--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:45:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/tsf/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1128.57         -1134.40
2      -1128.55         -1133.28
--------------------------------------
TOTAL    -1128.56         -1133.99
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899583    0.092207    0.383720    1.518548    0.855725   1449.94   1475.47    1.000
r(A<->C){all}   0.169499    0.021337    0.000001    0.462392    0.131912    230.62    259.79    1.001
r(A<->G){all}   0.149009    0.015366    0.000145    0.398898    0.119741    217.41    223.07    1.000
r(A<->T){all}   0.172846    0.021093    0.000075    0.460197    0.130092    115.28    187.49    1.003
r(C<->G){all}   0.175175    0.020564    0.000292    0.469295    0.138065    169.04    192.09    1.000
r(C<->T){all}   0.167918    0.020434    0.000089    0.466817    0.131144    229.30    251.70    1.001
r(G<->T){all}   0.165553    0.018606    0.000119    0.437529    0.128847    187.79    201.84    1.001
pi(A){all}      0.212833    0.000199    0.186594    0.240972    0.212438   1180.40   1261.01    1.000
pi(C){all}      0.277609    0.000238    0.246426    0.306544    0.277292   1245.79   1353.39    1.000
pi(G){all}      0.327000    0.000272    0.296205    0.360679    0.326681   1249.31   1289.82    1.000
pi(T){all}      0.182558    0.000177    0.156646    0.208003    0.181937   1302.86   1334.20    1.000
alpha{1,2}      0.435200    0.243246    0.000102    1.395722    0.257004   1300.60   1304.70    1.000
alpha{3}        0.459596    0.241624    0.000465    1.434397    0.293093   1334.32   1344.79    1.000
pinvar{all}     0.998114    0.000005    0.994027    0.999999    0.998825    968.95   1221.10    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1059.269873
Model 2: PositiveSelection	-1059.269865
Model 0: one-ratio	-1059.269872
Model 7: beta	-1059.269906
Model 8: beta&w>1	-1059.269864


Model 0 vs 1	1.99999976757681E-6

Model 2 vs 1	1.5999999959603883E-5

Model 8 vs 7	8.399999978792039E-5
>C1
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C2
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C3
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C4
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C5
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C6
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=276 

C1              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C2              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C3              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C4              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C5              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C6              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
                **************************************************

C1              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C2              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C3              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C4              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C5              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C6              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
                **************************************************

C1              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C2              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C3              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C4              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C5              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C6              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
                **************************************************

C1              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C2              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C3              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C4              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C5              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C6              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
                **************************************************

C1              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C2              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C3              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C4              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C5              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C6              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
                **************************************************

C1              KKTVKVLLDEAGVTVTRFVRFEVGQA
C2              KKTVKVLLDEAGVTVTRFVRFEVGQA
C3              KKTVKVLLDEAGVTVTRFVRFEVGQA
C4              KKTVKVLLDEAGVTVTRFVRFEVGQA
C5              KKTVKVLLDEAGVTVTRFVRFEVGQA
C6              KKTVKVLLDEAGVTVTRFVRFEVGQA
                **************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8280]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8280]--->[8280]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.500 Mb, Max= 30.833 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C2              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C3              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C4              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C5              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C6              MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
                **************************************************

C1              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C2              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C3              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C4              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C5              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C6              KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
                **************************************************

C1              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C2              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C3              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C4              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C5              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C6              IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
                **************************************************

C1              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C2              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C3              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C4              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C5              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C6              RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
                **************************************************

C1              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C2              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C3              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C4              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C5              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C6              DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
                **************************************************

C1              KKTVKVLLDEAGVTVTRFVRFEVGQA
C2              KKTVKVLLDEAGVTVTRFVRFEVGQA
C3              KKTVKVLLDEAGVTVTRFVRFEVGQA
C4              KKTVKVLLDEAGVTVTRFVRFEVGQA
C5              KKTVKVLLDEAGVTVTRFVRFEVGQA
C6              KKTVKVLLDEAGVTVTRFVRFEVGQA
                **************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C2              ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C3              ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C4              ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C5              ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C6              ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
                **************************************************

C1              TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C2              TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C3              TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C4              TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C5              TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C6              TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
                **************************************************

C1              TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C2              TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C3              TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C4              TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C5              TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C6              TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
                **************************************************

C1              AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C2              AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C3              AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C4              AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C5              AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C6              AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
                **************************************************

C1              TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C2              TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C3              TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C4              TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C5              TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C6              TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
                **************************************************

C1              AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C2              AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C3              AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C4              AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C5              AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C6              AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
                **************************************************

C1              ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C2              ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C3              ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C4              ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C5              ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C6              ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
                **************************************************

C1              CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C2              CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C3              CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C4              CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C5              CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C6              CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
                **************************************************

C1              TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C2              TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C3              TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C4              TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C5              TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C6              TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
                **************************************************

C1              CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C2              CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C3              CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C4              CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C5              CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C6              CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
                **************************************************

C1              CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C2              CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C3              CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C4              CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C5              CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C6              CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
                **************************************************

C1              AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C2              AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C3              AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C4              AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C5              AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C6              AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
                **************************************************

C1              GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C2              GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C3              GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C4              GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C5              GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C6              GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
                **************************************************

C1              GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C2              GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C3              GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C4              GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C5              GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C6              GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
                **************************************************

C1              GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C2              GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C3              GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C4              GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C5              GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C6              GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
                **************************************************

C1              AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C2              AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C3              AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C4              AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C5              AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C6              AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
                **************************************************

C1              ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C2              ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C3              ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C4              ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C5              ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C6              ATTCGTTCGGTTCGAGGTGGGCCAAGCC
                ****************************



>C1
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C2
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C3
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C4
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C5
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C6
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C1
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C2
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C3
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C4
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C5
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C6
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 828 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790661
      Setting output file names to "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 52805182
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0240173799
      Seed = 86233230
      Swapseed = 1579790661
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1853.103695 -- -24.965149
         Chain 2 -- -1853.103695 -- -24.965149
         Chain 3 -- -1853.103588 -- -24.965149
         Chain 4 -- -1853.103413 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1853.103588 -- -24.965149
         Chain 2 -- -1853.103695 -- -24.965149
         Chain 3 -- -1853.103695 -- -24.965149
         Chain 4 -- -1853.103588 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1853.104] (-1853.104) (-1853.104) (-1853.103) * [-1853.104] (-1853.104) (-1853.104) (-1853.104) 
        500 -- (-1134.273) (-1152.425) (-1138.337) [-1142.204] * [-1141.782] (-1148.460) (-1137.750) (-1157.622) -- 0:00:00
       1000 -- (-1141.249) (-1153.325) (-1140.590) [-1138.727] * (-1140.771) (-1138.500) (-1146.239) [-1138.849] -- 0:16:39
       1500 -- (-1137.862) (-1141.750) (-1138.966) [-1137.306] * (-1142.971) (-1135.110) (-1138.845) [-1138.462] -- 0:11:05
       2000 -- (-1146.523) (-1133.496) (-1139.510) [-1133.682] * [-1145.475] (-1140.887) (-1137.199) (-1139.153) -- 0:08:19
       2500 -- (-1136.957) (-1136.687) [-1138.719] (-1139.521) * (-1131.227) (-1135.787) [-1133.476] (-1139.547) -- 0:06:39
       3000 -- (-1139.805) (-1137.174) [-1140.466] (-1139.481) * (-1143.280) (-1144.370) (-1133.898) [-1137.417] -- 0:05:32
       3500 -- [-1138.776] (-1134.042) (-1137.636) (-1135.382) * [-1136.595] (-1140.404) (-1141.764) (-1140.476) -- 0:04:44
       4000 -- [-1134.342] (-1148.283) (-1141.556) (-1144.669) * (-1133.860) (-1134.570) [-1136.118] (-1141.173) -- 0:04:09
       4500 -- (-1135.777) (-1134.910) [-1133.982] (-1141.173) * (-1133.879) (-1138.479) (-1141.978) [-1133.326] -- 0:03:41
       5000 -- [-1139.536] (-1138.179) (-1138.897) (-1142.260) * [-1139.510] (-1150.182) (-1135.473) (-1139.076) -- 0:03:19

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-1145.256) (-1137.233) [-1142.297] (-1141.157) * (-1140.444) (-1137.514) [-1137.082] (-1136.671) -- 0:03:00
       6000 -- (-1137.150) (-1136.786) [-1135.198] (-1141.957) * (-1133.206) [-1130.959] (-1138.373) (-1142.944) -- 0:02:45
       6500 -- (-1141.285) (-1133.913) [-1133.243] (-1146.232) * (-1141.697) [-1137.594] (-1134.193) (-1142.559) -- 0:02:32
       7000 -- (-1140.424) (-1138.003) (-1140.188) [-1135.975] * [-1138.441] (-1141.659) (-1143.681) (-1131.063) -- 0:02:21
       7500 -- (-1133.627) (-1141.188) (-1135.710) [-1137.128] * (-1143.695) (-1137.350) [-1143.376] (-1142.063) -- 0:02:12
       8000 -- (-1135.947) (-1141.191) (-1141.108) [-1139.006] * [-1141.862] (-1141.229) (-1141.592) (-1139.452) -- 0:02:04
       8500 -- (-1139.656) [-1135.708] (-1145.821) (-1141.225) * [-1134.949] (-1138.334) (-1131.919) (-1135.421) -- 0:01:56
       9000 -- (-1133.509) [-1138.444] (-1137.904) (-1141.307) * [-1144.188] (-1137.108) (-1141.610) (-1141.148) -- 0:01:50
       9500 -- (-1140.769) (-1139.735) (-1144.533) [-1140.640] * [-1134.425] (-1138.655) (-1137.333) (-1137.479) -- 0:01:44
      10000 -- (-1137.582) (-1138.219) [-1136.437] (-1142.254) * (-1137.829) (-1140.241) (-1144.407) [-1139.925] -- 0:01:39

      Average standard deviation of split frequencies: 0.086179

      10500 -- (-1135.065) (-1133.642) (-1142.779) [-1135.866] * (-1138.004) [-1134.782] (-1135.979) (-1144.888) -- 0:01:34
      11000 -- (-1133.853) [-1141.417] (-1141.554) (-1137.559) * [-1133.306] (-1137.095) (-1140.154) (-1141.553) -- 0:01:29
      11500 -- (-1144.549) (-1131.146) [-1137.913] (-1134.432) * (-1142.530) (-1136.089) (-1137.745) [-1133.208] -- 0:01:25
      12000 -- (-1143.686) (-1141.384) (-1147.077) [-1135.164] * (-1140.622) (-1138.478) (-1135.575) [-1139.290] -- 0:01:22
      12500 -- (-1143.747) (-1136.660) [-1131.293] (-1139.543) * [-1137.458] (-1138.013) (-1138.451) (-1137.826) -- 0:01:19
      13000 -- (-1137.796) (-1137.864) (-1140.901) [-1133.919] * (-1138.673) (-1150.810) [-1138.913] (-1137.286) -- 0:01:15
      13500 -- (-1134.097) (-1139.093) [-1133.791] (-1131.752) * (-1144.458) (-1130.506) (-1139.051) [-1135.214] -- 0:01:13
      14000 -- [-1137.389] (-1144.746) (-1135.710) (-1140.147) * [-1140.537] (-1128.559) (-1139.494) (-1135.938) -- 0:01:10
      14500 -- (-1139.830) [-1137.283] (-1134.976) (-1139.869) * [-1134.050] (-1129.734) (-1133.457) (-1139.046) -- 0:01:07
      15000 -- [-1138.706] (-1142.493) (-1138.809) (-1141.112) * (-1147.558) (-1130.135) [-1135.262] (-1143.170) -- 0:01:05

      Average standard deviation of split frequencies: 0.063836

      15500 -- (-1135.729) (-1144.708) [-1140.397] (-1143.623) * (-1141.582) [-1130.832] (-1137.505) (-1143.493) -- 0:01:03
      16000 -- (-1139.676) (-1138.088) [-1142.880] (-1137.417) * (-1136.640) (-1130.266) (-1142.372) [-1143.225] -- 0:02:03
      16500 -- [-1140.460] (-1134.896) (-1137.560) (-1137.150) * [-1141.196] (-1129.628) (-1136.932) (-1143.163) -- 0:01:59
      17000 -- (-1147.091) (-1138.214) [-1133.979] (-1137.558) * (-1150.814) (-1130.204) (-1139.701) [-1135.073] -- 0:01:55
      17500 -- (-1142.293) (-1133.810) (-1137.623) [-1139.596] * [-1140.635] (-1129.161) (-1135.740) (-1137.606) -- 0:01:52
      18000 -- [-1141.838] (-1144.488) (-1135.980) (-1138.787) * (-1135.867) (-1128.890) [-1135.214] (-1142.447) -- 0:01:49
      18500 -- (-1135.816) (-1134.093) (-1139.812) [-1140.738] * (-1142.288) [-1134.504] (-1134.672) (-1132.509) -- 0:01:46
      19000 -- (-1138.608) (-1140.046) (-1141.240) [-1133.737] * (-1136.087) (-1129.889) [-1138.363] (-1140.341) -- 0:01:43
      19500 -- (-1135.574) [-1140.552] (-1135.879) (-1137.607) * (-1137.989) [-1128.898] (-1136.561) (-1134.170) -- 0:01:40
      20000 -- [-1136.614] (-1132.859) (-1140.000) (-1136.750) * (-1139.493) [-1128.610] (-1140.328) (-1145.900) -- 0:01:38

      Average standard deviation of split frequencies: 0.048661

      20500 -- (-1140.366) (-1134.867) (-1135.553) [-1134.854] * [-1133.502] (-1128.093) (-1138.772) (-1137.758) -- 0:01:35
      21000 -- [-1143.968] (-1133.905) (-1139.252) (-1133.797) * [-1141.971] (-1128.552) (-1147.498) (-1143.133) -- 0:01:33
      21500 -- (-1137.912) (-1139.076) [-1138.171] (-1134.144) * (-1143.525) (-1127.894) [-1136.808] (-1145.022) -- 0:01:31
      22000 -- (-1136.832) (-1135.788) (-1145.105) [-1135.428] * [-1134.623] (-1128.528) (-1137.181) (-1137.219) -- 0:01:28
      22500 -- (-1137.752) [-1133.087] (-1140.623) (-1138.169) * (-1142.557) [-1129.707] (-1134.607) (-1146.440) -- 0:01:26
      23000 -- (-1136.480) (-1143.346) (-1144.280) [-1140.129] * (-1141.962) (-1129.304) [-1135.671] (-1146.784) -- 0:01:24
      23500 -- (-1137.205) (-1138.997) (-1143.999) [-1135.054] * [-1135.773] (-1129.302) (-1140.688) (-1138.205) -- 0:01:23
      24000 -- (-1138.357) [-1144.907] (-1134.092) (-1135.316) * (-1134.465) (-1130.681) (-1135.015) [-1137.691] -- 0:01:21
      24500 -- [-1131.711] (-1149.361) (-1138.344) (-1146.689) * [-1138.987] (-1128.182) (-1143.980) (-1138.505) -- 0:01:19
      25000 -- [-1139.251] (-1137.730) (-1137.254) (-1129.560) * (-1135.496) (-1129.743) [-1138.651] (-1141.905) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-1133.654) (-1136.659) [-1134.631] (-1131.562) * [-1140.579] (-1129.722) (-1136.705) (-1144.016) -- 0:01:16
      26000 -- (-1141.421) (-1133.577) [-1134.004] (-1131.594) * (-1138.588) (-1129.615) [-1139.329] (-1136.765) -- 0:01:14
      26500 -- (-1137.620) (-1142.398) (-1148.994) [-1132.758] * (-1138.419) (-1130.785) (-1139.083) [-1137.483] -- 0:01:13
      27000 -- (-1142.244) [-1140.911] (-1134.501) (-1132.340) * (-1142.188) [-1132.935] (-1145.665) (-1141.950) -- 0:01:12
      27500 -- (-1133.020) (-1142.637) (-1144.339) [-1131.606] * (-1138.633) (-1129.372) [-1137.554] (-1142.826) -- 0:01:10
      28000 -- (-1137.379) [-1141.121] (-1140.189) (-1129.698) * [-1140.264] (-1129.993) (-1139.178) (-1138.667) -- 0:01:09
      28500 -- (-1133.729) [-1140.939] (-1136.393) (-1130.574) * (-1136.675) (-1128.562) [-1135.597] (-1147.176) -- 0:01:08
      29000 -- (-1141.441) (-1143.355) (-1137.325) [-1131.645] * (-1141.277) [-1130.230] (-1136.674) (-1155.154) -- 0:01:06
      29500 -- (-1141.471) (-1140.349) [-1134.627] (-1134.115) * (-1141.035) (-1129.011) (-1138.481) [-1128.603] -- 0:01:05
      30000 -- (-1146.133) [-1141.266] (-1136.983) (-1130.637) * (-1133.529) (-1127.531) (-1142.863) [-1129.195] -- 0:01:04

      Average standard deviation of split frequencies: 0.033626

      30500 -- (-1137.231) (-1136.763) (-1137.034) [-1131.218] * (-1138.731) (-1127.553) [-1143.479] (-1129.262) -- 0:01:03
      31000 -- (-1147.906) (-1137.362) (-1140.274) [-1132.938] * (-1134.412) (-1127.773) (-1146.169) [-1129.363] -- 0:01:33
      31500 -- (-1138.520) (-1137.806) [-1140.774] (-1131.342) * [-1139.098] (-1130.348) (-1136.548) (-1127.900) -- 0:01:32
      32000 -- (-1136.520) (-1135.643) [-1135.212] (-1127.659) * [-1138.246] (-1127.187) (-1135.711) (-1127.809) -- 0:01:30
      32500 -- (-1134.285) (-1139.568) (-1137.698) [-1131.254] * (-1149.443) (-1128.036) [-1140.355] (-1128.518) -- 0:01:29
      33000 -- [-1135.083] (-1138.406) (-1132.999) (-1129.128) * [-1135.257] (-1128.468) (-1136.331) (-1130.351) -- 0:01:27
      33500 -- (-1141.009) [-1138.248] (-1141.898) (-1127.644) * (-1137.268) (-1127.782) (-1137.985) [-1128.700] -- 0:01:26
      34000 -- (-1139.153) [-1140.480] (-1132.891) (-1127.444) * (-1138.398) [-1128.220] (-1144.572) (-1128.929) -- 0:01:25
      34500 -- (-1140.429) [-1140.183] (-1135.081) (-1127.847) * [-1132.123] (-1128.995) (-1133.228) (-1127.535) -- 0:01:23
      35000 -- (-1140.883) (-1143.259) (-1137.662) [-1131.105] * (-1136.238) (-1130.889) [-1140.790] (-1128.522) -- 0:01:22

      Average standard deviation of split frequencies: 0.037216

      35500 -- (-1138.504) (-1141.124) [-1133.651] (-1132.099) * (-1137.150) (-1129.595) [-1137.866] (-1127.934) -- 0:01:21
      36000 -- (-1134.985) (-1149.865) (-1139.360) [-1127.879] * (-1146.789) (-1128.376) (-1138.351) [-1128.241] -- 0:01:20
      36500 -- (-1142.609) (-1138.808) [-1136.798] (-1129.782) * (-1138.115) (-1128.132) [-1137.178] (-1128.933) -- 0:01:19
      37000 -- (-1135.509) (-1143.432) [-1133.097] (-1130.367) * (-1138.543) [-1127.362] (-1138.811) (-1128.913) -- 0:01:18
      37500 -- [-1137.634] (-1141.768) (-1138.164) (-1130.230) * (-1138.449) [-1129.744] (-1138.787) (-1130.793) -- 0:01:17
      38000 -- (-1142.678) [-1141.259] (-1140.591) (-1128.018) * [-1134.636] (-1129.302) (-1143.458) (-1128.973) -- 0:01:15
      38500 -- [-1140.376] (-1137.530) (-1138.426) (-1129.270) * (-1137.268) (-1131.542) [-1136.448] (-1129.653) -- 0:01:14
      39000 -- (-1146.847) (-1142.354) (-1139.571) [-1127.979] * (-1138.317) (-1127.201) (-1133.640) [-1128.776] -- 0:01:13
      39500 -- (-1150.540) (-1137.609) [-1138.027] (-1128.014) * [-1140.741] (-1127.939) (-1138.812) (-1128.916) -- 0:01:12
      40000 -- [-1138.282] (-1135.377) (-1144.035) (-1128.120) * (-1139.824) (-1131.166) [-1139.677] (-1129.177) -- 0:01:12

      Average standard deviation of split frequencies: 0.036064

      40500 -- (-1141.644) (-1139.666) [-1136.627] (-1128.400) * (-1133.975) (-1132.474) (-1138.252) [-1128.201] -- 0:01:11
      41000 -- [-1136.367] (-1142.448) (-1140.450) (-1128.886) * [-1141.816] (-1129.927) (-1136.207) (-1128.969) -- 0:01:10
      41500 -- (-1132.422) [-1137.017] (-1135.021) (-1131.736) * (-1135.379) (-1128.527) (-1133.968) [-1131.280] -- 0:01:09
      42000 -- (-1140.354) (-1138.602) (-1133.508) [-1129.227] * (-1138.709) (-1128.893) (-1151.622) [-1128.030] -- 0:01:08
      42500 -- [-1134.946] (-1130.753) (-1138.634) (-1128.634) * (-1137.168) (-1129.074) (-1133.241) [-1127.988] -- 0:01:07
      43000 -- (-1140.354) (-1140.664) [-1134.281] (-1129.470) * (-1143.219) (-1131.239) [-1140.585] (-1134.349) -- 0:01:06
      43500 -- [-1145.382] (-1142.490) (-1135.660) (-1130.607) * (-1137.837) [-1129.924] (-1137.664) (-1134.234) -- 0:01:05
      44000 -- (-1134.714) (-1139.853) [-1140.651] (-1130.196) * (-1139.436) (-1130.075) [-1137.705] (-1129.992) -- 0:01:05
      44500 -- [-1135.193] (-1136.772) (-1148.083) (-1130.572) * (-1140.037) (-1132.347) [-1137.925] (-1133.539) -- 0:01:04
      45000 -- (-1136.701) [-1141.883] (-1152.448) (-1130.711) * [-1139.837] (-1131.453) (-1145.828) (-1128.785) -- 0:01:03

