--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:45:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/tsf/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1128.57 -1134.40
2 -1128.55 -1133.28
--------------------------------------
TOTAL -1128.56 -1133.99
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899583 0.092207 0.383720 1.518548 0.855725 1449.94 1475.47 1.000
r(A<->C){all} 0.169499 0.021337 0.000001 0.462392 0.131912 230.62 259.79 1.001
r(A<->G){all} 0.149009 0.015366 0.000145 0.398898 0.119741 217.41 223.07 1.000
r(A<->T){all} 0.172846 0.021093 0.000075 0.460197 0.130092 115.28 187.49 1.003
r(C<->G){all} 0.175175 0.020564 0.000292 0.469295 0.138065 169.04 192.09 1.000
r(C<->T){all} 0.167918 0.020434 0.000089 0.466817 0.131144 229.30 251.70 1.001
r(G<->T){all} 0.165553 0.018606 0.000119 0.437529 0.128847 187.79 201.84 1.001
pi(A){all} 0.212833 0.000199 0.186594 0.240972 0.212438 1180.40 1261.01 1.000
pi(C){all} 0.277609 0.000238 0.246426 0.306544 0.277292 1245.79 1353.39 1.000
pi(G){all} 0.327000 0.000272 0.296205 0.360679 0.326681 1249.31 1289.82 1.000
pi(T){all} 0.182558 0.000177 0.156646 0.208003 0.181937 1302.86 1334.20 1.000
alpha{1,2} 0.435200 0.243246 0.000102 1.395722 0.257004 1300.60 1304.70 1.000
alpha{3} 0.459596 0.241624 0.000465 1.434397 0.293093 1334.32 1344.79 1.000
pinvar{all} 0.998114 0.000005 0.994027 0.999999 0.998825 968.95 1221.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1059.269873
Model 2: PositiveSelection -1059.269865
Model 0: one-ratio -1059.269872
Model 7: beta -1059.269906
Model 8: beta&w>1 -1059.269864
Model 0 vs 1 1.99999976757681E-6
Model 2 vs 1 1.5999999959603883E-5
Model 8 vs 7 8.399999978792039E-5
>C1
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C2
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C3
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C4
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C5
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C6
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=276
C1 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C2 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C3 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C4 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C5 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C6 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
**************************************************
C1 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C2 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C3 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C4 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C5 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C6 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
**************************************************
C1 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C2 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C3 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C4 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C5 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C6 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
**************************************************
C1 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C2 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C3 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C4 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C5 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C6 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
**************************************************
C1 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C2 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C3 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C4 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C5 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C6 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
**************************************************
C1 KKTVKVLLDEAGVTVTRFVRFEVGQA
C2 KKTVKVLLDEAGVTVTRFVRFEVGQA
C3 KKTVKVLLDEAGVTVTRFVRFEVGQA
C4 KKTVKVLLDEAGVTVTRFVRFEVGQA
C5 KKTVKVLLDEAGVTVTRFVRFEVGQA
C6 KKTVKVLLDEAGVTVTRFVRFEVGQA
**************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8280]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8280]--->[8280]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.500 Mb, Max= 30.833 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C2 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C3 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C4 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C5 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
C6 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
**************************************************
C1 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C2 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C3 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C4 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C5 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
C6 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
**************************************************
C1 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C2 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C3 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C4 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C5 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