      Average standard deviation of split frequencies: 0.027669

      45500 -- (-1137.349) [-1137.273] (-1140.322) (-1129.487) * (-1145.331) (-1133.050) [-1131.650] (-1135.668) -- 0:01:02
      46000 -- (-1136.019) (-1140.655) [-1133.667] (-1129.272) * (-1134.284) [-1132.217] (-1137.642) (-1129.376) -- 0:01:02
      46500 -- (-1135.078) [-1133.816] (-1140.057) (-1127.064) * [-1138.129] (-1129.849) (-1138.513) (-1129.527) -- 0:01:22
      47000 -- (-1135.587) [-1134.872] (-1140.749) (-1129.782) * (-1138.087) (-1131.155) [-1136.748] (-1129.389) -- 0:01:21
      47500 -- [-1133.988] (-1137.393) (-1144.835) (-1127.573) * (-1141.480) (-1133.094) [-1139.630] (-1130.643) -- 0:01:20
      48000 -- [-1145.093] (-1135.041) (-1145.819) (-1128.071) * (-1136.848) (-1131.604) (-1136.717) [-1129.038] -- 0:01:19
      48500 -- (-1138.522) (-1143.221) (-1139.421) [-1130.762] * (-1136.984) (-1130.898) [-1134.324] (-1130.755) -- 0:01:18
      49000 -- (-1137.254) (-1136.359) (-1138.571) [-1129.051] * (-1139.517) (-1129.102) [-1135.013] (-1132.557) -- 0:01:17
      49500 -- [-1137.457] (-1145.723) (-1137.747) (-1128.023) * (-1138.937) [-1128.121] (-1138.170) (-1137.587) -- 0:01:16
      50000 -- (-1142.570) (-1133.673) [-1135.064] (-1128.493) * (-1143.111) (-1127.388) (-1135.497) [-1130.834] -- 0:01:16

      Average standard deviation of split frequencies: 0.028891

      50500 -- (-1151.577) (-1138.214) [-1130.442] (-1129.071) * (-1138.828) [-1127.871] (-1140.980) (-1130.886) -- 0:01:15
      51000 -- (-1137.907) (-1136.309) [-1134.626] (-1128.209) * (-1140.051) (-1130.542) [-1139.300] (-1130.453) -- 0:01:14
      51500 -- (-1138.335) [-1137.415] (-1136.343) (-1129.452) * [-1138.208] (-1129.255) (-1135.543) (-1130.077) -- 0:01:13
      52000 -- [-1141.509] (-1134.866) (-1139.776) (-1128.285) * (-1138.344) (-1127.779) (-1142.841) [-1130.426] -- 0:01:12
      52500 -- (-1139.238) (-1135.744) [-1136.763] (-1131.553) * (-1140.129) (-1132.454) [-1135.122] (-1128.907) -- 0:01:12
      53000 -- (-1141.900) (-1142.182) [-1136.562] (-1132.036) * (-1133.146) (-1130.308) (-1133.693) [-1128.110] -- 0:01:11
      53500 -- (-1141.349) (-1134.227) (-1142.429) [-1129.636] * (-1147.627) (-1129.197) (-1134.839) [-1127.854] -- 0:01:10
      54000 -- [-1132.327] (-1139.023) (-1142.027) (-1134.829) * [-1139.851] (-1128.722) (-1136.715) (-1131.604) -- 0:01:10
      54500 -- (-1141.411) [-1135.698] (-1137.833) (-1129.765) * (-1131.802) [-1132.587] (-1148.818) (-1134.656) -- 0:01:09
      55000 -- (-1136.222) (-1140.389) [-1132.046] (-1128.587) * (-1136.267) [-1129.020] (-1138.417) (-1129.707) -- 0:01:08

      Average standard deviation of split frequencies: 0.031333

      55500 -- (-1150.607) [-1132.890] (-1142.710) (-1130.928) * (-1138.086) [-1131.041] (-1137.855) (-1129.065) -- 0:01:08
      56000 -- [-1146.058] (-1136.169) (-1138.175) (-1132.487) * (-1144.270) (-1130.543) [-1138.533] (-1130.571) -- 0:01:07
      56500 -- (-1136.970) [-1142.059] (-1138.802) (-1136.506) * (-1137.095) (-1128.574) [-1141.874] (-1133.670) -- 0:01:06
      57000 -- (-1141.237) [-1133.156] (-1139.748) (-1137.926) * (-1147.330) (-1133.391) [-1133.990] (-1134.827) -- 0:01:06
      57500 -- (-1144.846) [-1140.865] (-1134.508) (-1131.998) * (-1135.493) (-1128.730) [-1137.254] (-1126.977) -- 0:01:05
      58000 -- (-1138.393) (-1135.729) (-1135.157) [-1128.617] * (-1141.662) [-1128.154] (-1138.541) (-1126.984) -- 0:01:04
      58500 -- (-1138.467) (-1149.394) [-1140.437] (-1127.277) * (-1147.411) (-1128.410) (-1137.052) [-1127.069] -- 0:01:04
      59000 -- (-1136.575) (-1131.951) (-1133.353) [-1128.980] * [-1132.102] (-1128.227) (-1135.237) (-1131.588) -- 0:01:03
      59500 -- (-1139.711) (-1129.463) (-1144.824) [-1128.183] * [-1137.730] (-1128.096) (-1133.299) (-1130.335) -- 0:01:03
      60000 -- (-1133.690) (-1131.675) (-1137.461) [-1128.308] * [-1135.977] (-1128.196) (-1146.052) (-1131.265) -- 0:01:02

      Average standard deviation of split frequencies: 0.027196

      60500 -- (-1141.013) [-1131.439] (-1143.536) (-1128.307) * (-1135.055) (-1129.248) [-1138.078] (-1130.260) -- 0:01:02
      61000 -- (-1137.457) (-1131.435) (-1138.895) [-1129.838] * [-1135.746] (-1128.759) (-1139.246) (-1129.868) -- 0:01:01
      61500 -- [-1139.941] (-1129.632) (-1137.281) (-1131.262) * (-1146.869) [-1127.067] (-1136.054) (-1128.595) -- 0:01:01
      62000 -- [-1138.334] (-1131.854) (-1141.725) (-1129.509) * [-1134.937] (-1129.743) (-1138.379) (-1128.624) -- 0:01:00
      62500 -- (-1134.181) [-1129.873] (-1135.360) (-1127.755) * [-1144.873] (-1131.360) (-1134.621) (-1127.455) -- 0:01:15
      63000 -- (-1143.836) [-1129.905] (-1137.211) (-1128.270) * (-1138.135) (-1129.281) [-1135.629] (-1131.454) -- 0:01:14
      63500 -- (-1131.695) [-1131.203] (-1144.551) (-1129.084) * (-1141.236) (-1128.013) (-1134.943) [-1128.189] -- 0:01:13
      64000 -- (-1135.272) [-1129.520] (-1137.716) (-1128.529) * (-1137.112) [-1127.215] (-1140.153) (-1128.359) -- 0:01:13
      64500 -- (-1135.219) (-1130.049) [-1138.923] (-1128.013) * [-1137.052] (-1130.369) (-1141.768) (-1130.428) -- 0:01:12
      65000 -- [-1136.983] (-1131.468) (-1141.155) (-1129.119) * [-1144.070] (-1129.043) (-1137.769) (-1131.721) -- 0:01:11

      Average standard deviation of split frequencies: 0.022499

      65500 -- (-1142.066) [-1128.123] (-1143.492) (-1128.279) * (-1142.050) (-1127.823) (-1140.466) [-1131.686] -- 0:01:11
      66000 -- [-1139.123] (-1129.571) (-1137.631) (-1128.096) * (-1143.148) (-1128.985) [-1136.094] (-1130.330) -- 0:01:10
      66500 -- (-1138.821) [-1134.278] (-1136.448) (-1130.221) * (-1135.036) (-1128.292) (-1139.276) [-1129.370] -- 0:01:10
      67000 -- [-1137.942] (-1127.650) (-1135.088) (-1131.745) * [-1138.975] (-1127.870) (-1141.084) (-1129.107) -- 0:01:09
      67500 -- (-1138.932) (-1130.903) (-1145.036) [-1133.043] * (-1140.037) (-1127.419) [-1140.900] (-1129.066) -- 0:01:09
      68000 -- (-1138.381) (-1128.776) [-1133.752] (-1134.328) * [-1137.096] (-1127.705) (-1141.101) (-1133.173) -- 0:01:08
      68500 -- (-1136.444) (-1129.983) [-1134.817] (-1131.132) * (-1135.126) (-1127.704) (-1141.225) [-1136.587] -- 0:01:07
      69000 -- (-1143.670) [-1127.744] (-1136.339) (-1130.302) * (-1138.477) [-1126.994] (-1137.491) (-1134.351) -- 0:01:07
      69500 -- (-1129.881) [-1129.304] (-1133.602) (-1129.426) * (-1146.490) (-1127.388) (-1149.849) [-1130.448] -- 0:01:06
      70000 -- (-1133.529) (-1128.305) (-1140.812) [-1130.419] * (-1130.920) (-1127.619) (-1150.594) [-1128.548] -- 0:01:06

      Average standard deviation of split frequencies: 0.022470

      70500 -- [-1133.356] (-1129.178) (-1137.138) (-1129.791) * (-1137.170) (-1128.277) (-1134.154) [-1129.783] -- 0:01:05
      71000 -- (-1134.026) (-1129.442) [-1136.607] (-1127.426) * [-1138.391] (-1128.518) (-1134.220) (-1128.896) -- 0:01:05
      71500 -- (-1129.561) (-1130.102) [-1137.139] (-1130.648) * (-1139.483) (-1128.522) (-1139.268) [-1129.444] -- 0:01:04
      72000 -- [-1131.217] (-1130.994) (-1130.800) (-1132.013) * (-1139.722) (-1127.742) (-1133.589) [-1129.313] -- 0:01:04
      72500 -- (-1132.286) [-1128.258] (-1133.280) (-1129.223) * (-1140.128) (-1127.883) [-1131.548] (-1127.985) -- 0:01:03
      73000 -- (-1132.082) (-1128.770) [-1131.421] (-1127.313) * (-1134.037) (-1127.624) (-1128.980) [-1128.541] -- 0:01:03
      73500 -- [-1131.449] (-1130.426) (-1129.206) (-1127.335) * (-1139.510) (-1128.471) [-1127.839] (-1128.724) -- 0:01:03
      74000 -- [-1128.821] (-1132.526) (-1128.797) (-1127.335) * (-1136.083) (-1128.984) [-1127.794] (-1127.543) -- 0:01:02
      74500 -- [-1128.302] (-1133.021) (-1129.775) (-1128.537) * (-1135.147) [-1127.815] (-1130.122) (-1131.367) -- 0:01:02
      75000 -- [-1128.394] (-1129.719) (-1129.904) (-1128.529) * (-1137.149) (-1127.213) (-1128.419) [-1127.367] -- 0:01:01

      Average standard deviation of split frequencies: 0.019914

      75500 -- (-1127.873) [-1128.923] (-1129.500) (-1129.213) * (-1137.643) (-1130.139) [-1131.551] (-1129.124) -- 0:01:01
      76000 -- [-1128.492] (-1130.614) (-1129.815) (-1128.084) * (-1144.509) (-1129.783) (-1128.738) [-1128.672] -- 0:01:00
      76500 -- (-1133.189) (-1136.554) [-1132.180] (-1127.942) * (-1137.309) (-1130.937) [-1129.801] (-1127.905) -- 0:01:00
      77000 -- (-1131.714) (-1130.520) (-1128.875) [-1128.374] * (-1150.033) [-1127.565] (-1129.732) (-1128.761) -- 0:00:59
      77500 -- (-1130.507) [-1130.231] (-1128.845) (-1128.274) * (-1140.513) [-1128.568] (-1130.004) (-1128.802) -- 0:00:59
      78000 -- (-1130.567) (-1130.056) [-1128.858] (-1128.044) * (-1145.487) [-1131.608] (-1131.519) (-1127.989) -- 0:00:59
      78500 -- (-1127.769) (-1130.457) (-1127.666) [-1129.653] * [-1135.330] (-1131.525) (-1128.073) (-1130.413) -- 0:00:58
      79000 -- (-1130.040) (-1130.206) [-1127.231] (-1127.254) * [-1134.269] (-1128.719) (-1131.954) (-1128.739) -- 0:01:09
      79500 -- (-1127.672) (-1131.241) [-1127.996] (-1127.560) * (-1144.375) (-1135.996) [-1129.515] (-1128.412) -- 0:01:09
      80000 -- (-1132.784) (-1129.578) (-1131.910) [-1127.587] * [-1136.221] (-1141.927) (-1128.234) (-1128.111) -- 0:01:09

      Average standard deviation of split frequencies: 0.023765

      80500 -- (-1132.337) (-1131.429) [-1128.278] (-1131.299) * (-1140.717) [-1130.904] (-1128.351) (-1131.717) -- 0:01:08
      81000 -- (-1134.899) (-1130.595) (-1128.315) [-1128.156] * (-1140.638) (-1127.861) (-1134.207) [-1132.429] -- 0:01:08
      81500 -- (-1131.870) [-1128.796] (-1130.230) (-1129.704) * [-1133.994] (-1131.415) (-1127.750) (-1128.603) -- 0:01:07
      82000 -- (-1127.739) [-1127.459] (-1128.472) (-1129.704) * (-1137.939) (-1129.630) [-1129.126] (-1128.422) -- 0:01:07
      82500 -- [-1128.353] (-1127.826) (-1128.875) (-1128.240) * (-1135.804) (-1128.091) (-1129.032) [-1128.883] -- 0:01:06
      83000 -- (-1127.995) [-1130.334] (-1130.509) (-1128.452) * (-1141.583) (-1129.221) (-1128.699) [-1127.992] -- 0:01:06
      83500 -- [-1127.256] (-1129.638) (-1127.761) (-1129.296) * [-1138.330] (-1129.042) (-1128.731) (-1135.478) -- 0:01:05
      84000 -- [-1127.623] (-1132.738) (-1127.746) (-1127.765) * (-1139.245) [-1128.487] (-1131.176) (-1134.265) -- 0:01:05
      84500 -- (-1127.604) (-1130.069) (-1128.338) [-1129.090] * (-1136.739) (-1128.740) [-1128.621] (-1132.221) -- 0:01:05
      85000 -- (-1127.312) [-1129.873] (-1130.940) (-1129.804) * (-1137.701) [-1128.329] (-1129.175) (-1129.332) -- 0:01:04

      Average standard deviation of split frequencies: 0.022709

      85500 -- [-1131.026] (-1136.498) (-1130.970) (-1129.840) * (-1135.204) (-1129.126) [-1132.351] (-1128.722) -- 0:01:04
      86000 -- (-1129.979) (-1132.758) [-1128.720] (-1128.758) * (-1139.816) (-1130.053) (-1131.355) [-1128.829] -- 0:01:03
      86500 -- (-1127.738) (-1130.651) (-1129.507) [-1128.336] * (-1145.940) (-1127.887) (-1128.250) [-1128.568] -- 0:01:03
      87000 -- (-1128.416) (-1128.985) (-1128.264) [-1128.127] * (-1139.942) [-1133.903] (-1128.722) (-1128.865) -- 0:01:02
      87500 -- (-1129.732) (-1127.902) (-1130.264) [-1129.243] * [-1137.892] (-1133.124) (-1128.336) (-1131.164) -- 0:01:02
      88000 -- (-1128.973) (-1129.025) (-1131.695) [-1130.738] * (-1133.254) [-1129.791] (-1129.272) (-1129.043) -- 0:01:02
      88500 -- (-1130.318) (-1129.106) (-1129.028) [-1134.076] * (-1143.797) (-1133.186) [-1129.271] (-1128.515) -- 0:01:01
      89000 -- (-1129.663) (-1128.759) (-1129.234) [-1130.235] * (-1140.585) (-1129.390) [-1133.312] (-1128.532) -- 0:01:01
      89500 -- (-1129.574) [-1134.018] (-1129.651) (-1129.488) * (-1134.609) (-1135.889) (-1130.026) [-1129.740] -- 0:01:01
      90000 -- (-1129.663) [-1129.921] (-1129.623) (-1129.319) * (-1159.198) (-1129.147) (-1130.477) [-1131.357] -- 0:01:00

      Average standard deviation of split frequencies: 0.026302

      90500 -- (-1131.431) (-1131.062) (-1129.410) [-1131.602] * (-1140.203) [-1129.661] (-1129.702) (-1136.116) -- 0:01:00
      91000 -- (-1129.342) [-1132.715] (-1127.721) (-1130.978) * (-1144.588) (-1130.107) [-1130.088] (-1128.020) -- 0:00:59
      91500 -- (-1129.826) (-1132.201) (-1129.317) [-1128.316] * [-1132.588] (-1129.571) (-1129.396) (-1128.976) -- 0:00:59
      92000 -- (-1133.277) [-1128.007] (-1131.884) (-1129.246) * (-1129.043) (-1127.810) (-1129.833) [-1128.068] -- 0:00:59
      92500 -- (-1134.518) (-1127.785) (-1127.445) [-1131.250] * (-1129.030) (-1127.516) (-1130.488) [-1130.532] -- 0:00:58
      93000 -- (-1127.505) [-1128.377] (-1128.391) (-1130.699) * [-1129.333] (-1128.614) (-1128.262) (-1128.755) -- 0:00:58
      93500 -- [-1128.313] (-1129.531) (-1128.600) (-1133.499) * (-1127.720) (-1127.631) (-1128.383) [-1128.771] -- 0:00:58
      94000 -- (-1131.283) [-1130.402] (-1131.692) (-1130.565) * (-1133.935) (-1128.972) (-1127.342) [-1129.837] -- 0:00:57
      94500 -- [-1135.688] (-1129.360) (-1128.314) (-1140.057) * [-1130.084] (-1129.060) (-1127.870) (-1128.526) -- 0:00:57
      95000 -- (-1131.113) (-1130.995) [-1127.170] (-1138.683) * [-1129.755] (-1128.408) (-1127.710) (-1135.349) -- 0:01:06

      Average standard deviation of split frequencies: 0.020733

      95500 -- [-1128.282] (-1133.440) (-1128.212) (-1134.706) * (-1131.654) (-1128.193) (-1127.774) [-1131.740] -- 0:01:06
      96000 -- (-1130.094) [-1131.311] (-1127.406) (-1130.328) * (-1128.708) (-1127.908) (-1138.009) [-1127.896] -- 0:01:05
      96500 -- (-1129.086) (-1132.051) [-1127.420] (-1130.330) * (-1130.282) (-1127.207) (-1133.017) [-1128.179] -- 0:01:05
      97000 -- [-1129.667] (-1128.674) (-1131.623) (-1131.623) * [-1127.937] (-1128.786) (-1132.796) (-1128.727) -- 0:01:05
      97500 -- (-1133.412) (-1129.063) [-1132.565] (-1133.522) * (-1127.938) [-1131.796] (-1129.690) (-1127.909) -- 0:01:04
      98000 -- (-1129.978) [-1128.370] (-1128.235) (-1129.860) * (-1130.464) (-1135.108) [-1129.643] (-1129.135) -- 0:01:04
      98500 -- [-1128.494] (-1129.561) (-1129.492) (-1130.014) * [-1126.864] (-1134.812) (-1130.645) (-1129.005) -- 0:01:04
      99000 -- (-1129.758) (-1131.054) (-1127.539) [-1130.563] * (-1127.170) (-1128.837) [-1128.075] (-1130.354) -- 0:01:03
      99500 -- (-1129.188) (-1127.834) [-1130.099] (-1133.814) * (-1127.064) [-1128.731] (-1129.104) (-1129.681) -- 0:01:03
      100000 -- [-1129.904] (-1127.732) (-1127.700) (-1130.266) * (-1129.481) (-1128.437) [-1128.908] (-1128.554) -- 0:01:02

      Average standard deviation of split frequencies: 0.020195

      100500 -- [-1130.578] (-1129.374) (-1132.953) (-1127.757) * [-1127.299] (-1129.037) (-1128.264) (-1128.274) -- 0:01:02
      101000 -- (-1129.720) [-1127.844] (-1128.567) (-1127.858) * (-1127.231) [-1129.186] (-1128.498) (-1128.296) -- 0:01:02
      101500 -- (-1127.074) [-1128.360] (-1129.535) (-1130.162) * [-1127.446] (-1128.655) (-1132.270) (-1130.830) -- 0:01:01
      102000 -- (-1127.683) (-1128.513) (-1127.876) [-1127.920] * [-1132.692] (-1127.320) (-1128.450) (-1129.688) -- 0:01:01
      102500 -- (-1127.904) (-1128.406) [-1127.775] (-1127.850) * (-1132.457) (-1128.396) [-1130.139] (-1129.210) -- 0:01:01
      103000 -- (-1127.674) (-1130.663) [-1128.003] (-1129.954) * (-1128.740) (-1130.145) (-1127.522) [-1128.660] -- 0:01:00
      103500 -- (-1128.363) [-1129.229] (-1127.370) (-1129.319) * (-1128.510) (-1131.060) [-1127.566] (-1132.280) -- 0:01:00
      104000 -- (-1130.367) (-1129.750) (-1127.485) [-1128.336] * (-1129.782) (-1130.917) (-1127.945) [-1128.889] -- 0:01:00
      104500 -- [-1127.714] (-1128.921) (-1127.327) (-1132.618) * (-1128.176) (-1130.412) (-1129.992) [-1130.543] -- 0:00:59
      105000 -- [-1129.451] (-1128.361) (-1132.278) (-1131.996) * (-1131.514) (-1129.754) (-1127.416) [-1129.608] -- 0:00:59

      Average standard deviation of split frequencies: 0.020457

      105500 -- (-1128.130) [-1130.044] (-1129.393) (-1128.670) * [-1127.901] (-1128.524) (-1128.251) (-1130.005) -- 0:00:59
      106000 -- (-1127.971) (-1129.747) (-1130.841) [-1132.636] * [-1127.994] (-1128.190) (-1128.257) (-1129.586) -- 0:00:59
      106500 -- [-1133.015] (-1130.724) (-1128.239) (-1132.053) * [-1130.985] (-1130.006) (-1128.615) (-1134.333) -- 0:00:58
      107000 -- (-1129.582) (-1130.875) (-1128.324) [-1129.887] * (-1128.167) [-1128.756] (-1127.606) (-1133.847) -- 0:00:58
      107500 -- (-1129.776) [-1129.348] (-1128.427) (-1129.664) * (-1129.023) (-1130.171) [-1130.247] (-1133.063) -- 0:00:58
      108000 -- [-1127.566] (-1129.147) (-1128.115) (-1129.392) * (-1131.063) [-1128.202] (-1129.871) (-1132.461) -- 0:00:57
      108500 -- (-1127.691) (-1127.469) (-1136.034) [-1127.640] * [-1130.839] (-1127.752) (-1127.088) (-1130.910) -- 0:00:57
      109000 -- (-1127.350) (-1128.393) [-1128.258] (-1127.646) * (-1135.616) (-1129.206) [-1129.005] (-1130.998) -- 0:00:57
      109500 -- [-1131.171] (-1127.565) (-1129.448) (-1127.923) * (-1135.065) (-1127.749) [-1127.599] (-1129.834) -- 0:00:56
      110000 -- (-1129.985) (-1127.667) [-1132.022] (-1128.550) * (-1128.799) (-1127.520) [-1129.565] (-1130.006) -- 0:00:56

      Average standard deviation of split frequencies: 0.023765

      110500 -- (-1130.085) [-1131.269] (-1129.824) (-1131.046) * [-1128.894] (-1127.497) (-1128.394) (-1129.717) -- 0:00:56
      111000 -- (-1128.128) (-1127.537) (-1131.296) [-1128.947] * (-1128.396) (-1131.157) (-1128.355) [-1130.833] -- 0:01:04
      111500 -- (-1128.199) [-1127.749] (-1129.540) (-1128.198) * (-1128.775) [-1129.675] (-1133.076) (-1131.428) -- 0:01:03
      112000 -- (-1127.873) (-1127.313) [-1132.002] (-1128.916) * (-1127.353) (-1131.052) [-1129.071] (-1133.593) -- 0:01:03
      112500 -- (-1128.087) (-1128.125) [-1128.611] (-1133.339) * (-1128.865) (-1130.945) (-1135.502) [-1130.931] -- 0:01:03
      113000 -- (-1127.768) (-1127.417) [-1130.025] (-1130.579) * [-1128.380] (-1129.825) (-1130.798) (-1130.096) -- 0:01:02
      113500 -- (-1128.534) (-1127.203) [-1128.472] (-1132.370) * (-1129.023) (-1132.436) [-1130.636] (-1131.947) -- 0:01:02
      114000 -- [-1127.919] (-1127.026) (-1130.264) (-1128.469) * (-1133.179) (-1132.426) [-1130.151] (-1130.688) -- 0:01:02
      114500 -- (-1127.614) [-1128.980] (-1131.230) (-1128.365) * (-1134.729) (-1133.821) [-1130.556] (-1131.176) -- 0:01:01
      115000 -- [-1128.661] (-1130.543) (-1128.309) (-1129.084) * (-1132.671) (-1135.820) (-1129.289) [-1132.760] -- 0:01:01

      Average standard deviation of split frequencies: 0.020558

      115500 -- (-1127.331) (-1132.981) [-1129.518] (-1130.002) * (-1129.359) [-1129.568] (-1129.265) (-1127.992) -- 0:01:01
      116000 -- (-1131.457) (-1129.540) [-1128.089] (-1130.065) * (-1129.733) [-1131.293] (-1130.880) (-1129.967) -- 0:01:00
      116500 -- (-1137.289) (-1129.260) (-1127.656) [-1129.516] * (-1129.855) (-1128.958) (-1132.808) [-1133.312] -- 0:01:00
      117000 -- [-1128.930] (-1131.858) (-1129.318) (-1129.727) * (-1133.521) (-1130.273) (-1130.305) [-1131.270] -- 0:01:00
      117500 -- [-1133.057] (-1130.217) (-1130.646) (-1130.308) * [-1128.396] (-1129.035) (-1128.426) (-1138.459) -- 0:01:00
      118000 -- (-1135.172) (-1130.147) [-1131.369] (-1131.053) * (-1130.454) (-1129.733) [-1129.683] (-1131.299) -- 0:00:59
      118500 -- (-1129.340) [-1130.449] (-1130.347) (-1129.412) * (-1127.099) [-1130.759] (-1131.414) (-1134.165) -- 0:00:59
      119000 -- (-1131.056) (-1129.538) (-1130.148) [-1130.395] * [-1127.896] (-1128.676) (-1131.613) (-1132.550) -- 0:00:59
      119500 -- (-1128.967) (-1129.754) (-1130.457) [-1128.879] * (-1128.015) [-1130.666] (-1128.569) (-1129.301) -- 0:00:58
      120000 -- (-1128.111) [-1131.935] (-1128.136) (-1136.474) * (-1129.598) [-1130.037] (-1131.525) (-1134.419) -- 0:00:58

      Average standard deviation of split frequencies: 0.023440

      120500 -- (-1127.559) (-1128.625) [-1129.031] (-1131.065) * (-1129.502) (-1131.581) (-1129.261) [-1129.555] -- 0:00:58
      121000 -- [-1128.887] (-1131.403) (-1133.812) (-1129.035) * (-1127.628) (-1130.355) [-1129.657] (-1130.228) -- 0:00:58
      121500 -- [-1128.769] (-1132.032) (-1133.812) (-1128.581) * (-1131.405) (-1129.725) (-1129.236) [-1135.194] -- 0:00:57
      122000 -- (-1128.731) (-1128.325) (-1128.740) [-1129.197] * (-1132.048) (-1129.189) (-1129.781) [-1132.811] -- 0:00:57
      122500 -- [-1129.235] (-1129.399) (-1128.463) (-1130.593) * (-1131.799) (-1128.590) [-1129.587] (-1129.051) -- 0:00:57
      123000 -- (-1130.350) (-1131.638) (-1128.988) [-1127.512] * (-1128.262) (-1128.411) (-1128.216) [-1129.322] -- 0:00:57
      123500 -- (-1131.269) (-1137.237) [-1129.136] (-1131.441) * (-1128.706) (-1128.497) [-1128.785] (-1129.093) -- 0:00:56
      124000 -- [-1130.086] (-1127.763) (-1128.499) (-1129.203) * (-1128.503) [-1127.900] (-1131.074) (-1128.779) -- 0:00:56
      124500 -- (-1128.055) (-1128.139) (-1128.945) [-1129.636] * (-1127.793) (-1128.315) [-1130.226] (-1129.755) -- 0:00:56
      125000 -- (-1128.082) (-1130.411) (-1127.813) [-1130.132] * [-1128.227] (-1127.583) (-1130.538) (-1128.045) -- 0:00:56

      Average standard deviation of split frequencies: 0.021788

      125500 -- (-1129.451) (-1129.600) (-1127.752) [-1130.227] * (-1128.586) (-1133.057) (-1128.716) [-1129.456] -- 0:00:55
      126000 -- [-1129.263] (-1130.764) (-1128.549) (-1130.362) * (-1129.738) (-1131.136) [-1128.299] (-1128.697) -- 0:00:55
      126500 -- (-1127.547) (-1129.037) (-1130.656) [-1129.544] * [-1129.575] (-1132.636) (-1127.871) (-1129.046) -- 0:00:55
      127000 -- (-1128.306) (-1128.565) (-1129.256) [-1131.639] * [-1129.788] (-1129.898) (-1129.591) (-1129.163) -- 0:00:54
      127500 -- (-1128.148) (-1131.392) [-1131.310] (-1131.917) * (-1129.234) (-1131.470) (-1129.631) [-1129.039] -- 0:01:01
      128000 -- (-1128.129) (-1129.919) [-1131.696] (-1129.883) * (-1127.187) (-1132.742) [-1130.431] (-1128.049) -- 0:01:01
      128500 -- (-1130.810) (-1128.121) [-1130.143] (-1126.990) * (-1129.681) (-1132.169) [-1129.523] (-1129.625) -- 0:01:01
      129000 -- [-1129.646] (-1127.175) (-1131.922) (-1128.096) * (-1129.068) (-1129.867) (-1129.002) [-1131.120] -- 0:01:00
      129500 -- (-1129.431) (-1129.887) [-1128.319] (-1127.326) * [-1130.355] (-1130.600) (-1129.829) (-1131.859) -- 0:01:00
      130000 -- (-1129.041) (-1130.915) [-1128.102] (-1128.832) * (-1128.838) (-1130.260) (-1130.370) [-1127.904] -- 0:01:00

      Average standard deviation of split frequencies: 0.023344

      130500 -- (-1128.645) (-1130.438) [-1132.073] (-1130.641) * (-1129.942) (-1128.472) [-1131.015] (-1129.843) -- 0:00:59
      131000 -- [-1130.497] (-1131.652) (-1128.703) (-1129.889) * (-1127.721) (-1128.573) (-1132.283) [-1128.395] -- 0:00:59
      131500 -- [-1132.633] (-1130.322) (-1127.450) (-1128.636) * (-1131.203) (-1127.821) [-1129.303] (-1128.187) -- 0:00:59
      132000 -- (-1132.301) [-1129.787] (-1129.228) (-1127.226) * (-1130.863) (-1127.749) [-1129.766] (-1128.198) -- 0:00:59
      132500 -- (-1132.793) (-1135.119) [-1128.233] (-1130.416) * [-1135.295] (-1128.171) (-1129.700) (-1128.940) -- 0:00:58
      133000 -- (-1131.347) (-1133.098) (-1128.398) [-1130.019] * (-1128.394) (-1128.578) (-1128.173) [-1129.191] -- 0:00:58
      133500 -- (-1128.733) (-1130.340) (-1129.309) [-1128.297] * [-1127.909] (-1127.697) (-1128.678) (-1130.965) -- 0:00:58
      134000 -- [-1127.868] (-1129.639) (-1128.923) (-1131.770) * [-1128.224] (-1127.352) (-1130.350) (-1132.353) -- 0:00:58
      134500 -- (-1129.237) (-1129.788) (-1130.594) [-1128.470] * (-1129.416) (-1128.491) [-1128.430] (-1131.061) -- 0:00:57
      135000 -- [-1131.738] (-1129.765) (-1134.958) (-1131.415) * (-1128.819) [-1131.680] (-1127.589) (-1130.755) -- 0:00:57

      Average standard deviation of split frequencies: 0.021014

      135500 -- (-1130.895) [-1128.375] (-1132.943) (-1130.085) * [-1129.860] (-1130.429) (-1132.540) (-1131.182) -- 0:00:57
      136000 -- (-1128.558) (-1133.852) (-1130.604) [-1127.316] * (-1130.148) (-1128.627) [-1129.004] (-1129.798) -- 0:00:57
      136500 -- [-1129.842] (-1129.255) (-1130.725) (-1127.908) * [-1130.290] (-1128.701) (-1127.077) (-1130.367) -- 0:00:56
      137000 -- (-1129.415) [-1128.383] (-1129.789) (-1127.968) * (-1129.622) [-1129.395] (-1129.987) (-1137.272) -- 0:00:56
      137500 -- (-1128.579) (-1132.033) (-1128.951) [-1127.944] * (-1131.280) [-1128.295] (-1127.164) (-1128.924) -- 0:00:56
      138000 -- [-1129.407] (-1127.948) (-1128.040) (-1127.384) * (-1128.173) (-1128.285) (-1131.116) [-1128.835] -- 0:00:56
      138500 -- (-1129.454) (-1129.078) [-1129.969] (-1132.215) * (-1129.344) [-1130.687] (-1127.474) (-1130.149) -- 0:00:55
      139000 -- (-1127.850) [-1127.288] (-1128.819) (-1133.070) * (-1129.175) (-1128.307) [-1128.482] (-1131.632) -- 0:00:55
      139500 -- [-1130.119] (-1127.959) (-1128.462) (-1129.165) * [-1129.611] (-1128.922) (-1129.421) (-1131.102) -- 0:00:55
      140000 -- (-1127.956) (-1129.039) (-1127.834) [-1129.173] * (-1130.621) (-1128.419) (-1128.970) [-1130.224] -- 0:00:55

      Average standard deviation of split frequencies: 0.021155

      140500 -- (-1134.611) [-1128.117] (-1127.848) (-1128.199) * (-1129.125) [-1130.149] (-1128.323) (-1129.980) -- 0:00:55
      141000 -- (-1130.139) (-1129.619) (-1132.826) [-1127.348] * [-1130.948] (-1129.362) (-1127.413) (-1130.570) -- 0:00:54
      141500 -- (-1128.651) (-1129.766) (-1133.829) [-1129.089] * (-1132.350) (-1130.560) [-1127.600] (-1129.195) -- 0:00:54
      142000 -- (-1127.354) (-1129.432) (-1131.796) [-1130.449] * (-1130.179) [-1129.316] (-1127.450) (-1131.933) -- 0:00:54
      142500 -- (-1132.824) [-1129.209] (-1131.249) (-1128.136) * (-1127.330) (-1128.798) [-1128.242] (-1129.253) -- 0:00:54
      143000 -- [-1129.267] (-1127.898) (-1130.633) (-1128.141) * (-1128.467) (-1127.399) [-1126.957] (-1129.270) -- 0:00:53
      143500 -- (-1130.528) (-1127.898) [-1130.961] (-1129.592) * (-1128.712) [-1129.680] (-1131.911) (-1127.817) -- 0:00:53
      144000 -- (-1129.549) (-1127.788) [-1128.627] (-1127.027) * (-1128.483) [-1129.329] (-1132.541) (-1127.962) -- 0:00:59
      144500 -- (-1129.783) (-1127.915) [-1127.728] (-1128.746) * (-1132.464) (-1128.855) [-1130.983] (-1127.417) -- 0:00:59
      145000 -- [-1130.996] (-1129.071) (-1131.098) (-1130.253) * (-1129.334) (-1128.330) (-1132.198) [-1128.869] -- 0:00:58

      Average standard deviation of split frequencies: 0.020892

      145500 -- [-1128.279] (-1129.329) (-1129.862) (-1127.379) * (-1130.604) (-1128.358) [-1128.014] (-1128.573) -- 0:00:58
      146000 -- (-1127.835) (-1130.041) (-1130.744) [-1127.580] * [-1130.410] (-1131.076) (-1131.822) (-1127.828) -- 0:00:58
      146500 -- (-1129.938) [-1127.305] (-1129.961) (-1128.034) * [-1129.099] (-1133.339) (-1128.096) (-1127.845) -- 0:00:58
      147000 -- (-1131.882) (-1133.907) [-1129.715] (-1128.994) * (-1128.519) (-1131.760) (-1128.725) [-1127.667] -- 0:00:58
      147500 -- (-1128.748) (-1131.655) (-1128.883) [-1132.810] * (-1130.419) (-1127.609) [-1128.506] (-1129.487) -- 0:00:57
      148000 -- [-1127.711] (-1131.359) (-1129.535) (-1129.395) * [-1128.985] (-1129.007) (-1132.822) (-1130.502) -- 0:00:57
      148500 -- (-1131.852) (-1129.181) (-1133.619) [-1128.278] * (-1128.063) (-1127.379) (-1129.817) [-1128.299] -- 0:00:57
      149000 -- [-1127.682] (-1128.998) (-1132.683) (-1128.972) * (-1131.037) (-1127.660) (-1137.104) [-1129.125] -- 0:00:57
      149500 -- (-1128.591) [-1130.368] (-1130.482) (-1129.956) * (-1132.043) [-1127.718] (-1132.055) (-1130.438) -- 0:00:56
      150000 -- (-1128.816) (-1131.311) [-1130.531] (-1129.548) * (-1128.622) [-1128.355] (-1131.666) (-1128.082) -- 0:00:56

      Average standard deviation of split frequencies: 0.023190

      150500 -- (-1131.114) [-1127.446] (-1128.315) (-1128.135) * (-1129.801) [-1129.269] (-1132.571) (-1127.974) -- 0:00:56
      151000 -- (-1127.072) (-1130.994) [-1127.902] (-1130.556) * (-1128.478) [-1128.300] (-1133.641) (-1129.533) -- 0:00:56
      151500 -- (-1127.446) (-1132.446) [-1129.341] (-1130.258) * [-1128.762] (-1132.253) (-1128.929) (-1128.511) -- 0:00:56
      152000 -- (-1130.821) (-1131.694) (-1129.336) [-1131.117] * (-1128.227) [-1127.304] (-1128.929) (-1132.337) -- 0:00:55
      152500 -- (-1129.694) (-1133.661) [-1128.507] (-1129.753) * [-1128.758] (-1128.683) (-1130.233) (-1128.739) -- 0:00:55
      153000 -- (-1128.529) (-1129.585) [-1131.375] (-1130.305) * (-1130.308) [-1128.057] (-1128.683) (-1127.351) -- 0:00:55
      153500 -- [-1127.779] (-1129.651) (-1130.019) (-1129.493) * (-1129.963) (-1127.017) (-1131.549) [-1127.977] -- 0:00:55
      154000 -- (-1132.390) [-1128.734] (-1129.001) (-1129.896) * (-1130.823) (-1129.722) (-1132.217) [-1128.156] -- 0:00:54
      154500 -- [-1130.613] (-1128.905) (-1129.632) (-1132.147) * (-1132.238) [-1129.603] (-1132.075) (-1132.795) -- 0:00:54
      155000 -- (-1128.345) (-1128.402) [-1133.179] (-1131.795) * [-1132.571] (-1129.603) (-1132.007) (-1131.785) -- 0:00:54

      Average standard deviation of split frequencies: 0.022930

      155500 -- (-1129.353) (-1128.346) (-1128.789) [-1129.347] * (-1132.718) (-1129.090) [-1132.414] (-1131.181) -- 0:00:54
      156000 -- (-1130.014) (-1128.928) [-1127.898] (-1129.857) * (-1128.641) (-1127.515) (-1127.794) [-1128.368] -- 0:00:54
      156500 -- (-1129.508) (-1129.209) (-1127.898) [-1129.235] * (-1127.971) (-1130.279) (-1127.898) [-1129.864] -- 0:00:53
      157000 -- (-1129.351) (-1127.988) [-1128.963] (-1131.528) * (-1128.559) [-1128.826] (-1127.284) (-1127.942) -- 0:00:53
      157500 -- (-1133.235) [-1129.877] (-1133.138) (-1132.775) * (-1127.963) [-1131.299] (-1128.806) (-1128.313) -- 0:00:53
      158000 -- (-1134.029) (-1127.734) [-1129.185] (-1137.007) * [-1128.916] (-1128.406) (-1128.014) (-1129.067) -- 0:00:53
      158500 -- (-1138.694) [-1128.149] (-1130.268) (-1131.656) * [-1129.361] (-1128.956) (-1128.239) (-1128.384) -- 0:00:53
      159000 -- (-1129.604) (-1132.406) [-1133.636] (-1128.257) * [-1132.359] (-1127.855) (-1129.152) (-1130.411) -- 0:00:52
      159500 -- [-1128.802] (-1130.466) (-1127.562) (-1130.094) * (-1127.930) [-1130.016] (-1129.123) (-1131.328) -- 0:00:52
      160000 -- (-1132.116) [-1130.304] (-1129.820) (-1129.611) * [-1129.541] (-1134.812) (-1128.891) (-1133.312) -- 0:00:57

      Average standard deviation of split frequencies: 0.022955

      160500 -- (-1132.134) (-1128.413) [-1127.389] (-1129.519) * [-1130.830] (-1127.913) (-1130.529) (-1128.881) -- 0:00:57
      161000 -- (-1130.604) (-1131.991) (-1129.204) [-1128.711] * (-1129.385) (-1128.406) [-1128.253] (-1129.346) -- 0:00:57
      161500 -- (-1130.792) (-1130.851) (-1127.938) [-1130.203] * (-1128.818) [-1128.092] (-1128.664) (-1129.236) -- 0:00:57
      162000 -- (-1129.148) [-1129.440] (-1128.793) (-1129.282) * [-1129.513] (-1128.223) (-1128.205) (-1129.742) -- 0:00:56
      162500 -- (-1130.193) (-1132.081) (-1127.375) [-1129.291] * [-1127.643] (-1128.921) (-1127.576) (-1134.744) -- 0:00:56
      163000 -- (-1133.084) (-1129.154) [-1127.631] (-1128.006) * (-1128.054) [-1128.630] (-1128.555) (-1130.764) -- 0:00:56
      163500 -- (-1132.110) (-1127.895) [-1127.333] (-1128.289) * (-1128.929) (-1130.091) (-1130.822) [-1133.277] -- 0:00:56
      164000 -- (-1134.251) [-1127.699] (-1128.794) (-1128.102) * (-1127.917) (-1132.453) [-1130.369] (-1131.035) -- 0:00:56
      164500 -- (-1130.177) (-1131.661) [-1127.665] (-1128.878) * (-1129.126) (-1133.710) [-1132.911] (-1128.769) -- 0:00:55
      165000 -- [-1130.875] (-1131.268) (-1128.545) (-1129.310) * [-1129.390] (-1131.229) (-1129.033) (-1130.067) -- 0:00:55

      Average standard deviation of split frequencies: 0.022551

      165500 -- (-1130.978) (-1128.469) (-1127.734) [-1129.401] * (-1129.343) [-1131.230] (-1129.161) (-1127.477) -- 0:00:55
      166000 -- (-1130.471) (-1129.232) (-1130.212) [-1129.402] * (-1127.971) (-1132.427) (-1131.134) [-1128.943] -- 0:00:55
      166500 -- (-1129.790) (-1131.729) [-1133.350] (-1131.541) * (-1131.287) (-1132.747) [-1129.971] (-1129.131) -- 0:00:55
      167000 -- (-1130.640) (-1129.783) [-1130.803] (-1135.381) * (-1132.257) (-1130.309) (-1128.466) [-1129.633] -- 0:00:54
      167500 -- (-1128.856) [-1128.660] (-1131.167) (-1130.669) * (-1132.226) (-1130.075) [-1128.151] (-1129.078) -- 0:00:54
      168000 -- (-1128.993) [-1128.677] (-1132.683) (-1132.772) * [-1131.627] (-1130.089) (-1137.870) (-1129.734) -- 0:00:54
      168500 -- (-1128.336) [-1128.980] (-1130.829) (-1131.570) * (-1131.039) (-1132.781) (-1135.879) [-1131.026] -- 0:00:54
      169000 -- (-1130.395) [-1128.436] (-1130.861) (-1129.975) * [-1129.307] (-1128.787) (-1128.367) (-1128.646) -- 0:00:54
      169500 -- [-1129.793] (-1127.312) (-1130.924) (-1131.249) * [-1129.535] (-1128.449) (-1127.543) (-1129.589) -- 0:00:53
      170000 -- (-1131.540) (-1128.892) (-1135.312) [-1130.480] * (-1129.392) (-1127.670) (-1131.076) [-1130.140] -- 0:00:53

      Average standard deviation of split frequencies: 0.019795

      170500 -- (-1128.763) (-1128.770) [-1128.643] (-1132.836) * (-1132.144) (-1129.579) (-1129.575) [-1129.032] -- 0:00:53
      171000 -- (-1134.447) (-1128.261) (-1130.496) [-1129.966] * (-1127.482) [-1127.538] (-1131.197) (-1128.879) -- 0:00:53
      171500 -- (-1130.205) [-1129.587] (-1129.055) (-1129.606) * (-1129.325) (-1128.388) (-1135.003) [-1128.539] -- 0:00:53
      172000 -- (-1129.780) (-1129.228) [-1128.033] (-1131.168) * (-1130.755) (-1128.388) (-1134.677) [-1127.204] -- 0:00:52
      172500 -- (-1134.577) [-1128.631] (-1129.828) (-1131.257) * [-1130.446] (-1131.303) (-1129.416) (-1127.031) -- 0:00:52
      173000 -- (-1134.023) [-1129.150] (-1130.731) (-1130.863) * (-1133.181) (-1128.751) [-1128.980] (-1128.032) -- 0:00:52
      173500 -- (-1135.919) [-1127.819] (-1128.299) (-1130.147) * (-1128.663) (-1128.254) (-1128.365) [-1127.907] -- 0:00:52
      174000 -- (-1131.316) [-1128.601] (-1135.375) (-1130.500) * (-1128.666) [-1128.323] (-1128.209) (-1130.862) -- 0:00:52
      174500 -- [-1131.111] (-1127.866) (-1128.137) (-1128.170) * (-1127.725) (-1128.093) [-1129.832] (-1128.527) -- 0:00:52
      175000 -- (-1128.245) (-1128.410) [-1128.456] (-1130.850) * (-1127.725) (-1134.535) (-1128.676) [-1127.669] -- 0:00:51