C6 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
**************************************************
C1 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C2 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C3 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C4 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C5 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
C6 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
**************************************************
C1 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C2 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C3 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C4 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C5 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
C6 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
**************************************************
C1 KKTVKVLLDEAGVTVTRFVRFEVGQA
C2 KKTVKVLLDEAGVTVTRFVRFEVGQA
C3 KKTVKVLLDEAGVTVTRFVRFEVGQA
C4 KKTVKVLLDEAGVTVTRFVRFEVGQA
C5 KKTVKVLLDEAGVTVTRFVRFEVGQA
C6 KKTVKVLLDEAGVTVTRFVRFEVGQA
**************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C2 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C3 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C4 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C5 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
C6 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
**************************************************
C1 TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C2 TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C3 TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C4 TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C5 TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
C6 TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
**************************************************
C1 TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C2 TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C3 TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C4 TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C5 TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
C6 TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
**************************************************
C1 AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C2 AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C3 AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C4 AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C5 AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
C6 AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
**************************************************
C1 TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C2 TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C3 TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C4 TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C5 TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
C6 TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
**************************************************
C1 AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C2 AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C3 AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C4 AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C5 AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
C6 AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
**************************************************
C1 ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C2 ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C3 ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C4 ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C5 ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
C6 ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
**************************************************
C1 CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C2 CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C3 CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C4 CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C5 CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
C6 CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
**************************************************
C1 TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C2 TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C3 TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C4 TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C5 TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
C6 TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
**************************************************
C1 CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C2 CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C3 CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C4 CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C5 CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
C6 CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
**************************************************
C1 CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C2 CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C3 CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C4 CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C5 CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
C6 CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
**************************************************
C1 AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C2 AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C3 AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C4 AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C5 AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
C6 AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
**************************************************
C1 GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C2 GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C3 GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C4 GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C5 GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
C6 GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
**************************************************
C1 GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C2 GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C3 GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C4 GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C5 GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
C6 GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
**************************************************
C1 GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C2 GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C3 GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C4 GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C5 GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
C6 GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
**************************************************
C1 AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C2 AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C3 AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C4 AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C5 AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
C6 AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
**************************************************
C1 ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C2 ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C3 ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C4 ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C5 ATTCGTTCGGTTCGAGGTGGGCCAAGCC
C6 ATTCGTTCGGTTCGAGGTGGGCCAAGCC
****************************
>C1
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C2
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C3
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C4
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C5
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C6
ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG
TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT
TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC
AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG
TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG
AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA
ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT
CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC
TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG
CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC
CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC
AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA
GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC
GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG
GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC
AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG
ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>C1
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C2
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C3
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C4
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C5
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
>C6
MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
KKTVKVLLDEAGVTVTRFVRFEVGQA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 828 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790661
Setting output file names to "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 52805182
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0240173799
Seed = 86233230
Swapseed = 1579790661
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1853.103695 -- -24.965149
Chain 2 -- -1853.103695 -- -24.965149
Chain 3 -- -1853.103588 -- -24.965149
Chain 4 -- -1853.103413 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1853.103588 -- -24.965149
Chain 2 -- -1853.103695 -- -24.965149
Chain 3 -- -1853.103695 -- -24.965149
Chain 4 -- -1853.103588 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1853.104] (-1853.104) (-1853.104) (-1853.103) * [-1853.104] (-1853.104) (-1853.104) (-1853.104)
500 -- (-1134.273) (-1152.425) (-1138.337) [-1142.204] * [-1141.782] (-1148.460) (-1137.750) (-1157.622) -- 0:00:00
1000 -- (-1141.249) (-1153.325) (-1140.590) [-1138.727] * (-1140.771) (-1138.500) (-1146.239) [-1138.849] -- 0:16:39
1500 -- (-1137.862) (-1141.750) (-1138.966) [-1137.306] * (-1142.971) (-1135.110) (-1138.845) [-1138.462] -- 0:11:05
2000 -- (-1146.523) (-1133.496) (-1139.510) [-1133.682] * [-1145.475] (-1140.887) (-1137.199) (-1139.153) -- 0:08:19
2500 -- (-1136.957) (-1136.687) [-1138.719] (-1139.521) * (-1131.227) (-1135.787) [-1133.476] (-1139.547) -- 0:06:39
3000 -- (-1139.805) (-1137.174) [-1140.466] (-1139.481) * (-1143.280) (-1144.370) (-1133.898) [-1137.417] -- 0:05:32
3500 -- [-1138.776] (-1134.042) (-1137.636) (-1135.382) * [-1136.595] (-1140.404) (-1141.764) (-1140.476) -- 0:04:44