      Average standard deviation of split frequencies: 0.016815

      175500 -- (-1128.397) (-1127.849) [-1127.330] (-1127.892) * (-1127.714) (-1130.443) [-1130.870] (-1128.901) -- 0:00:51
      176000 -- (-1128.679) (-1128.324) (-1127.424) [-1128.770] * (-1127.966) (-1127.676) [-1130.870] (-1127.450) -- 0:00:51
      176500 -- [-1127.858] (-1127.384) (-1128.549) (-1128.814) * [-1127.446] (-1130.068) (-1128.765) (-1127.926) -- 0:00:55
      177000 -- (-1128.093) (-1129.380) [-1129.047] (-1128.732) * (-1127.896) (-1130.274) (-1133.029) [-1128.630] -- 0:00:55
      177500 -- [-1129.488] (-1129.798) (-1132.237) (-1129.206) * (-1128.428) [-1131.266] (-1129.292) (-1127.639) -- 0:00:55
      178000 -- (-1129.083) [-1128.493] (-1128.375) (-1129.553) * (-1130.606) (-1131.031) [-1128.993] (-1127.976) -- 0:00:55
      178500 -- (-1128.418) [-1128.434] (-1130.161) (-1128.770) * (-1132.193) (-1129.524) [-1127.342] (-1128.670) -- 0:00:55
      179000 -- (-1128.135) [-1128.510] (-1130.487) (-1130.118) * [-1130.472] (-1128.370) (-1128.087) (-1129.101) -- 0:00:55
      179500 -- (-1135.204) (-1133.486) [-1132.834] (-1129.465) * (-1129.892) (-1130.524) [-1128.409] (-1128.270) -- 0:00:54
      180000 -- (-1134.208) (-1128.841) [-1128.046] (-1131.659) * (-1128.345) (-1138.689) [-1127.591] (-1129.705) -- 0:00:54

      Average standard deviation of split frequencies: 0.016205

      180500 -- (-1133.738) [-1127.785] (-1129.300) (-1128.954) * [-1128.446] (-1131.370) (-1130.543) (-1129.114) -- 0:00:54
      181000 -- (-1130.795) (-1128.002) (-1127.901) [-1134.229] * (-1130.248) (-1127.688) [-1130.448] (-1131.481) -- 0:00:54
      181500 -- (-1130.983) [-1127.181] (-1128.910) (-1130.319) * [-1127.661] (-1128.045) (-1129.391) (-1127.596) -- 0:00:54
      182000 -- (-1135.345) [-1127.832] (-1127.469) (-1130.188) * [-1132.385] (-1129.385) (-1127.803) (-1127.134) -- 0:00:53
      182500 -- (-1128.064) [-1127.380] (-1127.497) (-1127.382) * (-1129.199) (-1128.662) (-1128.412) [-1127.739] -- 0:00:53
      183000 -- (-1127.697) [-1127.627] (-1127.788) (-1129.275) * (-1132.434) (-1129.289) (-1128.840) [-1128.913] -- 0:00:53
      183500 -- (-1134.657) [-1129.599] (-1128.418) (-1130.747) * (-1129.516) (-1130.003) [-1129.709] (-1127.857) -- 0:00:53
      184000 -- (-1132.555) (-1129.666) (-1128.170) [-1134.281] * [-1132.213] (-1137.369) (-1128.046) (-1127.825) -- 0:00:53
      184500 -- (-1128.111) (-1129.233) [-1128.315] (-1137.779) * (-1130.658) (-1130.431) [-1128.371] (-1127.593) -- 0:00:53
      185000 -- (-1129.076) (-1128.206) [-1128.265] (-1130.867) * (-1131.518) (-1131.474) (-1127.539) [-1127.554] -- 0:00:52

      Average standard deviation of split frequencies: 0.015840

      185500 -- (-1133.694) (-1128.315) [-1129.220] (-1128.690) * (-1128.710) [-1128.216] (-1130.505) (-1128.484) -- 0:00:52
      186000 -- (-1134.589) [-1128.190] (-1131.917) (-1127.693) * (-1131.479) (-1128.539) [-1128.292] (-1127.769) -- 0:00:52
      186500 -- (-1134.899) (-1129.321) [-1131.945] (-1128.932) * (-1127.411) [-1130.569] (-1130.609) (-1130.951) -- 0:00:52
      187000 -- (-1129.953) (-1129.235) (-1131.624) [-1129.622] * (-1128.221) [-1128.888] (-1134.582) (-1134.764) -- 0:00:52
      187500 -- (-1128.266) (-1130.465) (-1132.466) [-1130.127] * [-1127.705] (-1127.443) (-1131.562) (-1132.639) -- 0:00:52
      188000 -- (-1130.386) [-1129.349] (-1129.352) (-1130.229) * (-1128.578) (-1131.510) (-1132.392) [-1129.450] -- 0:00:51
      188500 -- (-1132.242) (-1128.022) (-1131.237) [-1127.481] * [-1129.178] (-1129.916) (-1131.514) (-1129.394) -- 0:00:51
      189000 -- (-1131.493) [-1129.226] (-1130.360) (-1128.090) * (-1128.697) [-1127.667] (-1129.719) (-1133.584) -- 0:00:51
      189500 -- [-1128.897] (-1127.929) (-1129.693) (-1133.590) * (-1129.330) [-1128.872] (-1127.313) (-1129.633) -- 0:00:51
      190000 -- (-1131.866) (-1129.942) [-1134.942] (-1133.174) * (-1129.156) [-1127.982] (-1131.420) (-1129.939) -- 0:00:51

      Average standard deviation of split frequencies: 0.016689

      190500 -- (-1129.710) (-1131.123) [-1130.949] (-1132.957) * (-1128.970) (-1131.241) [-1130.154] (-1128.158) -- 0:00:50
      191000 -- (-1130.909) (-1131.511) [-1131.535] (-1132.114) * (-1134.631) [-1131.237] (-1128.536) (-1127.756) -- 0:00:50
      191500 -- (-1129.659) [-1131.242] (-1127.010) (-1127.962) * [-1130.477] (-1131.445) (-1130.752) (-1129.451) -- 0:00:50
      192000 -- (-1132.221) (-1130.377) (-1128.200) [-1130.445] * (-1131.282) (-1129.448) [-1128.363] (-1135.244) -- 0:00:50
      192500 -- (-1130.081) [-1128.440] (-1128.558) (-1131.260) * (-1130.028) (-1128.737) [-1127.965] (-1130.777) -- 0:00:54
      193000 -- (-1132.223) [-1128.913] (-1127.351) (-1131.044) * (-1128.545) [-1128.749] (-1127.646) (-1130.262) -- 0:00:54
      193500 -- (-1128.188) [-1127.699] (-1130.660) (-1129.209) * (-1130.626) (-1129.221) [-1130.039] (-1130.996) -- 0:00:54
      194000 -- (-1129.227) (-1129.423) (-1129.644) [-1130.237] * (-1130.368) (-1131.399) [-1129.998] (-1127.574) -- 0:00:54
      194500 -- (-1127.728) (-1128.517) [-1131.519] (-1128.667) * (-1130.267) [-1130.976] (-1131.896) (-1129.207) -- 0:00:53
      195000 -- (-1126.986) (-1129.068) [-1128.980] (-1130.392) * (-1128.297) (-1130.882) (-1130.747) [-1129.541] -- 0:00:53

      Average standard deviation of split frequencies: 0.015823

      195500 -- (-1131.644) [-1129.264] (-1128.550) (-1131.096) * (-1130.081) (-1133.984) (-1128.803) [-1129.641] -- 0:00:53
      196000 -- (-1130.106) [-1127.167] (-1130.582) (-1127.580) * (-1132.391) (-1132.930) [-1130.652] (-1129.451) -- 0:00:53
      196500 -- [-1128.069] (-1128.125) (-1131.456) (-1127.757) * (-1134.262) [-1128.247] (-1127.536) (-1130.705) -- 0:00:53
      197000 -- (-1127.892) (-1133.322) [-1133.303] (-1132.060) * (-1130.663) [-1132.268] (-1128.927) (-1128.339) -- 0:00:52
      197500 -- (-1130.709) (-1131.929) [-1129.595] (-1131.501) * [-1129.215] (-1133.552) (-1129.266) (-1127.456) -- 0:00:52
      198000 -- (-1128.715) (-1135.385) (-1129.669) [-1129.085] * (-1129.957) (-1132.927) [-1129.734] (-1134.923) -- 0:00:52
      198500 -- [-1129.612] (-1130.858) (-1130.421) (-1129.386) * (-1129.277) (-1130.692) [-1134.749] (-1128.125) -- 0:00:52
      199000 -- [-1128.063] (-1131.193) (-1130.878) (-1128.615) * (-1129.010) (-1131.606) (-1132.843) [-1128.276] -- 0:00:52
      199500 -- (-1127.842) (-1130.842) [-1129.668] (-1130.134) * (-1129.001) (-1128.387) (-1133.665) [-1127.844] -- 0:00:52
      200000 -- (-1127.569) (-1133.405) (-1128.440) [-1129.128] * (-1132.236) (-1128.560) [-1129.042] (-1129.017) -- 0:00:51

      Average standard deviation of split frequencies: 0.017186

      200500 -- [-1128.387] (-1132.116) (-1127.918) (-1136.951) * (-1128.128) (-1129.858) [-1128.974] (-1131.065) -- 0:00:51
      201000 -- [-1128.616] (-1135.450) (-1128.038) (-1131.687) * (-1131.124) (-1132.023) (-1131.666) [-1128.505] -- 0:00:51
      201500 -- (-1129.360) (-1136.124) [-1128.050] (-1131.024) * (-1131.650) (-1134.446) [-1131.085] (-1127.194) -- 0:00:51
      202000 -- [-1127.527] (-1130.249) (-1129.744) (-1131.844) * (-1132.434) (-1130.717) (-1130.823) [-1128.698] -- 0:00:51
      202500 -- (-1129.182) [-1129.386] (-1129.701) (-1136.109) * (-1127.995) (-1132.752) (-1128.459) [-1130.592] -- 0:00:51
      203000 -- (-1128.018) (-1130.060) [-1128.040] (-1133.667) * (-1129.919) (-1128.305) [-1128.327] (-1130.666) -- 0:00:51
      203500 -- (-1130.944) [-1129.381] (-1129.432) (-1130.654) * (-1129.868) (-1127.404) [-1129.660] (-1128.071) -- 0:00:50
      204000 -- (-1127.600) (-1133.040) (-1132.011) [-1130.700] * (-1136.791) [-1127.531] (-1130.487) (-1128.521) -- 0:00:50
      204500 -- (-1127.136) [-1127.764] (-1129.749) (-1127.080) * (-1130.760) (-1131.592) (-1130.254) [-1128.636] -- 0:00:50
      205000 -- [-1127.569] (-1127.973) (-1129.405) (-1127.681) * [-1128.901] (-1131.114) (-1129.258) (-1128.828) -- 0:00:50

      Average standard deviation of split frequencies: 0.017705

      205500 -- (-1127.562) (-1129.958) [-1129.628] (-1128.173) * (-1129.546) [-1129.866] (-1129.910) (-1127.717) -- 0:00:50
      206000 -- [-1127.406] (-1130.354) (-1130.157) (-1129.419) * (-1131.246) (-1130.964) [-1133.700] (-1127.780) -- 0:00:50
      206500 -- [-1127.470] (-1130.165) (-1128.769) (-1130.374) * (-1128.112) (-1130.018) (-1133.012) [-1127.868] -- 0:00:49
      207000 -- (-1127.258) (-1129.026) (-1130.230) [-1128.606] * [-1128.459] (-1129.618) (-1130.915) (-1128.575) -- 0:00:49
      207500 -- [-1128.369] (-1128.283) (-1132.509) (-1132.249) * (-1128.475) (-1129.684) (-1128.135) [-1129.563] -- 0:00:49
      208000 -- (-1131.829) (-1128.427) [-1128.974] (-1136.129) * (-1128.594) [-1129.728] (-1128.474) (-1131.330) -- 0:00:49
      208500 -- (-1131.086) (-1128.911) [-1129.885] (-1134.386) * [-1128.919] (-1129.404) (-1128.705) (-1130.096) -- 0:00:49
      209000 -- (-1128.662) (-1130.884) (-1134.234) [-1128.927] * [-1127.784] (-1128.499) (-1129.101) (-1127.918) -- 0:00:52
      209500 -- (-1127.731) [-1130.367] (-1128.121) (-1131.044) * (-1128.059) [-1128.845] (-1133.011) (-1128.274) -- 0:00:52
      210000 -- (-1128.981) (-1131.294) [-1127.181] (-1131.124) * [-1131.320] (-1127.665) (-1129.245) (-1130.923) -- 0:00:52

      Average standard deviation of split frequencies: 0.015788

      210500 -- [-1127.247] (-1129.868) (-1130.081) (-1128.492) * (-1133.314) (-1135.734) [-1129.242] (-1134.866) -- 0:00:52
      211000 -- (-1128.746) (-1128.401) (-1130.162) [-1129.521] * (-1128.816) [-1129.092] (-1128.953) (-1129.115) -- 0:00:52
      211500 -- (-1128.634) (-1128.421) [-1131.429] (-1127.025) * [-1128.880] (-1127.322) (-1130.139) (-1130.334) -- 0:00:52
      212000 -- [-1129.336] (-1128.429) (-1129.510) (-1127.054) * (-1130.762) [-1128.434] (-1128.433) (-1127.658) -- 0:00:52
      212500 -- [-1132.363] (-1129.535) (-1127.902) (-1128.018) * [-1129.875] (-1129.207) (-1129.826) (-1131.937) -- 0:00:51
      213000 -- (-1131.568) (-1127.866) [-1131.401] (-1127.141) * (-1130.935) (-1127.501) [-1127.722] (-1129.790) -- 0:00:51
      213500 -- (-1129.048) (-1129.509) [-1131.549] (-1129.749) * [-1128.145] (-1130.042) (-1129.935) (-1131.175) -- 0:00:51
      214000 -- (-1129.219) (-1128.647) (-1130.385) [-1128.355] * (-1129.026) [-1129.090] (-1132.839) (-1130.718) -- 0:00:51
      214500 -- (-1131.715) [-1128.735] (-1128.329) (-1130.584) * (-1129.378) [-1128.128] (-1129.140) (-1134.990) -- 0:00:51
      215000 -- (-1128.085) (-1130.631) (-1129.046) [-1132.589] * [-1132.364] (-1128.349) (-1131.375) (-1129.822) -- 0:00:51

      Average standard deviation of split frequencies: 0.017459

      215500 -- (-1128.897) (-1130.545) (-1130.215) [-1129.997] * (-1129.809) (-1128.031) [-1128.852] (-1130.023) -- 0:00:50
      216000 -- (-1128.444) [-1131.694] (-1131.440) (-1133.267) * [-1129.769] (-1130.934) (-1131.267) (-1130.155) -- 0:00:50
      216500 -- [-1130.741] (-1127.558) (-1131.426) (-1136.936) * [-1128.243] (-1132.180) (-1128.024) (-1129.211) -- 0:00:50
      217000 -- (-1128.770) (-1127.646) [-1131.389] (-1128.923) * (-1128.093) [-1131.519] (-1127.951) (-1128.468) -- 0:00:50
      217500 -- [-1133.183] (-1129.771) (-1133.626) (-1127.597) * [-1128.093] (-1129.773) (-1128.035) (-1129.377) -- 0:00:50
      218000 -- [-1128.800] (-1128.930) (-1129.340) (-1129.725) * (-1128.723) (-1130.888) [-1127.316] (-1135.784) -- 0:00:50
      218500 -- (-1129.426) (-1128.418) [-1131.896] (-1129.517) * (-1128.000) (-1130.893) (-1127.411) [-1131.219] -- 0:00:50
      219000 -- (-1129.848) (-1129.431) [-1128.270] (-1129.261) * (-1127.174) (-1132.529) (-1130.938) [-1128.417] -- 0:00:49
      219500 -- (-1129.646) (-1127.711) [-1130.999] (-1127.941) * (-1131.191) (-1127.938) [-1128.657] (-1127.361) -- 0:00:49
      220000 -- (-1128.008) (-1128.562) [-1131.033] (-1129.753) * (-1127.770) [-1127.284] (-1130.186) (-1127.275) -- 0:00:49

      Average standard deviation of split frequencies: 0.017216

      220500 -- [-1128.302] (-1127.254) (-1129.313) (-1128.529) * (-1130.211) [-1130.443] (-1132.204) (-1128.396) -- 0:00:49
      221000 -- [-1130.380] (-1127.834) (-1129.907) (-1129.314) * (-1131.239) [-1128.661] (-1129.453) (-1129.563) -- 0:00:49
      221500 -- (-1128.711) (-1132.198) (-1132.581) [-1128.357] * (-1128.615) (-1127.813) [-1128.551] (-1130.439) -- 0:00:49
      222000 -- (-1130.160) (-1128.521) (-1129.647) [-1129.777] * (-1129.108) (-1128.488) (-1128.268) [-1127.030] -- 0:00:49
      222500 -- (-1136.969) (-1130.058) [-1130.995] (-1129.634) * (-1128.449) (-1129.011) [-1129.275] (-1128.524) -- 0:00:48
      223000 -- (-1130.662) (-1128.669) [-1127.884] (-1129.160) * [-1129.780] (-1131.093) (-1130.740) (-1130.313) -- 0:00:48
      223500 -- (-1129.321) (-1128.675) [-1128.251] (-1128.155) * [-1128.950] (-1132.570) (-1127.669) (-1130.249) -- 0:00:48
      224000 -- (-1128.404) (-1129.724) [-1129.742] (-1129.446) * (-1128.325) (-1129.583) (-1128.148) [-1128.066] -- 0:00:48
      224500 -- (-1129.276) (-1130.850) [-1126.998] (-1131.068) * (-1128.195) [-1129.437] (-1128.762) (-1134.674) -- 0:00:48
      225000 -- [-1128.621] (-1131.171) (-1127.258) (-1129.274) * (-1128.803) (-1130.434) [-1129.024] (-1131.097) -- 0:00:48

      Average standard deviation of split frequencies: 0.016441

      225500 -- [-1129.101] (-1130.368) (-1128.201) (-1130.180) * (-1128.894) (-1129.038) [-1127.739] (-1130.126) -- 0:00:51
      226000 -- (-1129.991) [-1131.771] (-1128.643) (-1129.058) * (-1129.157) (-1131.193) (-1127.544) [-1127.495] -- 0:00:51
      226500 -- [-1133.086] (-1129.640) (-1128.653) (-1131.456) * [-1128.718] (-1132.570) (-1127.589) (-1130.424) -- 0:00:51
      227000 -- (-1129.403) [-1127.899] (-1127.236) (-1128.404) * (-1129.084) (-1132.636) [-1128.218] (-1128.521) -- 0:00:51
      227500 -- (-1130.063) (-1127.841) (-1127.221) [-1128.115] * (-1130.598) (-1128.360) [-1128.486] (-1128.198) -- 0:00:50
      228000 -- (-1129.986) (-1129.338) [-1128.050] (-1128.333) * [-1131.416] (-1129.495) (-1129.196) (-1129.780) -- 0:00:50
      228500 -- (-1128.905) (-1129.633) [-1128.371] (-1137.085) * (-1128.631) (-1127.489) (-1132.908) [-1130.577] -- 0:00:50
      229000 -- [-1129.008] (-1131.269) (-1129.293) (-1133.438) * (-1128.733) [-1129.217] (-1133.507) (-1132.114) -- 0:00:50
      229500 -- [-1128.567] (-1131.178) (-1130.616) (-1127.607) * (-1131.731) (-1129.725) [-1134.366] (-1133.622) -- 0:00:50
      230000 -- (-1130.750) (-1129.496) (-1132.414) [-1127.875] * (-1134.426) (-1128.595) [-1130.466] (-1132.991) -- 0:00:50

      Average standard deviation of split frequencies: 0.016229

      230500 -- (-1130.194) (-1128.862) [-1130.947] (-1129.356) * (-1130.850) [-1128.495] (-1129.353) (-1134.644) -- 0:00:50
      231000 -- (-1131.872) [-1128.427] (-1130.546) (-1129.174) * (-1128.033) [-1127.780] (-1129.563) (-1134.084) -- 0:00:49
      231500 -- (-1128.920) (-1129.351) (-1132.821) [-1127.792] * [-1127.291] (-1127.112) (-1128.005) (-1132.879) -- 0:00:49
      232000 -- (-1128.864) [-1131.243] (-1130.906) (-1130.188) * (-1129.001) (-1130.391) [-1128.600] (-1131.650) -- 0:00:49
      232500 -- [-1128.154] (-1128.982) (-1132.062) (-1132.525) * (-1132.926) [-1131.231] (-1127.244) (-1129.770) -- 0:00:49
      233000 -- (-1131.494) (-1133.485) (-1129.935) [-1128.401] * (-1129.682) [-1129.763] (-1127.782) (-1130.412) -- 0:00:49
      233500 -- [-1130.384] (-1129.509) (-1130.111) (-1129.357) * (-1130.568) (-1129.803) (-1129.801) [-1130.198] -- 0:00:49
      234000 -- [-1130.994] (-1132.579) (-1132.774) (-1128.323) * (-1127.924) (-1136.749) [-1129.071] (-1131.316) -- 0:00:49
      234500 -- (-1136.642) [-1128.389] (-1129.841) (-1129.145) * [-1128.290] (-1135.251) (-1127.849) (-1128.183) -- 0:00:48
      235000 -- (-1129.948) (-1127.966) [-1129.506] (-1130.416) * [-1135.945] (-1136.376) (-1129.812) (-1127.672) -- 0:00:48

      Average standard deviation of split frequencies: 0.014981

      235500 -- (-1129.413) (-1129.014) [-1127.450] (-1130.433) * (-1133.939) (-1132.227) (-1130.513) [-1127.745] -- 0:00:48
      236000 -- (-1131.019) (-1130.507) (-1132.642) [-1127.429] * (-1132.265) (-1131.675) (-1128.186) [-1127.893] -- 0:00:48
      236500 -- (-1128.368) (-1128.350) (-1128.870) [-1127.888] * (-1131.887) (-1128.321) [-1128.187] (-1128.073) -- 0:00:48
      237000 -- (-1132.090) [-1129.627] (-1130.196) (-1128.794) * [-1127.567] (-1128.688) (-1130.051) (-1129.608) -- 0:00:48
      237500 -- [-1129.775] (-1128.528) (-1129.558) (-1129.863) * (-1128.257) (-1134.685) (-1133.362) [-1128.612] -- 0:00:48
      238000 -- (-1129.347) [-1128.405] (-1131.330) (-1134.142) * [-1127.635] (-1130.974) (-1139.057) (-1129.443) -- 0:00:48
      238500 -- (-1133.770) (-1127.741) (-1134.870) [-1131.296] * (-1130.758) (-1133.133) (-1131.394) [-1129.008] -- 0:00:47
      239000 -- [-1131.411] (-1128.394) (-1130.045) (-1130.777) * (-1131.896) (-1131.655) (-1131.154) [-1130.074] -- 0:00:47
      239500 -- (-1130.359) (-1127.665) [-1132.566] (-1130.092) * (-1131.327) (-1130.145) (-1132.643) [-1130.803] -- 0:00:47
      240000 -- (-1129.446) [-1128.282] (-1129.622) (-1130.792) * [-1131.402] (-1130.304) (-1128.811) (-1128.826) -- 0:00:47

      Average standard deviation of split frequencies: 0.015235

      240500 -- (-1129.069) [-1127.266] (-1129.716) (-1130.482) * (-1129.105) (-1129.195) (-1128.169) [-1128.322] -- 0:00:47
      241000 -- (-1132.996) (-1127.225) [-1129.558] (-1130.508) * (-1128.658) [-1128.339] (-1128.150) (-1131.316) -- 0:00:47
      241500 -- (-1129.560) (-1128.266) (-1130.338) [-1127.971] * [-1128.486] (-1131.823) (-1130.332) (-1128.358) -- 0:00:50
      242000 -- (-1128.936) (-1129.496) (-1128.082) [-1128.053] * (-1129.506) [-1133.717] (-1130.725) (-1128.463) -- 0:00:50
      242500 -- (-1131.859) (-1129.558) (-1127.874) [-1128.080] * [-1129.297] (-1127.928) (-1130.817) (-1129.390) -- 0:00:49
      243000 -- [-1131.301] (-1128.857) (-1127.657) (-1129.427) * [-1128.750] (-1133.784) (-1128.561) (-1131.317) -- 0:00:49
      243500 -- (-1127.963) (-1130.849) [-1127.233] (-1129.907) * (-1130.065) (-1129.459) [-1128.155] (-1129.791) -- 0:00:49
      244000 -- (-1127.500) (-1129.107) [-1127.159] (-1129.322) * (-1128.282) (-1131.249) (-1129.009) [-1128.736] -- 0:00:49
      244500 -- [-1129.335] (-1128.242) (-1128.876) (-1132.089) * [-1127.730] (-1132.319) (-1127.490) (-1132.112) -- 0:00:49
      245000 -- [-1129.395] (-1129.801) (-1129.662) (-1129.304) * [-1127.322] (-1129.765) (-1129.283) (-1129.034) -- 0:00:49

      Average standard deviation of split frequencies: 0.014691

      245500 -- (-1132.198) (-1127.172) (-1132.581) [-1128.442] * (-1129.345) [-1128.209] (-1129.063) (-1129.917) -- 0:00:49
      246000 -- (-1127.998) [-1127.372] (-1135.040) (-1129.242) * (-1131.062) (-1127.783) [-1128.855] (-1129.088) -- 0:00:49
      246500 -- (-1128.232) (-1126.901) (-1130.182) [-1128.238] * [-1129.750] (-1127.428) (-1128.556) (-1130.075) -- 0:00:48
      247000 -- (-1133.215) [-1131.413] (-1130.255) (-1130.086) * (-1127.790) (-1127.629) (-1128.619) [-1128.679] -- 0:00:48
      247500 -- (-1134.243) [-1130.341] (-1127.920) (-1129.143) * (-1127.903) [-1127.502] (-1127.835) (-1128.110) -- 0:00:48
      248000 -- (-1131.751) (-1127.954) [-1129.674] (-1129.034) * (-1129.177) (-1127.850) [-1127.828] (-1130.489) -- 0:00:48
      248500 -- (-1128.849) [-1128.028] (-1134.193) (-1129.432) * (-1130.076) (-1128.374) (-1127.671) [-1127.610] -- 0:00:48
      249000 -- (-1129.111) [-1129.755] (-1130.122) (-1130.295) * (-1128.384) [-1129.557] (-1127.671) (-1127.761) -- 0:00:48
      249500 -- (-1128.777) [-1128.508] (-1128.527) (-1128.869) * (-1133.374) [-1127.549] (-1128.563) (-1127.890) -- 0:00:48
      250000 -- (-1131.424) (-1128.478) [-1129.447] (-1128.645) * (-1131.811) [-1128.536] (-1129.448) (-1127.452) -- 0:00:48

      Average standard deviation of split frequencies: 0.015358

      250500 -- (-1128.946) [-1129.584] (-1130.206) (-1128.656) * (-1132.229) (-1127.349) [-1128.310] (-1127.358) -- 0:00:47
      251000 -- [-1130.652] (-1128.968) (-1130.990) (-1128.077) * [-1131.715] (-1128.652) (-1127.817) (-1128.234) -- 0:00:47
      251500 -- (-1131.289) [-1128.961] (-1132.128) (-1129.412) * (-1132.104) [-1129.328] (-1128.833) (-1127.518) -- 0:00:47
      252000 -- (-1128.656) [-1128.557] (-1129.632) (-1129.595) * (-1132.164) (-1128.805) (-1128.923) [-1127.945] -- 0:00:47
      252500 -- (-1129.050) (-1130.062) [-1128.006] (-1132.718) * (-1127.879) (-1128.569) [-1133.369] (-1130.184) -- 0:00:47
      253000 -- (-1129.307) (-1131.790) [-1129.158] (-1130.458) * (-1130.756) (-1132.800) (-1129.440) [-1128.211] -- 0:00:47
      253500 -- (-1130.491) [-1130.569] (-1127.721) (-1129.589) * (-1132.517) [-1133.091] (-1130.900) (-1131.173) -- 0:00:47
      254000 -- (-1128.843) [-1129.397] (-1128.104) (-1127.653) * (-1128.345) (-1128.902) (-1129.493) [-1130.683] -- 0:00:46
      254500 -- (-1130.067) (-1132.112) [-1127.508] (-1129.148) * (-1127.034) [-1128.752] (-1128.839) (-1129.633) -- 0:00:46
      255000 -- (-1131.859) (-1132.907) [-1128.658] (-1129.632) * (-1130.727) (-1128.008) [-1128.872] (-1133.379) -- 0:00:46

      Average standard deviation of split frequencies: 0.016368

      255500 -- [-1130.123] (-1131.729) (-1129.703) (-1132.973) * (-1135.538) (-1127.483) [-1130.274] (-1132.500) -- 0:00:46
      256000 -- (-1131.012) (-1128.331) [-1129.390] (-1131.618) * (-1135.456) (-1129.388) [-1127.843] (-1131.481) -- 0:00:46
      256500 -- (-1130.445) (-1128.523) (-1127.341) [-1127.494] * (-1133.100) [-1131.216] (-1130.918) (-1128.109) -- 0:00:46
      257000 -- [-1136.549] (-1129.103) (-1127.463) (-1130.162) * [-1134.205] (-1132.480) (-1129.187) (-1129.769) -- 0:00:46
      257500 -- (-1136.092) [-1129.084] (-1129.572) (-1127.189) * (-1129.004) (-1129.714) [-1129.119] (-1129.211) -- 0:00:46
      258000 -- [-1127.943] (-1128.820) (-1128.893) (-1127.378) * [-1129.468] (-1129.375) (-1128.441) (-1131.052) -- 0:00:48
      258500 -- [-1129.086] (-1129.875) (-1128.016) (-1129.100) * (-1128.210) (-1132.128) (-1129.383) [-1130.726] -- 0:00:48
      259000 -- [-1129.941] (-1130.706) (-1134.887) (-1128.997) * (-1128.115) (-1127.551) [-1128.702] (-1132.221) -- 0:00:48
      259500 -- (-1129.504) [-1129.511] (-1130.087) (-1128.945) * (-1127.602) [-1127.666] (-1130.211) (-1137.447) -- 0:00:48
      260000 -- (-1129.155) [-1129.628] (-1132.539) (-1131.768) * [-1127.989] (-1128.043) (-1129.721) (-1128.040) -- 0:00:48

      Average standard deviation of split frequencies: 0.015573

      260500 -- [-1129.501] (-1128.864) (-1134.719) (-1127.327) * [-1127.742] (-1128.210) (-1130.568) (-1128.721) -- 0:00:48
      261000 -- (-1128.491) (-1130.375) (-1133.211) [-1129.568] * (-1130.024) (-1128.280) (-1131.659) [-1127.815] -- 0:00:48
      261500 -- [-1128.486] (-1128.855) (-1132.664) (-1129.372) * [-1129.034] (-1128.687) (-1130.529) (-1127.748) -- 0:00:48
      262000 -- [-1130.617] (-1127.046) (-1129.777) (-1133.182) * (-1128.731) (-1128.687) (-1130.064) [-1128.948] -- 0:00:47
      262500 -- [-1128.177] (-1127.019) (-1128.724) (-1131.206) * [-1128.283] (-1130.332) (-1130.754) (-1127.764) -- 0:00:47
      263000 -- (-1128.437) [-1126.887] (-1129.553) (-1130.321) * (-1130.235) [-1129.464] (-1130.932) (-1129.453) -- 0:00:47
      263500 -- (-1131.540) (-1128.167) [-1128.252] (-1132.381) * [-1129.577] (-1129.569) (-1128.060) (-1128.019) -- 0:00:47
      264000 -- (-1130.701) (-1128.996) [-1128.051] (-1127.997) * [-1127.272] (-1129.146) (-1128.352) (-1128.510) -- 0:00:47
      264500 -- (-1131.277) (-1131.355) [-1130.016] (-1127.739) * (-1127.334) (-1130.995) (-1130.743) [-1133.883] -- 0:00:47
      265000 -- (-1127.976) [-1129.537] (-1130.072) (-1127.516) * [-1128.880] (-1132.948) (-1130.443) (-1131.138) -- 0:00:47

      Average standard deviation of split frequencies: 0.015950

      265500 -- (-1127.790) (-1128.564) (-1131.716) [-1128.812] * (-1128.035) (-1130.280) [-1132.755] (-1129.711) -- 0:00:47
      266000 -- (-1130.192) [-1128.237] (-1129.754) (-1130.189) * (-1127.653) (-1128.914) [-1134.392] (-1129.441) -- 0:00:46
      266500 -- (-1129.276) (-1127.795) [-1129.988] (-1132.321) * [-1127.765] (-1127.268) (-1128.947) (-1129.116) -- 0:00:46
      267000 -- (-1128.879) (-1127.624) (-1131.459) [-1131.127] * [-1130.244] (-1129.884) (-1128.664) (-1127.845) -- 0:00:46
      267500 -- (-1128.949) (-1127.887) (-1129.859) [-1128.215] * (-1133.471) (-1130.907) (-1129.155) [-1127.563] -- 0:00:46
      268000 -- [-1130.175] (-1131.113) (-1129.912) (-1128.676) * (-1130.727) (-1130.332) [-1127.561] (-1128.727) -- 0:00:46
      268500 -- (-1131.471) (-1133.765) (-1128.493) [-1129.072] * (-1129.149) (-1133.150) (-1127.540) [-1128.790] -- 0:00:46
      269000 -- [-1128.169] (-1129.001) (-1127.300) (-1127.853) * (-1129.348) [-1128.152] (-1129.231) (-1128.275) -- 0:00:46
      269500 -- [-1128.229] (-1130.021) (-1135.532) (-1129.927) * (-1130.102) [-1128.302] (-1128.278) (-1129.228) -- 0:00:46
      270000 -- (-1128.214) (-1131.103) (-1131.885) [-1129.920] * (-1130.626) (-1132.992) [-1130.137] (-1130.308) -- 0:00:45

      Average standard deviation of split frequencies: 0.016159

      270500 -- (-1129.717) (-1133.166) [-1128.901] (-1128.543) * (-1132.725) (-1128.309) (-1130.068) [-1129.731] -- 0:00:45
      271000 -- (-1129.230) [-1128.938] (-1130.804) (-1129.227) * (-1127.844) (-1127.453) (-1129.280) [-1129.442] -- 0:00:45
      271500 -- (-1130.639) [-1128.801] (-1130.808) (-1130.348) * (-1129.773) [-1129.325] (-1129.908) (-1128.310) -- 0:00:45
      272000 -- (-1129.217) [-1129.963] (-1131.217) (-1131.454) * (-1128.824) (-1127.911) (-1130.057) [-1128.745] -- 0:00:45
      272500 -- (-1129.364) [-1128.316] (-1129.837) (-1134.117) * (-1129.035) [-1127.951] (-1131.598) (-1128.889) -- 0:00:45
      273000 -- (-1127.607) [-1131.679] (-1132.613) (-1129.271) * (-1131.969) (-1129.692) (-1129.592) [-1127.421] -- 0:00:45
      273500 -- (-1129.448) (-1130.684) [-1130.036] (-1128.511) * (-1128.222) (-1129.328) [-1131.533] (-1128.833) -- 0:00:45
      274000 -- (-1127.841) (-1130.867) [-1131.280] (-1129.245) * [-1128.105] (-1128.109) (-1127.631) (-1128.754) -- 0:00:45
      274500 -- [-1129.475] (-1128.725) (-1131.376) (-1130.059) * (-1128.438) (-1128.851) (-1127.631) [-1127.626] -- 0:00:47
      275000 -- (-1132.399) (-1127.332) (-1129.846) [-1129.567] * (-1129.338) (-1129.165) (-1128.175) [-1128.207] -- 0:00:47

      Average standard deviation of split frequencies: 0.015846

      275500 -- (-1128.733) [-1128.348] (-1129.916) (-1130.437) * (-1129.391) (-1128.534) [-1128.219] (-1132.289) -- 0:00:47
      276000 -- (-1129.522) (-1128.300) (-1130.056) [-1127.380] * (-1128.350) [-1128.880] (-1128.004) (-1131.286) -- 0:00:47
      276500 -- (-1130.516) (-1127.655) (-1131.878) [-1129.202] * (-1133.003) (-1128.892) (-1128.613) [-1129.108] -- 0:00:47
      277000 -- (-1130.639) (-1131.325) (-1130.608) [-1131.438] * [-1129.901] (-1128.379) (-1129.216) (-1130.523) -- 0:00:46
      277500 -- (-1131.309) (-1127.708) [-1128.000] (-1128.344) * [-1130.773] (-1131.020) (-1130.091) (-1130.005) -- 0:00:46
      278000 -- [-1131.593] (-1128.107) (-1128.522) (-1128.055) * (-1131.840) (-1130.003) [-1129.019] (-1130.169) -- 0:00:46
      278500 -- [-1131.356] (-1127.792) (-1128.897) (-1129.008) * (-1131.184) (-1128.937) (-1130.799) [-1130.748] -- 0:00:46
      279000 -- [-1128.830] (-1128.861) (-1129.590) (-1127.052) * (-1130.293) (-1130.136) (-1133.153) [-1127.551] -- 0:00:46
      279500 -- (-1130.065) (-1128.760) (-1130.164) [-1129.530] * (-1130.868) [-1129.364] (-1130.742) (-1128.552) -- 0:00:46
      280000 -- (-1131.662) (-1130.161) [-1128.537] (-1127.992) * [-1128.177] (-1128.248) (-1131.431) (-1129.018) -- 0:00:46

      Average standard deviation of split frequencies: 0.016049

      280500 -- [-1132.719] (-1128.123) (-1128.739) (-1127.945) * [-1129.274] (-1128.076) (-1128.311) (-1132.286) -- 0:00:46
      281000 -- (-1129.917) [-1129.871] (-1130.502) (-1128.030) * (-1131.205) (-1129.036) [-1137.095] (-1131.379) -- 0:00:46
      281500 -- (-1130.103) (-1129.619) (-1127.451) [-1128.532] * (-1134.728) [-1129.417] (-1137.279) (-1129.057) -- 0:00:45
      282000 -- (-1128.764) (-1127.893) [-1127.136] (-1128.008) * (-1128.478) [-1130.181] (-1132.435) (-1128.889) -- 0:00:45
      282500 -- (-1131.150) (-1128.032) (-1127.228) [-1128.117] * (-1128.310) (-1130.676) [-1130.900] (-1129.727) -- 0:00:45
      283000 -- (-1129.954) (-1127.873) (-1127.509) [-1129.508] * (-1128.001) [-1128.082] (-1127.707) (-1128.517) -- 0:00:45
      283500 -- [-1132.957] (-1127.442) (-1127.511) (-1129.285) * (-1132.433) [-1128.628] (-1127.810) (-1129.327) -- 0:00:45
      284000 -- (-1130.726) (-1127.389) [-1127.120] (-1128.280) * (-1136.330) (-1131.604) [-1127.713] (-1130.312) -- 0:00:45
      284500 -- (-1130.849) (-1128.231) [-1128.029] (-1128.996) * (-1128.871) [-1128.325] (-1127.652) (-1129.453) -- 0:00:45
      285000 -- (-1129.354) (-1128.317) (-1131.614) [-1128.223] * [-1130.026] (-1129.345) (-1129.110) (-1127.420) -- 0:00:45

      Average standard deviation of split frequencies: 0.015842

      285500 -- (-1129.549) (-1128.447) (-1130.630) [-1129.396] * (-1131.159) [-1128.513] (-1128.972) (-1129.298) -- 0:00:45
      286000 -- (-1127.839) (-1127.413) (-1127.835) [-1128.164] * [-1128.969] (-1131.972) (-1129.903) (-1130.928) -- 0:00:44
      286500 -- (-1128.529) (-1130.683) (-1131.557) [-1130.113] * (-1129.608) [-1128.012] (-1129.982) (-1131.475) -- 0:00:44
      287000 -- (-1130.321) [-1130.533] (-1133.716) (-1131.031) * [-1129.048] (-1128.979) (-1130.981) (-1128.771) -- 0:00:44
      287500 -- (-1129.336) (-1131.664) [-1128.845] (-1128.052) * [-1128.209] (-1127.280) (-1130.416) (-1131.579) -- 0:00:44
      288000 -- [-1130.951] (-1128.732) (-1130.351) (-1131.496) * (-1128.209) [-1128.712] (-1128.456) (-1131.971) -- 0:00:44
      288500 -- (-1129.585) (-1129.897) (-1130.168) [-1127.696] * (-1130.052) (-1131.050) [-1129.997] (-1129.501) -- 0:00:44
      289000 -- (-1132.837) (-1130.616) (-1129.850) [-1127.680] * (-1128.840) [-1131.751] (-1128.151) (-1128.424) -- 0:00:44
      289500 -- (-1130.519) (-1130.786) [-1129.331] (-1127.356) * (-1128.711) (-1130.251) (-1129.185) [-1128.236] -- 0:00:44
      290000 -- (-1128.724) [-1131.343] (-1128.331) (-1127.371) * (-1129.049) (-1128.519) [-1128.015] (-1128.348) -- 0:00:44

      Average standard deviation of split frequencies: 0.016123

      290500 -- (-1128.117) [-1128.624] (-1130.446) (-1127.104) * [-1128.779] (-1130.475) (-1128.256) (-1130.418) -- 0:00:46
      291000 -- (-1128.923) (-1132.620) (-1128.889) [-1127.688] * (-1129.909) [-1131.017] (-1127.967) (-1129.164) -- 0:00:46
      291500 -- [-1129.605] (-1128.795) (-1130.428) (-1127.688) * (-1128.387) [-1130.019] (-1132.843) (-1128.748) -- 0:00:46
      292000 -- [-1130.442] (-1128.271) (-1128.319) (-1132.084) * (-1129.473) (-1128.267) [-1135.336] (-1128.829) -- 0:00:46
      292500 -- (-1132.422) (-1128.978) (-1127.847) [-1132.243] * [-1129.579] (-1135.530) (-1131.474) (-1129.563) -- 0:00:45
      293000 -- (-1129.075) [-1130.634] (-1129.018) (-1129.394) * (-1131.154) (-1135.412) (-1132.593) [-1128.609] -- 0:00:45
      293500 -- (-1132.731) (-1127.470) [-1127.744] (-1131.456) * (-1129.080) [-1128.167] (-1132.084) (-1130.864) -- 0:00:45
      294000 -- (-1129.775) (-1129.178) (-1130.231) [-1131.188] * [-1129.502] (-1129.293) (-1127.885) (-1130.905) -- 0:00:45
      294500 -- [-1129.475] (-1130.136) (-1129.058) (-1132.831) * (-1130.910) (-1129.393) [-1131.290] (-1128.483) -- 0:00:45
      295000 -- (-1133.585) [-1130.339] (-1131.102) (-1130.277) * (-1128.295) (-1128.219) [-1128.159] (-1128.485) -- 0:00:45

      Average standard deviation of split frequencies: 0.015738

      295500 -- (-1131.846) (-1127.334) (-1131.059) [-1129.280] * (-1132.102) [-1129.176] (-1129.025) (-1127.997) -- 0:00:45
      296000 -- (-1133.448) [-1128.154] (-1128.849) (-1129.492) * (-1128.970) (-1131.246) [-1129.399] (-1127.854) -- 0:00:45
      296500 -- (-1129.802) [-1127.194] (-1128.849) (-1131.004) * (-1128.679) [-1129.170] (-1129.547) (-1127.963) -- 0:00:45
      297000 -- [-1128.204] (-1131.134) (-1129.029) (-1129.552) * (-1132.355) (-1130.239) (-1129.918) [-1127.752] -- 0:00:44
      297500 -- (-1128.300) (-1129.114) [-1128.947] (-1128.248) * [-1130.754] (-1130.071) (-1131.495) (-1128.960) -- 0:00:44
      298000 -- (-1128.203) (-1129.295) [-1128.398] (-1130.921) * (-1129.727) [-1129.622] (-1132.227) (-1132.987) -- 0:00:44
      298500 -- [-1127.311] (-1129.139) (-1128.509) (-1129.960) * [-1128.346] (-1128.060) (-1128.827) (-1132.842) -- 0:00:44
      299000 -- [-1127.432] (-1127.645) (-1127.805) (-1130.046) * [-1128.280] (-1131.916) (-1128.956) (-1131.866) -- 0:00:44
      299500 -- (-1134.671) (-1128.026) (-1131.158) [-1128.794] * (-1128.401) [-1129.780] (-1129.474) (-1129.357) -- 0:00:44
      300000 -- [-1133.378] (-1128.642) (-1129.497) (-1128.310) * (-1128.673) (-1134.291) [-1135.455] (-1128.483) -- 0:00:44