4000 -- [-1134.342] (-1148.283) (-1141.556) (-1144.669) * (-1133.860) (-1134.570) [-1136.118] (-1141.173) -- 0:04:09
4500 -- (-1135.777) (-1134.910) [-1133.982] (-1141.173) * (-1133.879) (-1138.479) (-1141.978) [-1133.326] -- 0:03:41
5000 -- [-1139.536] (-1138.179) (-1138.897) (-1142.260) * [-1139.510] (-1150.182) (-1135.473) (-1139.076) -- 0:03:19
Average standard deviation of split frequencies: 0.104757
5500 -- (-1145.256) (-1137.233) [-1142.297] (-1141.157) * (-1140.444) (-1137.514) [-1137.082] (-1136.671) -- 0:03:00
6000 -- (-1137.150) (-1136.786) [-1135.198] (-1141.957) * (-1133.206) [-1130.959] (-1138.373) (-1142.944) -- 0:02:45
6500 -- (-1141.285) (-1133.913) [-1133.243] (-1146.232) * (-1141.697) [-1137.594] (-1134.193) (-1142.559) -- 0:02:32
7000 -- (-1140.424) (-1138.003) (-1140.188) [-1135.975] * [-1138.441] (-1141.659) (-1143.681) (-1131.063) -- 0:02:21
7500 -- (-1133.627) (-1141.188) (-1135.710) [-1137.128] * (-1143.695) (-1137.350) [-1143.376] (-1142.063) -- 0:02:12
8000 -- (-1135.947) (-1141.191) (-1141.108) [-1139.006] * [-1141.862] (-1141.229) (-1141.592) (-1139.452) -- 0:02:04
8500 -- (-1139.656) [-1135.708] (-1145.821) (-1141.225) * [-1134.949] (-1138.334) (-1131.919) (-1135.421) -- 0:01:56
9000 -- (-1133.509) [-1138.444] (-1137.904) (-1141.307) * [-1144.188] (-1137.108) (-1141.610) (-1141.148) -- 0:01:50
9500 -- (-1140.769) (-1139.735) (-1144.533) [-1140.640] * [-1134.425] (-1138.655) (-1137.333) (-1137.479) -- 0:01:44
10000 -- (-1137.582) (-1138.219) [-1136.437] (-1142.254) * (-1137.829) (-1140.241) (-1144.407) [-1139.925] -- 0:01:39
Average standard deviation of split frequencies: 0.086179
10500 -- (-1135.065) (-1133.642) (-1142.779) [-1135.866] * (-1138.004) [-1134.782] (-1135.979) (-1144.888) -- 0:01:34
11000 -- (-1133.853) [-1141.417] (-1141.554) (-1137.559) * [-1133.306] (-1137.095) (-1140.154) (-1141.553) -- 0:01:29
11500 -- (-1144.549) (-1131.146) [-1137.913] (-1134.432) * (-1142.530) (-1136.089) (-1137.745) [-1133.208] -- 0:01:25
12000 -- (-1143.686) (-1141.384) (-1147.077) [-1135.164] * (-1140.622) (-1138.478) (-1135.575) [-1139.290] -- 0:01:22
12500 -- (-1143.747) (-1136.660) [-1131.293] (-1139.543) * [-1137.458] (-1138.013) (-1138.451) (-1137.826) -- 0:01:19
13000 -- (-1137.796) (-1137.864) (-1140.901) [-1133.919] * (-1138.673) (-1150.810) [-1138.913] (-1137.286) -- 0:01:15
13500 -- (-1134.097) (-1139.093) [-1133.791] (-1131.752) * (-1144.458) (-1130.506) (-1139.051) [-1135.214] -- 0:01:13
14000 -- [-1137.389] (-1144.746) (-1135.710) (-1140.147) * [-1140.537] (-1128.559) (-1139.494) (-1135.938) -- 0:01:10
14500 -- (-1139.830) [-1137.283] (-1134.976) (-1139.869) * [-1134.050] (-1129.734) (-1133.457) (-1139.046) -- 0:01:07
15000 -- [-1138.706] (-1142.493) (-1138.809) (-1141.112) * (-1147.558) (-1130.135) [-1135.262] (-1143.170) -- 0:01:05
Average standard deviation of split frequencies: 0.063836
15500 -- (-1135.729) (-1144.708) [-1140.397] (-1143.623) * (-1141.582) [-1130.832] (-1137.505) (-1143.493) -- 0:01:03
16000 -- (-1139.676) (-1138.088) [-1142.880] (-1137.417) * (-1136.640) (-1130.266) (-1142.372) [-1143.225] -- 0:02:03
16500 -- [-1140.460] (-1134.896) (-1137.560) (-1137.150) * [-1141.196] (-1129.628) (-1136.932) (-1143.163) -- 0:01:59
17000 -- (-1147.091) (-1138.214) [-1133.979] (-1137.558) * (-1150.814) (-1130.204) (-1139.701) [-1135.073] -- 0:01:55
17500 -- (-1142.293) (-1133.810) (-1137.623) [-1139.596] * [-1140.635] (-1129.161) (-1135.740) (-1137.606) -- 0:01:52
18000 -- [-1141.838] (-1144.488) (-1135.980) (-1138.787) * (-1135.867) (-1128.890) [-1135.214] (-1142.447) -- 0:01:49
18500 -- (-1135.816) (-1134.093) (-1139.812) [-1140.738] * (-1142.288) [-1134.504] (-1134.672) (-1132.509) -- 0:01:46
19000 -- (-1138.608) (-1140.046) (-1141.240) [-1133.737] * (-1136.087) (-1129.889) [-1138.363] (-1140.341) -- 0:01:43
19500 -- (-1135.574) [-1140.552] (-1135.879) (-1137.607) * (-1137.989) [-1128.898] (-1136.561) (-1134.170) -- 0:01:40
20000 -- [-1136.614] (-1132.859) (-1140.000) (-1136.750) * (-1139.493) [-1128.610] (-1140.328) (-1145.900) -- 0:01:38
Average standard deviation of split frequencies: 0.048661
20500 -- (-1140.366) (-1134.867) (-1135.553) [-1134.854] * [-1133.502] (-1128.093) (-1138.772) (-1137.758) -- 0:01:35
21000 -- [-1143.968] (-1133.905) (-1139.252) (-1133.797) * [-1141.971] (-1128.552) (-1147.498) (-1143.133) -- 0:01:33
21500 -- (-1137.912) (-1139.076) [-1138.171] (-1134.144) * (-1143.525) (-1127.894) [-1136.808] (-1145.022) -- 0:01:31
22000 -- (-1136.832) (-1135.788) (-1145.105) [-1135.428] * [-1134.623] (-1128.528) (-1137.181) (-1137.219) -- 0:01:28
22500 -- (-1137.752) [-1133.087] (-1140.623) (-1138.169) * (-1142.557) [-1129.707] (-1134.607) (-1146.440) -- 0:01:26
23000 -- (-1136.480) (-1143.346) (-1144.280) [-1140.129] * (-1141.962) (-1129.304) [-1135.671] (-1146.784) -- 0:01:24
23500 -- (-1137.205) (-1138.997) (-1143.999) [-1135.054] * [-1135.773] (-1129.302) (-1140.688) (-1138.205) -- 0:01:23
24000 -- (-1138.357) [-1144.907] (-1134.092) (-1135.316) * (-1134.465) (-1130.681) (-1135.015) [-1137.691] -- 0:01:21
24500 -- [-1131.711] (-1149.361) (-1138.344) (-1146.689) * [-1138.987] (-1128.182) (-1143.980) (-1138.505) -- 0:01:19
25000 -- [-1139.251] (-1137.730) (-1137.254) (-1129.560) * (-1135.496) (-1129.743) [-1138.651] (-1141.905) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-1133.654) (-1136.659) [-1134.631] (-1131.562) * [-1140.579] (-1129.722) (-1136.705) (-1144.016) -- 0:01:16