      Average standard deviation of split frequencies: 0.014756

      300500 -- (-1130.053) (-1133.167) [-1130.804] (-1133.829) * (-1128.433) [-1129.066] (-1130.436) (-1131.942) -- 0:00:44
      301000 -- (-1127.798) [-1133.144] (-1129.928) (-1130.405) * [-1130.352] (-1129.449) (-1136.759) (-1131.036) -- 0:00:44
      301500 -- (-1131.347) (-1132.774) [-1132.912] (-1127.719) * (-1130.079) (-1128.464) (-1130.794) [-1128.945] -- 0:00:44
      302000 -- (-1129.762) [-1127.726] (-1127.247) (-1127.603) * [-1130.423] (-1128.212) (-1129.155) (-1130.776) -- 0:00:43
      302500 -- (-1127.993) [-1128.415] (-1129.938) (-1128.428) * (-1130.841) (-1128.943) [-1129.385] (-1130.461) -- 0:00:43
      303000 -- (-1131.681) (-1130.026) [-1131.350] (-1128.241) * (-1128.977) [-1127.325] (-1131.961) (-1128.675) -- 0:00:43
      303500 -- (-1127.686) (-1129.196) (-1131.667) [-1128.516] * [-1127.799] (-1129.466) (-1130.440) (-1129.033) -- 0:00:43
      304000 -- (-1127.858) (-1128.754) [-1130.127] (-1131.784) * (-1128.191) [-1128.183] (-1128.572) (-1131.179) -- 0:00:43
      304500 -- (-1130.909) (-1127.467) (-1127.822) [-1127.140] * (-1129.172) (-1128.649) [-1129.163] (-1129.542) -- 0:00:43
      305000 -- (-1130.889) (-1127.788) (-1128.498) [-1129.912] * [-1129.451] (-1129.796) (-1128.136) (-1127.324) -- 0:00:43

      Average standard deviation of split frequencies: 0.014952

      305500 -- (-1130.142) [-1127.387] (-1128.628) (-1130.796) * (-1131.512) (-1129.950) [-1128.027] (-1127.874) -- 0:00:43
      306000 -- (-1129.433) (-1129.062) (-1131.254) [-1128.621] * (-1128.656) (-1130.037) (-1128.440) [-1130.403] -- 0:00:43
      306500 -- (-1129.066) (-1128.195) [-1133.376] (-1131.028) * (-1129.956) [-1127.726] (-1128.012) (-1134.628) -- 0:00:42
      307000 -- (-1130.881) (-1132.421) (-1131.132) [-1130.085] * [-1126.994] (-1129.996) (-1127.401) (-1130.177) -- 0:00:45
      307500 -- (-1130.456) (-1131.085) [-1130.965] (-1131.888) * (-1128.030) (-1133.057) (-1127.982) [-1129.977] -- 0:00:45
      308000 -- [-1129.682] (-1131.362) (-1128.089) (-1131.156) * [-1131.917] (-1129.340) (-1130.717) (-1131.834) -- 0:00:44
      308500 -- (-1129.419) (-1132.744) [-1130.162] (-1129.379) * [-1128.079] (-1127.795) (-1129.750) (-1128.406) -- 0:00:44
      309000 -- (-1127.680) (-1131.721) (-1131.482) [-1127.272] * (-1128.511) (-1135.350) [-1128.942] (-1128.319) -- 0:00:44
      309500 -- (-1128.851) (-1131.456) (-1128.653) [-1128.092] * (-1128.696) (-1130.618) [-1128.216] (-1129.793) -- 0:00:44
      310000 -- (-1130.898) [-1128.731] (-1132.588) (-1129.642) * (-1132.139) [-1129.031] (-1129.245) (-1130.521) -- 0:00:44

      Average standard deviation of split frequencies: 0.014460

      310500 -- (-1130.930) (-1128.904) (-1131.282) [-1128.386] * (-1134.392) (-1128.628) (-1132.927) [-1131.395] -- 0:00:44
      311000 -- (-1128.910) (-1133.687) (-1128.506) [-1130.624] * (-1131.579) [-1128.191] (-1128.730) (-1133.925) -- 0:00:44
      311500 -- (-1131.434) [-1130.716] (-1129.411) (-1131.954) * [-1130.610] (-1129.535) (-1128.663) (-1132.987) -- 0:00:44
      312000 -- [-1129.460] (-1128.712) (-1128.073) (-1128.001) * (-1127.822) (-1129.207) [-1128.835] (-1131.347) -- 0:00:44
      312500 -- (-1129.387) [-1127.948] (-1129.563) (-1132.061) * [-1127.663] (-1130.419) (-1129.550) (-1129.999) -- 0:00:44
      313000 -- (-1129.814) (-1129.205) [-1128.949] (-1127.723) * (-1129.106) (-1130.756) [-1128.131] (-1129.223) -- 0:00:43
      313500 -- [-1129.630] (-1129.767) (-1128.999) (-1131.099) * [-1130.161] (-1129.023) (-1128.328) (-1131.109) -- 0:00:43
      314000 -- (-1129.358) (-1133.675) [-1130.005] (-1127.351) * (-1130.348) (-1128.126) (-1129.336) [-1128.342] -- 0:00:43
      314500 -- [-1130.440] (-1131.583) (-1131.453) (-1129.195) * (-1131.798) [-1128.680] (-1131.824) (-1130.834) -- 0:00:43
      315000 -- [-1131.884] (-1129.625) (-1129.892) (-1129.266) * (-1129.829) [-1129.990] (-1130.155) (-1129.792) -- 0:00:43

      Average standard deviation of split frequencies: 0.014304

      315500 -- (-1127.973) (-1130.287) [-1133.106] (-1129.964) * (-1128.964) [-1130.632] (-1130.884) (-1128.717) -- 0:00:43
      316000 -- (-1129.016) [-1127.745] (-1133.014) (-1129.974) * (-1130.109) [-1127.716] (-1127.343) (-1132.415) -- 0:00:43
      316500 -- [-1128.870] (-1129.904) (-1129.157) (-1133.848) * (-1128.600) (-1128.798) (-1127.239) [-1135.049] -- 0:00:43
      317000 -- (-1128.244) (-1129.166) [-1127.809] (-1129.385) * (-1128.277) (-1131.792) (-1127.810) [-1129.150] -- 0:00:43
      317500 -- (-1127.158) (-1129.288) [-1127.071] (-1131.469) * (-1129.670) [-1128.375] (-1129.195) (-1130.201) -- 0:00:42
      318000 -- (-1130.680) (-1130.143) [-1129.004] (-1127.884) * [-1128.724] (-1127.800) (-1130.500) (-1131.144) -- 0:00:42
      318500 -- (-1129.245) [-1130.154] (-1127.707) (-1129.370) * (-1129.062) [-1128.303] (-1129.284) (-1128.129) -- 0:00:42
      319000 -- (-1129.104) (-1129.869) (-1127.077) [-1134.302] * (-1127.900) (-1132.862) [-1127.904] (-1132.688) -- 0:00:42
      319500 -- (-1129.653) [-1129.474] (-1129.872) (-1129.102) * (-1129.670) (-1130.103) (-1127.903) [-1131.331] -- 0:00:42
      320000 -- (-1131.211) (-1132.907) [-1127.215] (-1130.521) * (-1128.368) (-1130.604) (-1127.187) [-1131.941] -- 0:00:42

      Average standard deviation of split frequencies: 0.013750

      320500 -- (-1132.582) [-1130.029] (-1128.379) (-1131.379) * [-1129.369] (-1128.679) (-1130.240) (-1133.020) -- 0:00:42
      321000 -- (-1130.908) [-1128.010] (-1127.548) (-1128.524) * (-1128.715) [-1128.091] (-1128.315) (-1131.560) -- 0:00:42
      321500 -- (-1130.540) [-1128.013] (-1128.777) (-1128.629) * (-1129.936) (-1128.135) (-1129.447) [-1130.292] -- 0:00:42
      322000 -- (-1129.970) [-1127.967] (-1129.269) (-1131.122) * (-1130.795) (-1129.179) (-1130.001) [-1131.619] -- 0:00:42
      322500 -- (-1128.109) (-1129.110) (-1130.184) [-1130.774] * (-1128.329) (-1133.238) (-1128.195) [-1130.347] -- 0:00:42
      323000 -- (-1127.880) (-1131.015) (-1131.755) [-1130.431] * (-1128.474) (-1131.092) [-1129.457] (-1130.777) -- 0:00:41
      323500 -- (-1128.523) (-1131.768) [-1130.364] (-1128.697) * (-1132.991) (-1133.707) [-1128.442] (-1129.955) -- 0:00:43
      324000 -- (-1128.499) [-1127.726] (-1129.957) (-1129.281) * (-1130.697) (-1129.294) (-1128.366) [-1131.148] -- 0:00:43
      324500 -- (-1129.230) (-1129.954) [-1128.380] (-1128.488) * (-1127.887) (-1131.469) [-1127.383] (-1129.775) -- 0:00:43
      325000 -- (-1129.751) (-1130.517) (-1128.469) [-1130.230] * (-1129.019) [-1130.109] (-1129.886) (-1129.063) -- 0:00:43

      Average standard deviation of split frequencies: 0.013440

      325500 -- (-1129.345) [-1128.301] (-1128.469) (-1128.005) * (-1128.215) [-1128.243] (-1134.238) (-1129.199) -- 0:00:43
      326000 -- (-1130.043) (-1129.131) [-1127.952] (-1127.813) * [-1129.923] (-1127.562) (-1128.130) (-1128.772) -- 0:00:43
      326500 -- (-1131.650) (-1129.197) [-1127.158] (-1128.488) * (-1128.752) (-1131.563) (-1131.777) [-1128.134] -- 0:00:43
      327000 -- (-1132.480) (-1130.112) (-1131.757) [-1128.655] * (-1128.926) [-1127.560] (-1128.919) (-1127.592) -- 0:00:43
      327500 -- (-1129.537) (-1128.134) [-1131.428] (-1128.457) * (-1128.372) (-1127.518) (-1130.801) [-1127.337] -- 0:00:43
      328000 -- (-1129.630) (-1128.879) (-1133.786) [-1128.188] * (-1128.350) [-1127.628] (-1134.186) (-1128.521) -- 0:00:43
      328500 -- (-1129.411) (-1129.003) (-1130.476) [-1130.337] * [-1132.064] (-1128.731) (-1129.893) (-1127.655) -- 0:00:42
      329000 -- (-1128.492) (-1128.962) [-1128.639] (-1129.437) * [-1132.494] (-1127.166) (-1129.931) (-1127.737) -- 0:00:42
      329500 -- (-1129.908) (-1128.348) (-1133.124) [-1129.832] * (-1127.310) (-1129.014) [-1128.165] (-1129.033) -- 0:00:42
      330000 -- [-1130.559] (-1128.322) (-1128.523) (-1131.486) * (-1129.025) [-1127.465] (-1127.836) (-1128.135) -- 0:00:42

      Average standard deviation of split frequencies: 0.013166

      330500 -- (-1132.299) (-1128.131) [-1130.067] (-1132.417) * (-1130.485) [-1127.618] (-1128.368) (-1129.174) -- 0:00:42
      331000 -- (-1135.884) (-1127.727) (-1131.979) [-1129.896] * (-1127.985) [-1127.963] (-1127.558) (-1130.443) -- 0:00:42
      331500 -- (-1133.996) (-1131.877) [-1132.112] (-1129.835) * (-1128.976) (-1131.333) (-1129.463) [-1130.261] -- 0:00:42
      332000 -- (-1129.942) (-1129.301) (-1130.861) [-1128.788] * (-1127.734) (-1132.343) [-1129.207] (-1129.055) -- 0:00:42
      332500 -- (-1130.582) [-1128.533] (-1132.515) (-1128.819) * (-1127.093) (-1132.749) (-1130.379) [-1128.886] -- 0:00:42
      333000 -- (-1134.131) (-1128.005) (-1133.280) [-1127.534] * (-1128.431) [-1128.416] (-1138.499) (-1131.269) -- 0:00:42
      333500 -- (-1134.178) (-1133.028) (-1129.382) [-1129.646] * [-1134.332] (-1128.548) (-1129.734) (-1128.728) -- 0:00:41
      334000 -- (-1132.904) (-1133.106) [-1130.330] (-1128.446) * [-1128.397] (-1127.147) (-1134.738) (-1130.365) -- 0:00:41
      334500 -- (-1129.837) [-1127.135] (-1128.838) (-1129.298) * (-1127.799) (-1127.637) (-1135.342) [-1127.441] -- 0:00:41
      335000 -- [-1131.008] (-1130.423) (-1128.561) (-1128.972) * (-1127.469) (-1128.177) (-1130.533) [-1130.713] -- 0:00:41

      Average standard deviation of split frequencies: 0.013617

      335500 -- (-1129.813) [-1128.588] (-1129.985) (-1132.057) * (-1129.892) (-1135.653) (-1129.627) [-1128.151] -- 0:00:41
      336000 -- [-1128.989] (-1128.166) (-1129.914) (-1128.192) * (-1130.106) (-1129.660) (-1128.657) [-1127.460] -- 0:00:41
      336500 -- (-1132.620) (-1129.964) (-1129.531) [-1129.425] * (-1131.007) (-1127.071) (-1128.457) [-1133.509] -- 0:00:41
      337000 -- [-1131.785] (-1132.718) (-1127.049) (-1130.910) * (-1130.941) (-1126.949) (-1128.497) [-1130.582] -- 0:00:41
      337500 -- (-1130.741) (-1129.105) (-1127.257) [-1129.318] * (-1130.741) (-1128.292) [-1127.366] (-1129.516) -- 0:00:41
      338000 -- [-1127.655] (-1132.461) (-1128.343) (-1129.307) * (-1130.920) [-1127.374] (-1128.140) (-1131.357) -- 0:00:41
      338500 -- (-1127.662) [-1131.152] (-1127.092) (-1131.812) * (-1128.439) [-1129.498] (-1128.493) (-1127.915) -- 0:00:41
      339000 -- (-1129.320) (-1130.731) [-1127.360] (-1131.653) * (-1129.644) [-1131.097] (-1129.240) (-1132.066) -- 0:00:40
      339500 -- [-1128.425] (-1129.718) (-1127.202) (-1129.409) * (-1133.168) (-1127.816) [-1131.575] (-1129.564) -- 0:00:42
      340000 -- (-1131.098) (-1129.401) [-1127.446] (-1131.363) * (-1132.091) (-1129.095) (-1132.354) [-1129.450] -- 0:00:42

      Average standard deviation of split frequencies: 0.012373

      340500 -- (-1131.507) (-1128.087) (-1128.183) [-1130.093] * [-1132.621] (-1128.639) (-1130.407) (-1129.737) -- 0:00:42
      341000 -- [-1130.533] (-1128.087) (-1127.277) (-1131.473) * (-1127.734) [-1129.823] (-1130.027) (-1132.707) -- 0:00:42
      341500 -- (-1132.229) (-1128.824) [-1130.097] (-1129.243) * (-1127.471) [-1128.600] (-1130.337) (-1130.793) -- 0:00:42
      342000 -- (-1132.275) [-1127.623] (-1131.403) (-1128.570) * (-1128.432) (-1129.369) (-1130.822) [-1127.898] -- 0:00:42
      342500 -- (-1128.005) [-1127.788] (-1131.636) (-1127.312) * (-1128.165) (-1130.991) (-1129.004) [-1128.953] -- 0:00:42
      343000 -- (-1129.715) [-1129.778] (-1137.992) (-1127.580) * (-1128.063) (-1131.509) (-1129.480) [-1128.322] -- 0:00:42
      343500 -- (-1129.362) (-1131.469) [-1131.414] (-1129.697) * [-1128.385] (-1127.857) (-1129.215) (-1128.575) -- 0:00:42
      344000 -- [-1129.002] (-1130.689) (-1131.045) (-1129.271) * [-1127.727] (-1128.240) (-1133.958) (-1129.662) -- 0:00:41
      344500 -- (-1128.108) [-1129.489] (-1130.465) (-1127.453) * (-1127.330) (-1135.401) [-1134.172] (-1129.513) -- 0:00:41
      345000 -- (-1128.737) (-1128.744) (-1130.713) [-1129.514] * (-1128.203) [-1128.516] (-1128.764) (-1129.395) -- 0:00:41

      Average standard deviation of split frequencies: 0.013464

      345500 -- [-1130.132] (-1130.940) (-1128.996) (-1127.258) * (-1128.248) [-1128.766] (-1131.886) (-1129.095) -- 0:00:41
      346000 -- (-1128.188) (-1133.808) [-1129.994] (-1128.739) * (-1133.031) (-1129.319) [-1130.252] (-1128.631) -- 0:00:41
      346500 -- (-1127.718) (-1131.987) (-1128.231) [-1128.008] * [-1128.617] (-1128.611) (-1132.848) (-1128.839) -- 0:00:41
      347000 -- (-1131.678) (-1130.938) (-1126.947) [-1127.797] * (-1131.324) (-1131.527) [-1130.745] (-1130.651) -- 0:00:41
      347500 -- (-1129.397) (-1128.861) [-1128.896] (-1128.323) * (-1131.989) [-1130.590] (-1128.660) (-1130.518) -- 0:00:41
      348000 -- [-1131.744] (-1130.146) (-1132.008) (-1128.400) * (-1129.977) (-1132.041) (-1128.309) [-1129.468] -- 0:00:41
      348500 -- (-1129.004) (-1128.480) [-1128.021] (-1127.734) * (-1131.830) (-1130.539) [-1127.710] (-1128.016) -- 0:00:41
      349000 -- (-1131.754) (-1128.170) (-1130.921) [-1127.720] * [-1135.020] (-1127.533) (-1132.282) (-1129.047) -- 0:00:41
      349500 -- (-1128.430) [-1129.558] (-1128.537) (-1127.813) * (-1132.138) [-1128.748] (-1132.239) (-1129.067) -- 0:00:40
      350000 -- [-1130.252] (-1132.028) (-1128.937) (-1127.820) * (-1132.626) (-1127.756) [-1133.262] (-1127.580) -- 0:00:40

      Average standard deviation of split frequencies: 0.013206

      350500 -- [-1130.121] (-1130.513) (-1129.535) (-1127.841) * (-1133.532) [-1127.756] (-1129.785) (-1128.923) -- 0:00:40
      351000 -- (-1128.326) (-1129.470) [-1129.803] (-1129.293) * (-1130.539) [-1127.520] (-1127.972) (-1128.766) -- 0:00:40
      351500 -- (-1128.684) [-1127.974] (-1131.938) (-1130.649) * (-1128.053) (-1127.519) (-1127.594) [-1129.792] -- 0:00:40
      352000 -- [-1128.492] (-1128.316) (-1130.326) (-1130.849) * (-1127.629) (-1129.377) [-1128.699] (-1130.278) -- 0:00:40
      352500 -- [-1131.368] (-1129.500) (-1129.587) (-1128.322) * (-1130.071) (-1127.580) [-1128.185] (-1131.418) -- 0:00:40
      353000 -- (-1129.512) [-1128.416] (-1129.257) (-1130.500) * (-1131.457) (-1132.386) [-1127.306] (-1128.899) -- 0:00:40
      353500 -- [-1128.893] (-1128.613) (-1128.713) (-1131.624) * (-1128.876) (-1130.224) (-1128.795) [-1129.047] -- 0:00:40
      354000 -- [-1128.046] (-1135.337) (-1128.287) (-1138.202) * (-1129.504) [-1131.801] (-1131.280) (-1129.357) -- 0:00:40
      354500 -- [-1127.764] (-1128.732) (-1131.848) (-1127.681) * (-1129.525) (-1135.787) (-1131.710) [-1128.464] -- 0:00:40
      355000 -- (-1128.323) [-1129.831] (-1136.067) (-1128.273) * (-1130.906) [-1135.079] (-1131.153) (-1128.098) -- 0:00:39

      Average standard deviation of split frequencies: 0.012930

      355500 -- (-1128.293) [-1129.344] (-1129.349) (-1128.867) * (-1132.557) (-1129.982) (-1130.032) [-1127.768] -- 0:00:41
      356000 -- (-1127.250) (-1129.291) (-1130.424) [-1128.973] * (-1134.628) (-1127.468) (-1131.541) [-1127.469] -- 0:00:41
      356500 -- (-1129.456) (-1131.325) [-1131.112] (-1133.248) * (-1132.560) [-1128.956] (-1131.783) (-1128.793) -- 0:00:41
      357000 -- (-1130.729) (-1130.993) [-1130.182] (-1128.430) * (-1132.314) (-1129.426) (-1134.885) [-1127.748] -- 0:00:41
      357500 -- (-1129.700) (-1130.391) [-1128.254] (-1128.067) * [-1133.948] (-1129.256) (-1134.515) (-1129.458) -- 0:00:41
      358000 -- [-1127.929] (-1129.366) (-1128.448) (-1132.690) * (-1131.035) (-1133.521) [-1135.077] (-1130.295) -- 0:00:41
      358500 -- (-1128.456) (-1131.305) [-1130.459] (-1127.768) * [-1128.192] (-1128.996) (-1129.543) (-1135.395) -- 0:00:41
      359000 -- (-1128.612) [-1131.900] (-1130.459) (-1127.081) * (-1129.913) (-1131.315) [-1132.640] (-1135.433) -- 0:00:41
      359500 -- (-1130.668) [-1130.369] (-1130.947) (-1127.027) * [-1128.962] (-1132.090) (-1129.205) (-1130.554) -- 0:00:40
      360000 -- (-1129.307) [-1129.565] (-1129.660) (-1129.766) * [-1127.137] (-1128.927) (-1129.041) (-1128.225) -- 0:00:40

      Average standard deviation of split frequencies: 0.012071

      360500 -- (-1131.367) (-1131.851) (-1128.965) [-1128.100] * (-1127.589) (-1129.767) (-1128.171) [-1129.326] -- 0:00:40
      361000 -- (-1127.834) (-1127.425) [-1129.792] (-1127.994) * (-1130.123) (-1128.982) (-1128.146) [-1130.280] -- 0:00:40
      361500 -- (-1132.055) [-1128.066] (-1130.797) (-1128.054) * (-1130.202) (-1128.590) [-1127.325] (-1128.774) -- 0:00:40
      362000 -- [-1134.687] (-1132.502) (-1131.031) (-1128.439) * [-1128.664] (-1128.564) (-1130.431) (-1130.751) -- 0:00:40
      362500 -- (-1130.071) (-1133.813) [-1129.447] (-1127.567) * (-1127.483) [-1130.104] (-1130.976) (-1130.461) -- 0:00:40
      363000 -- [-1132.066] (-1132.235) (-1129.407) (-1128.396) * (-1129.455) (-1132.472) (-1131.555) [-1128.688] -- 0:00:40
      363500 -- (-1129.238) (-1134.319) [-1128.633] (-1129.234) * [-1130.339] (-1129.167) (-1133.002) (-1128.238) -- 0:00:40
      364000 -- [-1128.499] (-1129.091) (-1127.715) (-1127.994) * (-1130.939) (-1129.661) (-1130.235) [-1128.571] -- 0:00:40
      364500 -- (-1129.010) (-1127.996) (-1131.345) [-1126.868] * (-1128.769) (-1129.754) (-1132.346) [-1128.317] -- 0:00:40
      365000 -- (-1130.021) (-1128.662) (-1131.464) [-1127.732] * [-1128.066] (-1128.395) (-1128.725) (-1127.766) -- 0:00:40

      Average standard deviation of split frequencies: 0.011592

      365500 -- (-1130.552) [-1127.879] (-1134.306) (-1127.848) * [-1128.836] (-1129.221) (-1129.803) (-1128.013) -- 0:00:39
      366000 -- (-1131.594) [-1128.305] (-1127.951) (-1131.712) * [-1128.805] (-1129.761) (-1132.618) (-1127.262) -- 0:00:39
      366500 -- [-1132.101] (-1127.454) (-1129.167) (-1128.594) * (-1128.050) (-1129.383) [-1129.351] (-1130.173) -- 0:00:39
      367000 -- (-1128.323) (-1127.441) [-1128.711] (-1128.807) * (-1128.149) (-1128.584) (-1129.549) [-1129.941] -- 0:00:39
      367500 -- [-1129.706] (-1128.150) (-1132.353) (-1127.501) * (-1128.388) [-1129.140] (-1128.064) (-1132.216) -- 0:00:39
      368000 -- (-1128.775) (-1128.982) [-1132.346] (-1127.613) * (-1127.769) [-1128.127] (-1127.698) (-1132.429) -- 0:00:39
      368500 -- (-1130.102) (-1131.388) [-1129.566] (-1127.734) * (-1129.833) [-1127.460] (-1129.368) (-1129.348) -- 0:00:39
      369000 -- (-1129.381) [-1129.173] (-1129.990) (-1129.893) * (-1129.423) (-1132.564) [-1127.524] (-1128.538) -- 0:00:39
      369500 -- (-1129.644) (-1129.502) [-1129.532] (-1129.503) * (-1131.950) (-1130.410) (-1129.056) [-1127.608] -- 0:00:39
      370000 -- (-1129.124) [-1128.504] (-1129.215) (-1132.787) * (-1129.340) (-1128.441) [-1130.379] (-1128.120) -- 0:00:39

      Average standard deviation of split frequencies: 0.011670

      370500 -- (-1129.344) (-1128.505) [-1127.242] (-1128.176) * (-1127.928) [-1129.411] (-1129.010) (-1128.048) -- 0:00:39
      371000 -- (-1131.692) (-1128.418) (-1129.465) [-1128.482] * (-1127.926) (-1129.558) (-1131.928) [-1128.321] -- 0:00:38
      371500 -- (-1129.516) [-1131.858] (-1128.531) (-1140.455) * (-1128.224) [-1132.385] (-1130.895) (-1129.494) -- 0:00:38
      372000 -- (-1128.180) [-1128.956] (-1128.160) (-1133.527) * (-1127.943) (-1127.994) (-1131.210) [-1127.931] -- 0:00:40
      372500 -- [-1129.221] (-1127.881) (-1127.033) (-1131.480) * (-1127.479) [-1127.258] (-1130.050) (-1128.662) -- 0:00:40
      373000 -- [-1132.031] (-1128.378) (-1128.377) (-1133.058) * (-1128.003) (-1128.234) [-1129.362] (-1129.175) -- 0:00:40
      373500 -- (-1131.468) (-1127.904) (-1128.251) [-1131.875] * (-1132.468) (-1131.960) [-1129.868] (-1128.540) -- 0:00:40
      374000 -- (-1129.061) (-1128.488) [-1127.834] (-1127.997) * (-1132.810) (-1130.553) [-1130.740] (-1132.026) -- 0:00:40
      374500 -- [-1130.130] (-1128.867) (-1129.050) (-1127.132) * (-1130.003) (-1128.211) [-1130.405] (-1129.727) -- 0:00:40
      375000 -- [-1129.390] (-1127.716) (-1135.733) (-1130.319) * (-1133.152) [-1130.290] (-1139.135) (-1130.170) -- 0:00:40

      Average standard deviation of split frequencies: 0.011136

      375500 -- (-1127.588) [-1129.193] (-1132.703) (-1133.730) * (-1129.541) (-1128.089) (-1130.004) [-1131.824] -- 0:00:39
      376000 -- [-1132.574] (-1131.451) (-1133.769) (-1127.921) * (-1130.283) (-1131.302) (-1132.980) [-1130.095] -- 0:00:39
      376500 -- (-1132.552) (-1131.718) (-1129.579) [-1129.610] * [-1130.036] (-1128.893) (-1130.747) (-1128.371) -- 0:00:39
      377000 -- [-1133.177] (-1131.635) (-1134.956) (-1129.540) * (-1132.052) [-1129.286] (-1130.283) (-1128.272) -- 0:00:39
      377500 -- [-1127.632] (-1128.843) (-1129.767) (-1128.325) * (-1132.245) [-1131.484] (-1128.647) (-1134.399) -- 0:00:39
      378000 -- (-1127.527) [-1131.796] (-1135.163) (-1127.176) * (-1131.052) (-1129.895) [-1128.801] (-1127.696) -- 0:00:39
      378500 -- (-1127.891) (-1129.048) (-1131.364) [-1128.694] * [-1134.608] (-1130.796) (-1130.863) (-1127.454) -- 0:00:39
      379000 -- [-1127.287] (-1131.512) (-1128.060) (-1127.695) * (-1127.871) [-1129.500] (-1128.293) (-1129.739) -- 0:00:39
      379500 -- (-1128.046) (-1131.697) [-1131.116] (-1128.208) * (-1128.930) (-1128.715) [-1128.834] (-1129.483) -- 0:00:39
      380000 -- (-1128.623) (-1130.921) [-1131.334] (-1129.065) * (-1128.167) (-1129.742) [-1128.489] (-1131.008) -- 0:00:39

      Average standard deviation of split frequencies: 0.012019

      380500 -- (-1128.363) (-1129.286) [-1129.495] (-1128.000) * (-1128.032) [-1128.238] (-1130.301) (-1128.988) -- 0:00:39
      381000 -- (-1127.244) (-1130.000) (-1130.465) [-1132.143] * [-1131.083] (-1131.664) (-1129.586) (-1131.268) -- 0:00:38
      381500 -- [-1128.920] (-1131.414) (-1130.223) (-1128.042) * [-1132.009] (-1129.157) (-1130.055) (-1132.794) -- 0:00:38
      382000 -- [-1131.461] (-1129.658) (-1128.022) (-1130.842) * [-1127.286] (-1128.464) (-1129.021) (-1127.425) -- 0:00:38
      382500 -- (-1128.621) [-1129.393] (-1128.156) (-1127.404) * [-1128.306] (-1130.108) (-1127.550) (-1128.387) -- 0:00:38
      383000 -- (-1129.839) (-1128.666) [-1131.161] (-1129.050) * (-1130.000) (-1132.326) [-1128.074] (-1130.247) -- 0:00:38
      383500 -- (-1130.150) (-1127.865) [-1132.690] (-1128.918) * (-1132.356) [-1127.905] (-1128.085) (-1129.588) -- 0:00:38
      384000 -- (-1128.945) [-1130.770] (-1129.736) (-1128.762) * [-1127.960] (-1126.903) (-1128.160) (-1129.639) -- 0:00:38
      384500 -- (-1128.535) (-1128.677) (-1129.713) [-1130.244] * (-1130.555) (-1129.101) [-1127.693] (-1131.699) -- 0:00:38
      385000 -- [-1131.405] (-1129.057) (-1131.147) (-1134.098) * (-1128.245) (-1129.040) (-1128.832) [-1130.200] -- 0:00:38

      Average standard deviation of split frequencies: 0.011063

      385500 -- [-1128.004] (-1129.958) (-1127.942) (-1131.171) * (-1128.638) (-1129.526) (-1128.569) [-1130.200] -- 0:00:38
      386000 -- (-1129.190) (-1127.528) (-1127.935) [-1128.270] * (-1132.323) (-1130.073) [-1130.981] (-1129.090) -- 0:00:38
      386500 -- (-1128.456) (-1128.069) (-1128.082) [-1129.049] * (-1130.800) (-1128.410) (-1132.419) [-1129.639] -- 0:00:38
      387000 -- (-1130.505) (-1128.870) [-1128.084] (-1129.545) * (-1131.041) [-1127.606] (-1132.259) (-1129.409) -- 0:00:38
      387500 -- (-1131.501) [-1127.016] (-1131.023) (-1127.823) * (-1128.710) [-1127.473] (-1131.396) (-1130.628) -- 0:00:37
      388000 -- (-1129.465) [-1128.900] (-1130.332) (-1129.528) * (-1129.296) [-1128.667] (-1130.323) (-1134.163) -- 0:00:39
      388500 -- (-1130.161) (-1128.905) (-1130.910) [-1128.365] * (-1129.355) (-1128.910) [-1130.761] (-1129.795) -- 0:00:39
      389000 -- (-1130.421) (-1129.179) [-1132.236] (-1131.303) * (-1129.849) (-1129.634) [-1132.541] (-1131.800) -- 0:00:39
      389500 -- (-1130.755) (-1130.345) [-1131.048] (-1127.614) * (-1128.587) [-1130.287] (-1130.155) (-1131.980) -- 0:00:39
      390000 -- [-1130.867] (-1128.443) (-1130.376) (-1128.403) * (-1128.388) [-1128.130] (-1130.504) (-1132.693) -- 0:00:39

      Average standard deviation of split frequencies: 0.010647

      390500 -- (-1130.512) (-1129.346) [-1129.375] (-1128.355) * (-1128.187) (-1127.553) (-1130.793) [-1127.598] -- 0:00:39
      391000 -- (-1128.947) (-1128.995) [-1128.909] (-1128.412) * [-1127.834] (-1133.406) (-1129.507) (-1128.635) -- 0:00:38
      391500 -- (-1129.375) (-1130.463) [-1131.872] (-1136.936) * (-1128.082) (-1132.635) [-1128.506] (-1128.451) -- 0:00:38
      392000 -- (-1128.585) (-1128.882) (-1131.135) [-1130.827] * (-1127.958) (-1134.433) [-1127.546] (-1130.022) -- 0:00:38
      392500 -- (-1129.830) (-1128.433) [-1127.234] (-1129.106) * (-1130.284) (-1128.268) [-1129.893] (-1133.913) -- 0:00:38
      393000 -- (-1130.730) [-1127.902] (-1128.099) (-1129.101) * (-1128.264) (-1134.188) (-1128.308) [-1130.521] -- 0:00:38
      393500 -- (-1128.658) [-1128.287] (-1129.796) (-1130.670) * [-1127.482] (-1127.908) (-1128.308) (-1131.074) -- 0:00:38
      394000 -- [-1132.272] (-1131.270) (-1133.529) (-1133.430) * [-1132.631] (-1127.345) (-1130.489) (-1133.825) -- 0:00:38
      394500 -- [-1127.745] (-1134.707) (-1132.296) (-1130.479) * (-1132.500) (-1130.604) (-1128.772) [-1131.005] -- 0:00:38
      395000 -- (-1128.925) (-1131.342) (-1130.142) [-1130.418] * (-1130.802) (-1128.713) [-1128.373] (-1130.694) -- 0:00:38

      Average standard deviation of split frequencies: 0.011134

      395500 -- (-1128.859) (-1131.318) (-1127.667) [-1128.159] * (-1129.833) (-1130.758) [-1128.792] (-1134.320) -- 0:00:38
      396000 -- (-1128.050) [-1128.954] (-1127.766) (-1131.336) * (-1128.771) [-1128.262] (-1130.105) (-1128.887) -- 0:00:38
      396500 -- (-1131.272) (-1129.932) [-1128.377] (-1127.770) * [-1129.373] (-1129.483) (-1131.313) (-1128.485) -- 0:00:38
      397000 -- (-1129.711) (-1128.774) (-1128.250) [-1127.247] * (-1131.322) (-1132.995) (-1129.606) [-1127.407] -- 0:00:37
      397500 -- (-1130.046) (-1128.297) [-1131.754] (-1127.236) * (-1131.221) (-1133.825) (-1127.804) [-1128.457] -- 0:00:37
      398000 -- (-1133.856) [-1128.439] (-1127.745) (-1131.971) * (-1130.308) [-1128.239] (-1128.087) (-1128.548) -- 0:00:37
      398500 -- [-1127.770] (-1127.560) (-1130.456) (-1132.332) * (-1129.540) (-1127.987) [-1129.162] (-1129.647) -- 0:00:37
      399000 -- (-1129.134) (-1128.363) (-1129.247) [-1130.672] * (-1131.314) (-1132.573) [-1128.880] (-1135.484) -- 0:00:37
      399500 -- (-1128.446) [-1127.766] (-1128.851) (-1131.278) * (-1130.476) [-1130.398] (-1128.811) (-1129.242) -- 0:00:37
      400000 -- (-1128.353) (-1128.455) [-1128.559] (-1132.229) * [-1129.209] (-1127.059) (-1131.033) (-1128.169) -- 0:00:37

      Average standard deviation of split frequencies: 0.010935

      400500 -- (-1128.376) (-1127.923) [-1129.215] (-1129.855) * (-1127.953) (-1129.688) (-1134.067) [-1127.796] -- 0:00:37
      401000 -- (-1128.902) [-1127.616] (-1127.963) (-1128.843) * [-1127.625] (-1128.810) (-1127.595) (-1128.928) -- 0:00:37
      401500 -- (-1128.515) (-1128.512) [-1128.810] (-1129.463) * (-1127.891) (-1132.924) [-1127.825] (-1127.710) -- 0:00:37
      402000 -- [-1132.608] (-1127.987) (-1127.337) (-1129.437) * [-1128.731] (-1127.652) (-1131.437) (-1128.119) -- 0:00:37
      402500 -- (-1128.339) (-1128.176) (-1128.735) [-1130.474] * (-1128.055) (-1130.143) (-1129.710) [-1127.845] -- 0:00:37
      403000 -- (-1128.465) (-1130.694) [-1128.036] (-1130.055) * [-1127.975] (-1129.900) (-1130.388) (-1128.221) -- 0:00:37
      403500 -- [-1127.997] (-1129.961) (-1129.892) (-1130.719) * (-1128.288) (-1128.819) (-1130.980) [-1128.059] -- 0:00:36
      404000 -- (-1130.287) (-1129.023) [-1127.287] (-1130.066) * (-1127.996) (-1129.918) [-1127.568] (-1130.317) -- 0:00:36
      404500 -- (-1127.558) (-1128.526) (-1128.427) [-1133.883] * (-1130.133) (-1129.935) (-1129.417) [-1128.636] -- 0:00:38
      405000 -- (-1127.557) [-1130.741] (-1128.394) (-1131.266) * (-1130.735) [-1127.096] (-1132.732) (-1128.861) -- 0:00:38

      Average standard deviation of split frequencies: 0.010791

      405500 -- (-1132.237) (-1129.399) [-1130.228] (-1131.538) * [-1128.071] (-1128.303) (-1131.437) (-1128.994) -- 0:00:38
      406000 -- (-1131.728) (-1132.696) (-1129.443) [-1128.390] * [-1133.720] (-1131.873) (-1132.619) (-1129.492) -- 0:00:38
      406500 -- (-1128.596) (-1128.346) (-1128.967) [-1129.510] * [-1129.891] (-1132.250) (-1128.116) (-1130.509) -- 0:00:37
      407000 -- [-1128.210] (-1130.139) (-1129.506) (-1130.966) * (-1128.861) [-1129.422] (-1128.770) (-1128.367) -- 0:00:37
      407500 -- (-1131.804) (-1130.528) [-1131.072] (-1129.183) * (-1128.577) (-1128.524) [-1128.039] (-1128.390) -- 0:00:37
      408000 -- [-1131.808] (-1132.525) (-1129.953) (-1129.134) * (-1128.289) (-1129.612) [-1127.790] (-1132.291) -- 0:00:37
      408500 -- (-1130.503) (-1129.939) (-1132.327) [-1129.069] * (-1128.533) [-1129.229] (-1130.362) (-1130.238) -- 0:00:37
      409000 -- (-1132.567) (-1129.757) (-1128.225) [-1128.998] * (-1129.971) (-1128.978) (-1130.633) [-1127.640] -- 0:00:37
      409500 -- [-1129.310] (-1129.916) (-1127.643) (-1127.864) * [-1129.236] (-1129.489) (-1132.500) (-1129.227) -- 0:00:37
      410000 -- (-1131.933) (-1128.342) (-1126.974) [-1127.601] * (-1129.557) (-1128.577) (-1129.941) [-1129.303] -- 0:00:37

      Average standard deviation of split frequencies: 0.010196

      410500 -- (-1131.753) [-1128.276] (-1127.049) (-1129.173) * (-1132.518) [-1128.420] (-1138.148) (-1134.908) -- 0:00:37
      411000 -- (-1130.350) (-1130.353) [-1127.317] (-1136.694) * (-1129.251) [-1128.773] (-1137.995) (-1131.646) -- 0:00:37
      411500 -- [-1130.137] (-1128.999) (-1127.733) (-1131.241) * (-1130.297) [-1130.812] (-1128.247) (-1128.395) -- 0:00:37
      412000 -- [-1128.568] (-1128.106) (-1129.443) (-1131.153) * (-1130.994) (-1128.151) [-1130.592] (-1128.091) -- 0:00:37
      412500 -- [-1128.267] (-1129.858) (-1129.066) (-1133.183) * (-1130.219) (-1127.887) (-1129.054) [-1128.053] -- 0:00:37
      413000 -- (-1130.199) (-1130.070) (-1129.701) [-1128.544] * (-1130.068) (-1128.813) [-1128.305] (-1128.376) -- 0:00:36
      413500 -- (-1129.995) (-1128.061) (-1129.746) [-1128.542] * (-1129.381) (-1134.254) [-1131.102] (-1129.595) -- 0:00:36
      414000 -- [-1131.259] (-1127.881) (-1129.029) (-1127.774) * [-1129.072] (-1132.353) (-1129.872) (-1137.313) -- 0:00:36
      414500 -- [-1130.608] (-1130.139) (-1129.598) (-1129.424) * [-1129.919] (-1134.411) (-1128.416) (-1128.875) -- 0:00:36
      415000 -- (-1131.549) [-1128.138] (-1131.355) (-1127.780) * (-1129.839) (-1131.258) [-1134.316] (-1129.701) -- 0:00:36

      Average standard deviation of split frequencies: 0.010465

      415500 -- (-1131.919) (-1129.846) [-1130.103] (-1128.286) * (-1132.280) (-1129.057) (-1130.418) [-1129.599] -- 0:00:36
      416000 -- (-1128.436) [-1128.866] (-1131.452) (-1127.648) * (-1128.409) [-1129.557] (-1127.745) (-1132.993) -- 0:00:36
      416500 -- [-1127.720] (-1128.230) (-1128.977) (-1129.283) * (-1128.302) (-1128.501) (-1130.247) [-1132.182] -- 0:00:36
      417000 -- (-1128.533) [-1128.109] (-1130.687) (-1129.107) * [-1127.857] (-1127.613) (-1128.568) (-1135.469) -- 0:00:36
      417500 -- (-1127.861) [-1129.416] (-1128.134) (-1128.697) * [-1128.923] (-1129.525) (-1129.938) (-1134.840) -- 0:00:36
      418000 -- [-1131.041] (-1128.286) (-1129.381) (-1128.521) * (-1128.825) [-1127.127] (-1128.027) (-1130.535) -- 0:00:36
      418500 -- (-1127.988) [-1128.054] (-1130.108) (-1127.844) * [-1128.592] (-1127.867) (-1132.512) (-1129.382) -- 0:00:36
      419000 -- [-1127.798] (-1132.930) (-1129.046) (-1128.742) * (-1129.927) (-1129.500) (-1129.041) [-1129.501] -- 0:00:36
      419500 -- (-1131.297) [-1127.958] (-1131.011) (-1129.684) * (-1131.829) [-1130.421] (-1129.148) (-1129.392) -- 0:00:35
      420000 -- (-1131.960) (-1127.704) (-1132.635) [-1128.968] * (-1130.507) (-1130.255) (-1128.683) [-1128.566] -- 0:00:35

      Average standard deviation of split frequencies: 0.010283

      420500 -- (-1128.561) (-1128.339) (-1136.782) [-1128.348] * (-1129.001) (-1130.125) [-1127.944] (-1129.645) -- 0:00:37
      421000 -- (-1129.371) [-1128.715] (-1127.956) (-1128.416) * [-1128.371] (-1129.984) (-1129.298) (-1127.776) -- 0:00:37
      421500 -- (-1132.051) [-1128.792] (-1128.532) (-1130.053) * (-1129.901) (-1129.088) [-1131.706] (-1132.200) -- 0:00:37
      422000 -- (-1132.316) (-1130.793) (-1128.548) [-1130.123] * (-1129.078) [-1127.770] (-1128.615) (-1133.159) -- 0:00:36
      422500 -- (-1130.745) (-1132.854) (-1130.118) [-1129.755] * [-1129.270] (-1129.055) (-1127.984) (-1133.160) -- 0:00:36
      423000 -- (-1131.532) (-1129.551) [-1130.537] (-1130.857) * [-1129.081] (-1129.711) (-1130.588) (-1129.347) -- 0:00:36
      423500 -- (-1131.970) [-1128.895] (-1128.110) (-1135.777) * (-1128.546) [-1129.559] (-1131.339) (-1127.689) -- 0:00:36
      424000 -- (-1129.279) (-1128.583) (-1132.734) [-1129.666] * (-1127.647) (-1130.873) (-1129.815) [-1130.353] -- 0:00:36
      424500 -- (-1131.754) (-1130.460) [-1134.102] (-1130.066) * (-1129.827) [-1130.191] (-1127.585) (-1129.660) -- 0:00:36
      425000 -- (-1130.697) (-1130.226) [-1132.070] (-1131.384) * (-1128.889) (-1130.373) [-1127.501] (-1128.663) -- 0:00:36

      Average standard deviation of split frequencies: 0.010089

      425500 -- (-1128.940) [-1129.229] (-1127.606) (-1129.427) * (-1127.306) (-1132.303) [-1130.626] (-1130.697) -- 0:00:36
      426000 -- (-1131.059) (-1130.322) [-1129.089] (-1133.993) * [-1127.644] (-1129.831) (-1130.317) (-1132.126) -- 0:00:36
      426500 -- (-1131.163) (-1127.997) [-1128.816] (-1131.723) * (-1127.837) [-1128.885] (-1133.784) (-1132.687) -- 0:00:36
      427000 -- (-1133.396) (-1128.233) [-1127.209] (-1130.962) * (-1130.229) (-1129.008) (-1132.112) [-1132.883] -- 0:00:36
      427500 -- [-1128.535] (-1128.045) (-1132.191) (-1128.842) * (-1132.069) (-1132.564) [-1129.340] (-1132.700) -- 0:00:36
      428000 -- (-1127.433) [-1127.975] (-1128.301) (-1128.746) * (-1129.026) (-1128.539) [-1129.343] (-1132.170) -- 0:00:36
      428500 -- (-1129.677) [-1129.245] (-1128.877) (-1129.212) * [-1130.400] (-1127.534) (-1128.719) (-1131.718) -- 0:00:36
      429000 -- (-1127.906) (-1129.002) (-1128.683) [-1128.034] * (-1127.965) (-1128.261) (-1127.953) [-1130.201] -- 0:00:35
      429500 -- [-1128.074] (-1129.272) (-1131.033) (-1130.209) * [-1128.512] (-1128.317) (-1128.944) (-1128.813) -- 0:00:35
      430000 -- (-1130.708) (-1128.266) (-1131.388) [-1130.996] * (-1129.313) (-1129.303) (-1128.842) [-1128.167] -- 0:00:35