26000 -- (-1141.421) (-1133.577) [-1134.004] (-1131.594) * (-1138.588) (-1129.615) [-1139.329] (-1136.765) -- 0:01:14
26500 -- (-1137.620) (-1142.398) (-1148.994) [-1132.758] * (-1138.419) (-1130.785) (-1139.083) [-1137.483] -- 0:01:13
27000 -- (-1142.244) [-1140.911] (-1134.501) (-1132.340) * (-1142.188) [-1132.935] (-1145.665) (-1141.950) -- 0:01:12
27500 -- (-1133.020) (-1142.637) (-1144.339) [-1131.606] * (-1138.633) (-1129.372) [-1137.554] (-1142.826) -- 0:01:10
28000 -- (-1137.379) [-1141.121] (-1140.189) (-1129.698) * [-1140.264] (-1129.993) (-1139.178) (-1138.667) -- 0:01:09
28500 -- (-1133.729) [-1140.939] (-1136.393) (-1130.574) * (-1136.675) (-1128.562) [-1135.597] (-1147.176) -- 0:01:08
29000 -- (-1141.441) (-1143.355) (-1137.325) [-1131.645] * (-1141.277) [-1130.230] (-1136.674) (-1155.154) -- 0:01:06
29500 -- (-1141.471) (-1140.349) [-1134.627] (-1134.115) * (-1141.035) (-1129.011) (-1138.481) [-1128.603] -- 0:01:05
30000 -- (-1146.133) [-1141.266] (-1136.983) (-1130.637) * (-1133.529) (-1127.531) (-1142.863) [-1129.195] -- 0:01:04
Average standard deviation of split frequencies: 0.033626
30500 -- (-1137.231) (-1136.763) (-1137.034) [-1131.218] * (-1138.731) (-1127.553) [-1143.479] (-1129.262) -- 0:01:03
31000 -- (-1147.906) (-1137.362) (-1140.274) [-1132.938] * (-1134.412) (-1127.773) (-1146.169) [-1129.363] -- 0:01:33
31500 -- (-1138.520) (-1137.806) [-1140.774] (-1131.342) * [-1139.098] (-1130.348) (-1136.548) (-1127.900) -- 0:01:32
32000 -- (-1136.520) (-1135.643) [-1135.212] (-1127.659) * [-1138.246] (-1127.187) (-1135.711) (-1127.809) -- 0:01:30
32500 -- (-1134.285) (-1139.568) (-1137.698) [-1131.254] * (-1149.443) (-1128.036) [-1140.355] (-1128.518) -- 0:01:29
33000 -- [-1135.083] (-1138.406) (-1132.999) (-1129.128) * [-1135.257] (-1128.468) (-1136.331) (-1130.351) -- 0:01:27
33500 -- (-1141.009) [-1138.248] (-1141.898) (-1127.644) * (-1137.268) (-1127.782) (-1137.985) [-1128.700] -- 0:01:26
34000 -- (-1139.153) [-1140.480] (-1132.891) (-1127.444) * (-1138.398) [-1128.220] (-1144.572) (-1128.929) -- 0:01:25
34500 -- (-1140.429) [-1140.183] (-1135.081) (-1127.847) * [-1132.123] (-1128.995) (-1133.228) (-1127.535) -- 0:01:23
35000 -- (-1140.883) (-1143.259) (-1137.662) [-1131.105] * (-1136.238) (-1130.889) [-1140.790] (-1128.522) -- 0:01:22
Average standard deviation of split frequencies: 0.037216
35500 -- (-1138.504) (-1141.124) [-1133.651] (-1132.099) * (-1137.150) (-1129.595) [-1137.866] (-1127.934) -- 0:01:21
36000 -- (-1134.985) (-1149.865) (-1139.360) [-1127.879] * (-1146.789) (-1128.376) (-1138.351) [-1128.241] -- 0:01:20
36500 -- (-1142.609) (-1138.808) [-1136.798] (-1129.782) * (-1138.115) (-1128.132) [-1137.178] (-1128.933) -- 0:01:19
37000 -- (-1135.509) (-1143.432) [-1133.097] (-1130.367) * (-1138.543) [-1127.362] (-1138.811) (-1128.913) -- 0:01:18
37500 -- [-1137.634] (-1141.768) (-1138.164) (-1130.230) * (-1138.449) [-1129.744] (-1138.787) (-1130.793) -- 0:01:17
38000 -- (-1142.678) [-1141.259] (-1140.591) (-1128.018) * [-1134.636] (-1129.302) (-1143.458) (-1128.973) -- 0:01:15
38500 -- [-1140.376] (-1137.530) (-1138.426) (-1129.270) * (-1137.268) (-1131.542) [-1136.448] (-1129.653) -- 0:01:14
39000 -- (-1146.847) (-1142.354) (-1139.571) [-1127.979] * (-1138.317) (-1127.201) (-1133.640) [-1128.776] -- 0:01:13
39500 -- (-1150.540) (-1137.609) [-1138.027] (-1128.014) * [-1140.741] (-1127.939) (-1138.812) (-1128.916) -- 0:01:12
40000 -- [-1138.282] (-1135.377) (-1144.035) (-1128.120) * (-1139.824) (-1131.166) [-1139.677] (-1129.177) -- 0:01:12
Average standard deviation of split frequencies: 0.036064
40500 -- (-1141.644) (-1139.666) [-1136.627] (-1128.400) * (-1133.975) (-1132.474) (-1138.252) [-1128.201] -- 0:01:11
41000 -- [-1136.367] (-1142.448) (-1140.450) (-1128.886) * [-1141.816] (-1129.927) (-1136.207) (-1128.969) -- 0:01:10
41500 -- (-1132.422) [-1137.017] (-1135.021) (-1131.736) * (-1135.379) (-1128.527) (-1133.968) [-1131.280] -- 0:01:09
42000 -- (-1140.354) (-1138.602) (-1133.508) [-1129.227] * (-1138.709) (-1128.893) (-1151.622) [-1128.030] -- 0:01:08
42500 -- [-1134.946] (-1130.753) (-1138.634) (-1128.634) * (-1137.168) (-1129.074) (-1133.241) [-1127.988] -- 0:01:07
43000 -- (-1140.354) (-1140.664) [-1134.281] (-1129.470) * (-1143.219) (-1131.239) [-1140.585] (-1134.349) -- 0:01:06
43500 -- [-1145.382] (-1142.490) (-1135.660) (-1130.607) * (-1137.837) [-1129.924] (-1137.664) (-1134.234) -- 0:01:05
44000 -- (-1134.714) (-1139.853) [-1140.651] (-1130.196) * (-1139.436) (-1130.075) [-1137.705] (-1129.992) -- 0:01:05
44500 -- [-1135.193] (-1136.772) (-1148.083) (-1130.572) * (-1140.037) (-1132.347) [-1137.925] (-1133.539) -- 0:01:04
45000 -- (-1136.701) [-1141.883] (-1152.448) (-1130.711) * [-1139.837] (-1131.453) (-1145.828) (-1128.785) -- 0:01:03
Average standard deviation of split frequencies: 0.027669
45500 -- (-1137.349) [-1137.273] (-1140.322) (-1129.487) * (-1145.331) (-1133.050) [-1131.650] (-1135.668) -- 0:01:02
46000 -- (-1136.019) (-1140.655) [-1133.667] (-1129.272) * (-1134.284) [-1132.217] (-1137.642) (-1129.376) -- 0:01:02
46500 -- (-1135.078) [-1133.816] (-1140.057) (-1127.064) * [-1138.129] (-1129.849) (-1138.513) (-1129.527) -- 0:01:22
47000 -- (-1135.587) [-1134.872] (-1140.749) (-1129.782) * (-1138.087) (-1131.155) [-1136.748] (-1129.389) -- 0:01:21
47500 -- [-1133.988] (-1137.393) (-1144.835) (-1127.573) * (-1141.480) (-1133.094) [-1139.630] (-1130.643) -- 0:01:20
48000 -- [-1145.093] (-1135.041) (-1145.819) (-1128.071) * (-1136.848) (-1131.604) (-1136.717) [-1129.038] -- 0:01:19
48500 -- (-1138.522) (-1143.221) (-1139.421) [-1130.762] * (-1136.984) (-1130.898) [-1134.324] (-1130.755) -- 0:01:18
49000 -- (-1137.254) (-1136.359) (-1138.571) [-1129.051] * (-1139.517) (-1129.102) [-1135.013] (-1132.557) -- 0:01:17
49500 -- [-1137.457] (-1145.723) (-1137.747) (-1128.023) * (-1138.937) [-1128.121] (-1138.170) (-1137.587) -- 0:01:16
50000 -- (-1142.570) (-1133.673) [-1135.064] (-1128.493) * (-1143.111) (-1127.388) (-1135.497) [-1130.834] -- 0:01:16
Average standard deviation of split frequencies: 0.028891
50500 -- (-1151.577) (-1138.214) [-1130.442] (-1129.071) * (-1138.828) [-1127.871] (-1140.980) (-1130.886) -- 0:01:15
51000 -- (-1137.907) (-1136.309) [-1134.626] (-1128.209) * (-1140.051) (-1130.542) [-1139.300] (-1130.453) -- 0:01:14
51500 -- (-1138.335) [-1137.415] (-1136.343) (-1129.452) * [-1138.208] (-1129.255) (-1135.543) (-1130.077) -- 0:01:13
52000 -- [-1141.509] (-1134.866) (-1139.776) (-1128.285) * (-1138.344) (-1127.779) (-1142.841) [-1130.426] -- 0:01:12
52500 -- (-1139.238) (-1135.744) [-1136.763] (-1131.553) * (-1140.129) (-1132.454) [-1135.122] (-1128.907) -- 0:01:12
53000 -- (-1141.900) (-1142.182) [-1136.562] (-1132.036) * (-1133.146) (-1130.308) (-1133.693) [-1128.110] -- 0:01:11
53500 -- (-1141.349) (-1134.227) (-1142.429) [-1129.636] * (-1147.627) (-1129.197) (-1134.839) [-1127.854] -- 0:01:10
54000 -- [-1132.327] (-1139.023) (-1142.027) (-1134.829) * [-1139.851] (-1128.722) (-1136.715) (-1131.604) -- 0:01:10
54500 -- (-1141.411) [-1135.698] (-1137.833) (-1129.765) * (-1131.802) [-1132.587] (-1148.818) (-1134.656) -- 0:01:09
55000 -- (-1136.222) (-1140.389) [-1132.046] (-1128.587) * (-1136.267) [-1129.020] (-1138.417) (-1129.707) -- 0:01:08
Average standard deviation of split frequencies: 0.031333
55500 -- (-1150.607) [-1132.890] (-1142.710) (-1130.928) * (-1138.086) [-1131.041] (-1137.855) (-1129.065) -- 0:01:08
56000 -- [-1146.058] (-1136.169) (-1138.175) (-1132.487) * (-1144.270) (-1130.543) [-1138.533] (-1130.571) -- 0:01:07
56500 -- (-1136.970) [-1142.059] (-1138.802) (-1136.506) * (-1137.095) (-1128.574) [-1141.874] (-1133.670) -- 0:01:06
57000 -- (-1141.237) [-1133.156] (-1139.748) (-1137.926) * (-1147.330) (-1133.391) [-1133.990] (-1134.827) -- 0:01:06
57500 -- (-1144.846) [-1140.865] (-1134.508) (-1131.998) * (-1135.493) (-1128.730) [-1137.254] (-1126.977) -- 0:01:05
58000 -- (-1138.393) (-1135.729) (-1135.157) [-1128.617] * (-1141.662) [-1128.154] (-1138.541) (-1126.984) -- 0:01:04
58500 -- (-1138.467) (-1149.394) [-1140.437] (-1127.277) * (-1147.411) (-1128.410) (-1137.052) [-1127.069] -- 0:01:04
59000 -- (-1136.575) (-1131.951) (-1133.353) [-1128.980] * [-1132.102] (-1128.227) (-1135.237) (-1131.588) -- 0:01:03
59500 -- (-1139.711) (-1129.463) (-1144.824) [-1128.183] * [-1137.730] (-1128.096) (-1133.299) (-1130.335) -- 0:01:03
60000 -- (-1133.690) (-1131.675) (-1137.461) [-1128.308] * [-1135.977] (-1128.196) (-1146.052) (-1131.265) -- 0:01:02
Average standard deviation of split frequencies: 0.027196
60500 -- (-1141.013) [-1131.439] (-1143.536) (-1128.307) * (-1135.055) (-1129.248) [-1138.078] (-1130.260) -- 0:01:02
61000 -- (-1137.457) (-1131.435) (-1138.895) [-1129.838] * [-1135.746] (-1128.759) (-1139.246) (-1129.868) -- 0:01:01
61500 -- [-1139.941] (-1129.632) (-1137.281) (-1131.262) * (-1146.869) [-1127.067] (-1136.054) (-1128.595) -- 0:01:01
62000 -- [-1138.334] (-1131.854) (-1141.725) (-1129.509) * [-1134.937] (-1129.743) (-1138.379) (-1128.624) -- 0:01:00
62500 -- (-1134.181) [-1129.873] (-1135.360) (-1127.755) * [-1144.873] (-1131.360) (-1134.621) (-1127.455) -- 0:01:15
63000 -- (-1143.836) [-1129.905] (-1137.211) (-1128.270) * (-1138.135) (-1129.281) [-1135.629] (-1131.454) -- 0:01:14
63500 -- (-1131.695) [-1131.203] (-1144.551) (-1129.084) * (-1141.236) (-1128.013) (-1134.943) [-1128.189] -- 0:01:13
64000 -- (-1135.272) [-1129.520] (-1137.716) (-1128.529) * (-1137.112) [-1127.215] (-1140.153) (-1128.359) -- 0:01:13
64500 -- (-1135.219) (-1130.049) [-1138.923] (-1128.013) * [-1137.052] (-1130.369) (-1141.768) (-1130.428) -- 0:01:12
65000 -- [-1136.983] (-1131.468) (-1141.155) (-1129.119) * [-1144.070] (-1129.043) (-1137.769) (-1131.721) -- 0:01:11
Average standard deviation of split frequencies: 0.022499
65500 -- (-1142.066) [-1128.123] (-1143.492) (-1128.279) * (-1142.050) (-1127.823) (-1140.466) [-1131.686] -- 0:01:11
66000 -- [-1139.123] (-1129.571) (-1137.631) (-1128.096) * (-1143.148) (-1128.985) [-1136.094] (-1130.330) -- 0:01:10
66500 -- (-1138.821) [-1134.278] (-1136.448) (-1130.221) * (-1135.036) (-1128.292) (-1139.276) [-1129.370] -- 0:01:10
67000 -- [-1137.942] (-1127.650) (-1135.088) (-1131.745) * [-1138.975] (-1127.870) (-1141.084) (-1129.107) -- 0:01:09
67500 -- (-1138.932) (-1130.903) (-1145.036) [-1133.043] * (-1140.037) (-1127.419) [-1140.900] (-1129.066) -- 0:01:09
68000 -- (-1138.381) (-1128.776) [-1133.752] (-1134.328) * [-1137.096] (-1127.705) (-1141.101) (-1133.173) -- 0:01:08
68500 -- (-1136.444) (-1129.983) [-1134.817] (-1131.132) * (-1135.126) (-1127.704) (-1141.225) [-1136.587] -- 0:01:07
69000 -- (-1143.670) [-1127.744] (-1136.339) (-1130.302) * (-1138.477) [-1126.994] (-1137.491) (-1134.351) -- 0:01:07
69500 -- (-1129.881) [-1129.304] (-1133.602) (-1129.426) * (-1146.490) (-1127.388) (-1149.849) [-1130.448] -- 0:01:06
70000 -- (-1133.529) (-1128.305) (-1140.812) [-1130.419] * (-1130.920) (-1127.619) (-1150.594) [-1128.548] -- 0:01:06