      Average standard deviation of split frequencies: 0.009916

      430500 -- (-1133.185) [-1133.477] (-1129.160) (-1129.087) * (-1129.197) [-1128.352] (-1131.951) (-1127.295) -- 0:00:35
      431000 -- [-1128.044] (-1127.969) (-1127.682) (-1129.053) * (-1128.995) [-1128.072] (-1130.312) (-1127.732) -- 0:00:35
      431500 -- (-1128.207) [-1129.088] (-1128.299) (-1130.155) * [-1130.199] (-1130.060) (-1128.966) (-1128.385) -- 0:00:35
      432000 -- (-1131.321) (-1128.042) (-1127.990) [-1131.239] * (-1130.499) (-1129.851) (-1128.911) [-1130.907] -- 0:00:35
      432500 -- (-1130.029) (-1127.830) [-1131.673] (-1130.826) * (-1132.700) (-1129.957) [-1129.406] (-1129.205) -- 0:00:35
      433000 -- (-1128.608) (-1131.971) [-1127.591] (-1130.146) * (-1131.967) (-1128.754) (-1129.643) [-1127.432] -- 0:00:35
      433500 -- [-1127.849] (-1126.932) (-1128.025) (-1127.278) * (-1131.508) (-1127.389) (-1127.055) [-1128.889] -- 0:00:35
      434000 -- (-1128.527) (-1128.416) [-1127.166] (-1127.866) * (-1128.298) (-1128.570) [-1127.804] (-1129.123) -- 0:00:35
      434500 -- [-1128.573] (-1129.024) (-1127.246) (-1129.465) * [-1130.183] (-1129.156) (-1129.971) (-1129.392) -- 0:00:35
      435000 -- (-1130.433) [-1132.834] (-1127.410) (-1129.409) * (-1130.986) (-1128.649) (-1128.135) [-1131.474] -- 0:00:35

      Average standard deviation of split frequencies: 0.010136

      435500 -- (-1130.379) [-1127.300] (-1127.689) (-1127.750) * (-1128.577) [-1128.293] (-1128.226) (-1128.358) -- 0:00:34
      436000 -- (-1129.422) [-1127.297] (-1129.210) (-1128.228) * [-1128.427] (-1127.477) (-1128.723) (-1127.490) -- 0:00:34
      436500 -- (-1129.154) (-1129.717) [-1128.812] (-1134.314) * (-1128.790) [-1128.979] (-1130.047) (-1128.494) -- 0:00:34
      437000 -- [-1130.410] (-1128.231) (-1135.650) (-1128.450) * (-1129.794) (-1131.122) [-1128.570] (-1128.590) -- 0:00:36
      437500 -- (-1128.364) (-1129.408) [-1129.575] (-1129.276) * (-1129.748) (-1130.442) [-1130.213] (-1128.695) -- 0:00:36
      438000 -- [-1128.063] (-1129.009) (-1129.900) (-1127.830) * (-1129.028) (-1132.111) [-1129.300] (-1130.242) -- 0:00:35
      438500 -- (-1128.640) (-1129.707) [-1130.635] (-1127.957) * (-1130.429) [-1135.349] (-1137.376) (-1129.979) -- 0:00:35
      439000 -- [-1128.988] (-1127.954) (-1133.259) (-1130.027) * (-1130.408) [-1133.349] (-1130.347) (-1128.940) -- 0:00:35
      439500 -- [-1127.460] (-1128.903) (-1132.979) (-1128.045) * (-1129.326) (-1128.344) [-1130.963] (-1127.462) -- 0:00:35
      440000 -- (-1127.639) (-1127.262) (-1133.064) [-1127.493] * (-1128.918) [-1128.128] (-1128.312) (-1127.651) -- 0:00:35

      Average standard deviation of split frequencies: 0.010029

      440500 -- (-1129.215) [-1127.624] (-1128.939) (-1127.322) * [-1126.972] (-1129.378) (-1132.017) (-1127.655) -- 0:00:35
      441000 -- (-1131.690) [-1127.410] (-1130.621) (-1129.756) * (-1129.905) (-1127.822) (-1130.477) [-1127.469] -- 0:00:35
      441500 -- [-1133.486] (-1129.674) (-1130.679) (-1128.444) * (-1129.000) [-1129.707] (-1127.723) (-1128.360) -- 0:00:35
      442000 -- (-1127.828) (-1128.110) (-1129.044) [-1128.360] * (-1127.654) [-1131.040] (-1128.301) (-1128.773) -- 0:00:35
      442500 -- [-1127.340] (-1129.203) (-1131.586) (-1130.241) * (-1129.483) (-1130.217) (-1127.714) [-1127.509] -- 0:00:35
      443000 -- (-1130.117) (-1129.821) [-1131.955] (-1131.595) * (-1129.046) (-1129.836) [-1128.801] (-1130.718) -- 0:00:35
      443500 -- (-1131.063) (-1136.720) (-1130.706) [-1127.452] * [-1130.143] (-1132.333) (-1134.222) (-1130.856) -- 0:00:35
      444000 -- (-1128.764) (-1128.467) (-1127.458) [-1127.433] * (-1128.917) [-1131.831] (-1133.879) (-1130.224) -- 0:00:35
      444500 -- (-1129.342) (-1128.017) (-1128.251) [-1128.378] * (-1128.513) (-1128.763) (-1131.913) [-1130.153] -- 0:00:34
      445000 -- (-1128.358) (-1129.372) [-1134.723] (-1128.269) * [-1129.116] (-1129.634) (-1131.589) (-1129.660) -- 0:00:34

      Average standard deviation of split frequencies: 0.009909

      445500 -- (-1130.060) [-1128.365] (-1132.516) (-1129.304) * (-1134.153) (-1127.638) [-1127.666] (-1129.790) -- 0:00:34
      446000 -- (-1129.649) [-1128.362] (-1129.577) (-1127.781) * (-1128.631) (-1129.657) [-1128.385] (-1131.206) -- 0:00:34
      446500 -- [-1129.354] (-1127.642) (-1129.157) (-1127.788) * (-1128.948) (-1130.190) (-1134.274) [-1129.502] -- 0:00:34
      447000 -- (-1129.861) [-1131.414] (-1130.760) (-1128.348) * (-1129.680) [-1132.130] (-1132.110) (-1129.156) -- 0:00:34
      447500 -- (-1128.693) (-1127.355) [-1129.163] (-1128.210) * [-1129.711] (-1129.071) (-1127.137) (-1128.459) -- 0:00:34
      448000 -- (-1128.651) (-1128.287) (-1129.698) [-1130.096] * (-1130.779) (-1127.392) [-1128.614] (-1128.636) -- 0:00:34
      448500 -- (-1129.644) (-1128.664) [-1129.398] (-1127.255) * (-1131.681) (-1128.336) [-1128.834] (-1128.679) -- 0:00:34
      449000 -- (-1129.124) (-1128.201) [-1129.570] (-1127.466) * (-1128.170) [-1128.637] (-1127.924) (-1128.555) -- 0:00:34
      449500 -- (-1132.497) (-1129.761) (-1129.289) [-1130.866] * (-1129.394) (-1131.119) [-1127.875] (-1131.907) -- 0:00:34
      450000 -- (-1134.502) (-1132.259) [-1129.295] (-1133.339) * (-1130.396) (-1129.419) [-1129.012] (-1135.173) -- 0:00:34

      Average standard deviation of split frequencies: 0.009741

      450500 -- [-1128.953] (-1128.816) (-1129.832) (-1130.915) * (-1131.099) (-1128.233) (-1131.422) [-1129.047] -- 0:00:34
      451000 -- (-1129.297) [-1128.292] (-1128.789) (-1132.751) * [-1128.882] (-1128.618) (-1127.835) (-1127.769) -- 0:00:34
      451500 -- (-1128.440) [-1128.177] (-1128.908) (-1128.167) * (-1128.495) (-1129.262) [-1128.080] (-1127.984) -- 0:00:34
      452000 -- (-1128.629) [-1127.339] (-1131.663) (-1128.580) * (-1127.823) (-1128.927) (-1128.254) [-1129.993] -- 0:00:33
      452500 -- (-1130.157) (-1127.138) [-1132.049] (-1129.872) * (-1128.587) [-1128.048] (-1128.302) (-1132.222) -- 0:00:33
      453000 -- (-1129.552) (-1127.421) [-1127.503] (-1129.193) * (-1130.785) (-1128.132) (-1128.989) [-1130.638] -- 0:00:33
      453500 -- (-1129.568) (-1128.627) (-1130.441) [-1128.163] * (-1131.714) (-1128.158) (-1127.493) [-1133.808] -- 0:00:34
      454000 -- (-1129.437) (-1129.895) (-1129.101) [-1129.733] * (-1130.496) (-1128.352) [-1130.148] (-1132.200) -- 0:00:34
      454500 -- (-1129.322) (-1130.313) [-1129.201] (-1131.245) * (-1129.266) (-1130.611) (-1128.587) [-1129.801] -- 0:00:34
      455000 -- (-1127.111) [-1130.641] (-1128.196) (-1128.553) * (-1131.539) (-1130.532) [-1128.244] (-1127.085) -- 0:00:34

      Average standard deviation of split frequencies: 0.009950

      455500 -- [-1130.508] (-1130.714) (-1129.329) (-1128.010) * (-1129.780) (-1128.632) [-1128.743] (-1130.344) -- 0:00:34
      456000 -- (-1130.111) (-1127.309) (-1127.889) [-1130.214] * (-1129.905) [-1129.381] (-1130.387) (-1131.964) -- 0:00:34
      456500 -- (-1132.206) (-1127.949) [-1127.580] (-1127.810) * (-1130.456) (-1129.348) [-1129.555] (-1130.654) -- 0:00:34
      457000 -- (-1127.754) (-1127.714) [-1127.900] (-1128.805) * (-1128.520) [-1129.733] (-1130.397) (-1129.734) -- 0:00:34
      457500 -- (-1130.055) [-1131.362] (-1128.375) (-1128.594) * (-1129.554) (-1129.329) [-1127.557] (-1130.935) -- 0:00:34
      458000 -- (-1128.111) [-1128.591] (-1128.550) (-1128.368) * (-1131.110) (-1129.808) (-1128.196) [-1127.276] -- 0:00:34
      458500 -- (-1130.079) [-1128.396] (-1129.022) (-1129.712) * (-1130.251) [-1127.903] (-1128.566) (-1128.531) -- 0:00:34
      459000 -- (-1130.337) [-1127.557] (-1131.411) (-1128.231) * [-1128.694] (-1130.772) (-1128.467) (-1128.326) -- 0:00:34
      459500 -- (-1127.720) (-1129.861) [-1129.156] (-1128.665) * (-1132.251) (-1129.138) [-1128.176] (-1131.432) -- 0:00:34
      460000 -- (-1128.784) (-1128.358) (-1129.982) [-1128.489] * (-1132.785) (-1131.091) [-1131.278] (-1134.189) -- 0:00:34

      Average standard deviation of split frequencies: 0.009785

      460500 -- (-1128.192) (-1127.204) (-1130.661) [-1130.618] * (-1131.301) [-1128.014] (-1129.798) (-1132.776) -- 0:00:33
      461000 -- (-1128.839) (-1127.485) [-1129.479] (-1130.496) * (-1129.848) (-1127.358) [-1128.192] (-1128.390) -- 0:00:33
      461500 -- (-1131.656) [-1129.203] (-1132.855) (-1131.052) * [-1129.255] (-1127.724) (-1127.809) (-1131.021) -- 0:00:33
      462000 -- (-1129.618) (-1132.613) (-1132.366) [-1127.981] * [-1127.816] (-1127.763) (-1127.513) (-1133.599) -- 0:00:33
      462500 -- (-1130.467) (-1129.917) (-1131.073) [-1128.197] * (-1130.628) (-1130.125) (-1133.110) [-1128.417] -- 0:00:33
      463000 -- (-1129.951) (-1130.033) (-1133.077) [-1128.507] * (-1130.919) (-1132.724) (-1130.922) [-1129.980] -- 0:00:33
      463500 -- [-1129.354] (-1128.159) (-1130.961) (-1131.700) * [-1128.833] (-1131.853) (-1127.417) (-1130.811) -- 0:00:33
      464000 -- (-1131.047) [-1129.556] (-1128.347) (-1132.843) * (-1131.053) (-1129.264) (-1128.115) [-1129.153] -- 0:00:33
      464500 -- (-1134.127) (-1129.864) [-1127.662] (-1130.362) * (-1132.087) (-1131.081) [-1129.902] (-1130.604) -- 0:00:33
      465000 -- (-1130.196) [-1128.566] (-1135.215) (-1129.114) * [-1128.644] (-1129.832) (-1127.522) (-1132.485) -- 0:00:33

      Average standard deviation of split frequencies: 0.010685

      465500 -- (-1129.083) (-1127.960) (-1129.616) [-1130.872] * (-1128.177) (-1130.722) [-1127.965] (-1131.504) -- 0:00:33
      466000 -- (-1128.760) [-1129.017] (-1128.024) (-1130.702) * (-1129.001) (-1133.010) [-1129.341] (-1129.684) -- 0:00:33
      466500 -- (-1129.786) [-1126.953] (-1129.098) (-1130.944) * [-1128.668] (-1130.448) (-1133.059) (-1130.840) -- 0:00:33
      467000 -- (-1131.018) (-1127.953) (-1128.809) [-1129.979] * (-1127.245) (-1128.760) (-1132.231) [-1128.917] -- 0:00:33
      467500 -- [-1127.987] (-1128.055) (-1132.029) (-1134.914) * (-1128.591) (-1127.875) [-1127.981] (-1129.003) -- 0:00:33
      468000 -- [-1127.973] (-1129.626) (-1130.534) (-1130.321) * [-1128.265] (-1129.102) (-1127.568) (-1130.040) -- 0:00:32
      468500 -- (-1128.406) [-1130.500] (-1129.711) (-1127.749) * (-1129.013) (-1129.982) [-1127.457] (-1128.635) -- 0:00:32
      469000 -- (-1130.973) [-1130.056] (-1129.383) (-1127.651) * [-1129.972] (-1128.658) (-1127.288) (-1129.383) -- 0:00:32
      469500 -- (-1131.019) (-1129.731) (-1129.048) [-1127.656] * (-1129.074) [-1128.314] (-1130.776) (-1129.049) -- 0:00:32
      470000 -- [-1130.317] (-1127.906) (-1133.425) (-1130.109) * (-1129.938) (-1127.949) [-1130.078] (-1127.463) -- 0:00:33

      Average standard deviation of split frequencies: 0.011080

      470500 -- (-1130.189) [-1130.098] (-1128.174) (-1129.447) * [-1127.860] (-1129.169) (-1129.561) (-1129.161) -- 0:00:33
      471000 -- (-1129.517) (-1127.298) (-1129.467) [-1129.303] * (-1127.807) (-1128.396) [-1129.531] (-1131.026) -- 0:00:33
      471500 -- (-1135.911) (-1130.574) (-1128.499) [-1129.869] * (-1127.508) (-1128.475) (-1127.234) [-1129.160] -- 0:00:33
      472000 -- (-1129.478) [-1130.444] (-1129.465) (-1134.544) * (-1127.508) (-1129.420) [-1127.163] (-1131.377) -- 0:00:33
      472500 -- (-1128.389) [-1128.921] (-1131.097) (-1133.085) * [-1129.912] (-1128.463) (-1128.521) (-1127.741) -- 0:00:33
      473000 -- [-1127.931] (-1127.775) (-1132.136) (-1130.214) * [-1133.293] (-1128.343) (-1130.762) (-1128.381) -- 0:00:33
      473500 -- (-1128.397) (-1131.399) [-1127.951] (-1131.001) * (-1129.057) (-1133.226) (-1129.452) [-1128.340] -- 0:00:33
      474000 -- [-1128.016] (-1130.488) (-1128.653) (-1133.013) * (-1134.361) (-1137.234) [-1128.565] (-1130.662) -- 0:00:33
      474500 -- (-1128.643) (-1131.168) [-1129.547] (-1129.154) * (-1127.643) [-1130.621] (-1127.826) (-1129.146) -- 0:00:33
      475000 -- (-1130.616) (-1129.090) [-1127.511] (-1130.803) * (-1129.277) (-1133.516) [-1129.508] (-1131.665) -- 0:00:33

      Average standard deviation of split frequencies: 0.011637

      475500 -- [-1129.832] (-1132.042) (-1129.173) (-1132.797) * [-1128.573] (-1130.762) (-1129.082) (-1131.691) -- 0:00:33
      476000 -- (-1131.517) [-1130.438] (-1128.577) (-1131.159) * [-1127.786] (-1131.657) (-1127.921) (-1128.267) -- 0:00:33
      476500 -- [-1129.993] (-1130.763) (-1129.075) (-1130.269) * (-1132.166) (-1132.682) [-1133.241] (-1131.775) -- 0:00:32
      477000 -- (-1127.420) (-1128.417) [-1127.244] (-1129.684) * (-1131.014) (-1128.337) [-1127.153] (-1129.635) -- 0:00:32
      477500 -- (-1128.111) [-1129.234] (-1129.179) (-1129.994) * (-1131.727) [-1130.385] (-1128.024) (-1129.392) -- 0:00:32
      478000 -- (-1130.113) (-1127.930) (-1129.933) [-1130.674] * (-1128.560) (-1128.403) (-1127.968) [-1128.289] -- 0:00:32
      478500 -- (-1131.829) [-1128.876] (-1129.072) (-1130.343) * (-1132.862) [-1131.991] (-1134.443) (-1128.848) -- 0:00:32
      479000 -- (-1129.349) (-1130.778) [-1130.046] (-1127.174) * (-1129.110) (-1128.035) (-1132.779) [-1128.360] -- 0:00:32
      479500 -- (-1130.116) [-1131.994] (-1130.737) (-1131.448) * [-1128.748] (-1128.017) (-1130.341) (-1129.994) -- 0:00:32
      480000 -- (-1128.967) [-1130.708] (-1130.679) (-1129.594) * (-1130.230) (-1129.919) (-1129.708) [-1130.238] -- 0:00:32

      Average standard deviation of split frequencies: 0.010972

      480500 -- (-1127.716) (-1130.782) (-1130.563) [-1128.608] * (-1131.895) (-1130.245) (-1129.428) [-1130.234] -- 0:00:32
      481000 -- (-1130.293) (-1130.882) (-1129.518) [-1130.694] * (-1133.183) [-1129.697] (-1127.120) (-1137.537) -- 0:00:32
      481500 -- (-1129.395) (-1127.879) (-1127.879) [-1128.244] * [-1131.641] (-1131.276) (-1128.225) (-1127.997) -- 0:00:32
      482000 -- [-1130.027] (-1131.419) (-1129.355) (-1130.147) * (-1127.313) (-1130.370) (-1130.978) [-1129.128] -- 0:00:32
      482500 -- (-1129.762) (-1133.034) [-1129.769] (-1135.272) * (-1127.091) (-1128.417) [-1129.236] (-1129.476) -- 0:00:32
      483000 -- [-1129.199] (-1132.450) (-1127.497) (-1129.093) * (-1129.363) (-1128.594) (-1128.126) [-1128.010] -- 0:00:32
      483500 -- (-1133.361) (-1127.880) (-1134.830) [-1128.286] * (-1134.647) (-1129.116) (-1128.442) [-1132.778] -- 0:00:32
      484000 -- (-1132.704) (-1127.880) [-1129.209] (-1129.031) * (-1131.496) (-1128.610) (-1131.264) [-1128.889] -- 0:00:31
      484500 -- (-1131.383) (-1129.029) [-1128.871] (-1130.166) * (-1133.590) [-1129.515] (-1131.146) (-1129.462) -- 0:00:31
      485000 -- (-1128.344) (-1129.109) (-1133.416) [-1128.605] * (-1133.305) [-1128.976] (-1132.680) (-1129.524) -- 0:00:31

      Average standard deviation of split frequencies: 0.011337

      485500 -- [-1128.182] (-1128.440) (-1131.082) (-1127.706) * (-1128.744) [-1129.139] (-1129.271) (-1134.921) -- 0:00:31
      486000 -- (-1129.901) (-1129.693) (-1131.575) [-1128.618] * [-1128.742] (-1128.129) (-1130.708) (-1135.825) -- 0:00:32
      486500 -- (-1129.368) (-1129.445) [-1130.104] (-1128.020) * (-1134.081) [-1128.129] (-1134.892) (-1133.102) -- 0:00:32
      487000 -- [-1129.975] (-1128.529) (-1128.418) (-1128.807) * [-1129.116] (-1128.032) (-1130.612) (-1131.360) -- 0:00:32
      487500 -- (-1128.603) (-1128.595) (-1128.724) [-1130.503] * [-1131.508] (-1128.203) (-1127.251) (-1130.453) -- 0:00:32
      488000 -- [-1128.084] (-1129.168) (-1132.229) (-1130.199) * (-1132.320) (-1131.329) [-1127.182] (-1130.053) -- 0:00:32
      488500 -- (-1132.591) (-1128.096) (-1127.783) [-1129.470] * (-1129.903) (-1130.079) [-1127.674] (-1129.468) -- 0:00:32
      489000 -- (-1134.209) (-1128.072) [-1128.486] (-1128.237) * [-1128.621] (-1130.642) (-1128.340) (-1128.306) -- 0:00:32
      489500 -- (-1128.458) [-1128.729] (-1130.658) (-1131.446) * (-1127.600) [-1130.208] (-1128.029) (-1127.727) -- 0:00:32
      490000 -- (-1127.571) [-1127.761] (-1128.649) (-1131.006) * (-1130.035) (-1131.083) (-1128.883) [-1128.785] -- 0:00:32

      Average standard deviation of split frequencies: 0.011109

      490500 -- [-1127.505] (-1129.568) (-1128.493) (-1129.842) * [-1128.934] (-1130.745) (-1129.753) (-1128.387) -- 0:00:32
      491000 -- (-1128.714) (-1130.135) (-1128.573) [-1137.015] * (-1129.938) (-1132.651) [-1128.260] (-1127.509) -- 0:00:32
      491500 -- (-1128.265) [-1129.285] (-1131.227) (-1128.757) * (-1127.757) [-1127.224] (-1129.944) (-1128.466) -- 0:00:32
      492000 -- (-1127.865) (-1130.004) (-1128.372) [-1128.245] * (-1129.359) (-1128.232) (-1129.253) [-1129.100] -- 0:00:32
      492500 -- (-1131.028) (-1129.730) (-1128.697) [-1128.717] * (-1129.527) [-1130.311] (-1133.638