Average standard deviation of split frequencies: 0.022470
70500 -- [-1133.356] (-1129.178) (-1137.138) (-1129.791) * (-1137.170) (-1128.277) (-1134.154) [-1129.783] -- 0:01:05
71000 -- (-1134.026) (-1129.442) [-1136.607] (-1127.426) * [-1138.391] (-1128.518) (-1134.220) (-1128.896) -- 0:01:05
71500 -- (-1129.561) (-1130.102) [-1137.139] (-1130.648) * (-1139.483) (-1128.522) (-1139.268) [-1129.444] -- 0:01:04
72000 -- [-1131.217] (-1130.994) (-1130.800) (-1132.013) * (-1139.722) (-1127.742) (-1133.589) [-1129.313] -- 0:01:04
72500 -- (-1132.286) [-1128.258] (-1133.280) (-1129.223) * (-1140.128) (-1127.883) [-1131.548] (-1127.985) -- 0:01:03
73000 -- (-1132.082) (-1128.770) [-1131.421] (-1127.313) * (-1134.037) (-1127.624) (-1128.980) [-1128.541] -- 0:01:03
73500 -- [-1131.449] (-1130.426) (-1129.206) (-1127.335) * (-1139.510) (-1128.471) [-1127.839] (-1128.724) -- 0:01:03
74000 -- [-1128.821] (-1132.526) (-1128.797) (-1127.335) * (-1136.083) (-1128.984) [-1127.794] (-1127.543) -- 0:01:02
74500 -- [-1128.302] (-1133.021) (-1129.775) (-1128.537) * (-1135.147) [-1127.815] (-1130.122) (-1131.367) -- 0:01:02
75000 -- [-1128.394] (-1129.719) (-1129.904) (-1128.529) * (-1137.149) (-1127.213) (-1128.419) [-1127.367] -- 0:01:01
Average standard deviation of split frequencies: 0.019914
75500 -- (-1127.873) [-1128.923] (-1129.500) (-1129.213) * (-1137.643) (-1130.139) [-1131.551] (-1129.124) -- 0:01:01
76000 -- [-1128.492] (-1130.614) (-1129.815) (-1128.084) * (-1144.509) (-1129.783) (-1128.738) [-1128.672] -- 0:01:00
76500 -- (-1133.189) (-1136.554) [-1132.180] (-1127.942) * (-1137.309) (-1130.937) [-1129.801] (-1127.905) -- 0:01:00
77000 -- (-1131.714) (-1130.520) (-1128.875) [-1128.374] * (-1150.033) [-1127.565] (-1129.732) (-1128.761) -- 0:00:59
77500 -- (-1130.507) [-1130.231] (-1128.845) (-1128.274) * (-1140.513) [-1128.568] (-1130.004) (-1128.802) -- 0:00:59
78000 -- (-1130.567) (-1130.056) [-1128.858] (-1128.044) * (-1145.487) [-1131.608] (-1131.519) (-1127.989) -- 0:00:59
78500 -- (-1127.769) (-1130.457) (-1127.666) [-1129.653] * [-1135.330] (-1131.525) (-1128.073) (-1130.413) -- 0:00:58
79000 -- (-1130.040) (-1130.206) [-1127.231] (-1127.254) * [-1134.269] (-1128.719) (-1131.954) (-1128.739) -- 0:01:09
79500 -- (-1127.672) (-1131.241) [-1127.996] (-1127.560) * (-1144.375) (-1135.996) [-1129.515] (-1128.412) -- 0:01:09
80000 -- (-1132.784) (-1129.578) (-1131.910) [-1127.587] * [-1136.221] (-1141.927) (-1128.234) (-1128.111) -- 0:01:09
Average standard deviation of split frequencies: 0.023765
80500 -- (-1132.337) (-1131.429) [-1128.278] (-1131.299) * (-1140.717) [-1130.904] (-1128.351) (-1131.717) -- 0:01:08
81000 -- (-1134.899) (-1130.595) (-1128.315) [-1128.156] * (-1140.638) (-1127.861) (-1134.207) [-1132.429] -- 0:01:08
81500 -- (-1131.870) [-1128.796] (-1130.230) (-1129.704) * [-1133.994] (-1131.415) (-1127.750) (-1128.603) -- 0:01:07
82000 -- (-1127.739) [-1127.459] (-1128.472) (-1129.704) * (-1137.939) (-1129.630) [-1129.126] (-1128.422) -- 0:01:07
82500 -- [-1128.353] (-1127.826) (-1128.875) (-1128.240) * (-1135.804) (-1128.091) (-1129.032) [-1128.883] -- 0:01:06
83000 -- (-1127.995) [-1130.334] (-1130.509) (-1128.452) * (-1141.583) (-1129.221) (-1128.699) [-1127.992] -- 0:01:06
83500 -- [-1127.256] (-1129.638) (-1127.761) (-1129.296) * [-1138.330] (-1129.042) (-1128.731) (-1135.478) -- 0:01:05
84000 -- [-1127.623] (-1132.738) (-1127.746) (-1127.765) * (-1139.245) [-1128.487] (-1131.176) (-1134.265) -- 0:01:05
84500 -- (-1127.604) (-1130.069) (-1128.338) [-1129.090] * (-1136.739) (-1128.740) [-1128.621] (-1132.221) -- 0:01:05
85000 -- (-1127.312) [-1129.873] (-1130.940) (-1129.804) * (-1137.701) [-1128.329] (-1129.175) (-1129.332) -- 0:01:04
Average standard deviation of split frequencies: 0.022709
85500 -- [-1131.026] (-1136.498) (-1130.970) (-1129.840) * (-1135.204) (-1129.126) [-1132.351] (-1128.722) -- 0:01:04
86000 -- (-1129.979) (-1132.758) [-1128.720] (-1128.758) * (-1139.816) (-1130.053) (-1131.355) [-1128.829] -- 0:01:03
86500 -- (-1127.738) (-1130.651) (-1129.507) [-1128.336] * (-1145.940) (-1127.887) (-1128.250) [-1128.568] -- 0:01:03
87000 -- (-1128.416) (-1128.985) (-1128.264) [-1128.127] * (-1139.942) [-1133.903] (-1128.722) (-1128.865) -- 0:01:02
87500 -- (-1129.732) (-1127.902) (-1130.264) [-1129.243] * [-1137.892] (-1133.124) (-1128.336) (-1131.164) -- 0:01:02
88000 -- (-1128.973) (-1129.025) (-1131.695) [-1130.738] * (-1133.254) [-1129.791] (-1129.272) (-1129.043) -- 0:01:02
88500 -- (-1130.318) (-1129.106) (-1129.028) [-1134.076] * (-1143.797) (-1133.186) [-1129.271] (-1128.515) -- 0:01:01
89000 -- (-1129.663) (-1128.759) (-1129.234) [-1130.235] * (-1140.585) (-1129.390) [-1133.312] (-1128.532) -- 0:01:01
89500 -- (-1129.574) [-1134.018] (-1129.651) (-1129.488) * (-1134.609) (-1135.889) (-1130.026) [-1129.740] -- 0:01:01
90000 -- (-1129.663) [-1129.921] (-1129.623) (-1129.319) * (-1159.198) (-1129.147) (-1130.477) [-1131.357] -- 0:01:00
Average standard deviation of split frequencies: 0.026302
90500 -- (-1131.431) (-1131.062) (-1129.410) [-1131.602] * (-1140.203) [-1129.661] (-1129.702) (-1136.116) -- 0:01:00
91000 -- (-1129.342) [-1132.715] (-1127.721) (-1130.978) * (-1144.588) (-1130.107) [-1130.088] (-1128.020) -- 0:00:59
91500 -- (-1129.826) (-1132.201) (-1129.317) [-1128.316] * [-1132.588] (-1129.571) (-1129.396) (-1128.976) -- 0:00:59
92000 -- (-1133.277) [-1128.007] (-1131.884) (-1129.246) * (-1129.043) (-1127.810) (-1129.833) [-1128.068] -- 0:00:59
92500 -- (-1134.518) (-1127.785) (-1127.445) [-1131.250] * (-1129.030) (-1127.516) (-1130.488) [-1130.532] -- 0:00:58
93000 -- (-1127.505) [-1128.377] (-1128.391) (-1130.699) * [-1129.333] (-1128.614) (-1128.262) (-1128.755) -- 0:00:58
93500 -- [-1128.313] (-1129.531) (-1128.600) (-1133.499) * (-1127.720) (-1127.631) (-1128.383) [-1128.771] -- 0:00:58
94000 -- (-1131.283) [-1130.402] (-1131.692) (-1130.565) * (-1133.935) (-1128.972) (-1127.342) [-1129.837] -- 0:00:57
94500 -- [-1135.688] (-1129.360) (-1128.314) (-1140.057) * [-1130.084] (-1129.060) (-1127.870) (-1128.526) -- 0:00:57
95000 -- (-1131.113) (-1130.995) [-1127.170] (-1138.683) * [-1129.755] (-1128.408) (-1127.710) (-1135.349) -- 0:01:06
Average standard deviation of split frequencies: 0.020733
95500 -- [-1128.282] (-1133.440) (-1128.212) (-1134.706) * (-1131.654) (-1128.193) (-1127.774) [-1131.740] -- 0:01:06
96000 -- (-1130.094) [-1131.311] (-1127.406) (-1130.328) * (-1128.708) (-1127.908) (-1138.009) [-1127.896] -- 0:01:05
96500 -- (-1129.086) (-1132.051) [-1127.420] (-1130.330) * (-1130.282) (-1127.207) (-1133.017) [-1128.179] -- 0:01:05
97000 -- [-1129.667] (-1128.674) (-1131.623) (-1131.623) * [-1127.937] (-1128.786) (-1132.796) (-1128.727) -- 0:01:05
97500 -- (-1133.412) (-1129.063) [-1132.565] (-1133.522) * (-1127.938) [-1131.796] (-1129.690) (-1127.909) -- 0:01:04
98000 -- (-1129.978) [-1128.370] (-1128.235) (-1129.860) * (-1130.464) (-1135.108) [-1129.643] (-1129.135) -- 0:01:04
98500 -- [-1128.494] (-1129.561) (-1129.492) (-1130.014) * [-1126.864] (-1134.812) (-1130.645) (-1129.005) -- 0:01:04
99000 -- (-1129.758) (-1131.054) (-1127.539) [-1130.563] * (-1127.170) (-1128.837) [-1128.075] (-1130.354) -- 0:01:03
99500 -- (-1129.188) (-1127.834) [-1130.099] (-1133.814) * (-1127.064) [-1128.731] (-1129.104) (-1129.681) -- 0:01:03
100000 -- [-1129.904] (-1127.732) (-1127.700) (-1130.266) * (-1129.481) (-1128.437) [-1128.908] (-1128.554) -- 0:01:02
Average standard deviation of split frequencies: 0.020195
100500 -- [-1130.578] (-1129.374) (-1132.953) (-1127.757) * [-1127.299] (-1129.037) (-1128.264) (-1128.274) -- 0:01:02
101000 -- (-1129.720) [-1127.844] (-1128.567) (-1127.858) * (-1127.231) [-1129.186] (-1128.498) (-1128.296) -- 0:01:02
101500 -- (-1127.074) [-1128.360] (-1129.535) (-1130.162) * [-1127.446] (-1128.655) (-1132.270) (-1130.830) -- 0:01:01
102000 -- (-1127.683) (-1128.513) (-1127.876) [-1127.920] * [-1132.692] (-1127.320) (-1128.450) (-1129.688) -- 0:01:01
102500 -- (-1127.904) (-1128.406) [-1127.775] (-1127.850) * (-1132.457) (-1128.396) [-1130.139] (-1129.210) -- 0:01:01
103000 -- (-1127.674) (-1130.663) [-1128.003] (-1129.954) * (-1128.740) (-1130.145) (-1127.522) [-1128.660] -- 0:01:00
103500 -- (-1128.363) [-1129.229] (-1127.370) (-1129.319) * (-1128.510) (-1131.060) [-1127.566] (-1132.280) -- 0:01:00
104000 -- (-1130.367) (-1129.750) (-1127.485) [-1128.336] * (-1129.782) (-1130.917) (-1127.945) [-1128.889] -- 0:01:00
104500 -- [-1127.714] (-1128.921) (-1127.327) (-1132.618) * (-1128.176) (-1130.412) (-1129.992) [-1130.543] -- 0:00:59
105000 -- [-1129.451] (-1128.361) (-1132.278) (-1131.996) * (-1131.514) (-1129.754) (-1127.416) [-1129.608] -- 0:00:59
Average standard deviation of split frequencies: 0.020457
105500 -- (-1128.130) [-1130.044] (-1129.393) (-1128.670) * [-1127.901] (-1128.524) (-1128.251) (-1130.005) -- 0:00:59
106000 -- (-1127.971) (-1129.747) (-1130.841) [-1132.636] * [-1127.994] (-1128.190) (-1128.257) (-1129.586) -- 0:00:59
106500 -- [-1133.015] (-1130.724) (-1128.239) (-1132.053) * [-1130.985] (-1130.006) (-1128.615) (-1134.333) -- 0:00:58
107000 -- (-1129.582) (-1130.875) (-1128.324) [-1129.887] * (-1128.167) [-1128.756] (-1127.606) (-1133.847) -- 0:00:58
107500 -- (-1129.776) [-1129.348] (-1128.427) (-1129.664) * (-1129.023) (-1130.171) [-1130.247] (-1133.063) -- 0:00:58
108000 -- [-1127.566] (-1129.147) (-1128.115) (-1129.392) * (-1131.063) [-1128.202] (-1129.871) (-1132.461) -- 0:00:57
108500 -- (-1127.691) (-1127.469) (-1136.034) [-1127.640] * [-1130.839] (-1127.752) (-1127.088) (-1130.910) -- 0:00:57
109000 -- (-1127.350) (-1128.393) [-1128.258] (-1127.646) * (-1135.616) (-1129.206) [-1129.005] (-1130.998) -- 0:00:57
109500 -- [-1131.171] (-1127.565) (-1129.448) (-1127.923) * (-1135.065) (-1127.749) [-1127.599] (-1129.834) -- 0:00:56
110000 -- (-1129.985) (-1127.667) [-1132.022] (-1128.550) * (-1128.799) (-1127.520) [-1129.565] (-1130.006) -- 0:00:56
Average standard deviation of split frequencies: 0.023765
110500 -- (-1130.085) [-1131.269] (-1129.824) (-1131.046) * [-1128.894] (-1127.497) (-1128.394) (-1129.717) -- 0:00:56
111000 -- (-1128.128) (-1127.537) (-1131.296) [-1128.947] * (-1128.396) (-1131.157) (-1128.355) [-1130.833] -- 0:01:04
111500 -- (-1128.199) [-1127.749] (-1129.540) (-1128.198) * (-1128.775) [-1129.675] (-1133.076) (-1131.428) -- 0:01:03
112000 -- (-1127.873) (-1127.313) [-1132.002] (-1128.916) * (-1127.353) (-1131.052) [-1129.071] (-1133.593) -- 0:01:03
112500 -- (-1128.087) (-1128.125) [-1128.611] (-1133.339) * (-1128.865) (-1130.945) (-1135.502) [-1130.931] -- 0:01:03
113000 -- (-1127.768) (-1127.417) [-1130.025] (-1130.579) * [-1128.380] (-1129.825) (-1130.798) (-1130.096) -- 0:01:02
113500 -- (-1128.534) (-1127.203) [-1128.472] (-1132.370) * (-1129.023) (-1132.436) [-1130.636] (-1131.947) -- 0:01:02
114000 -- [-1127.919] (-1127.026) (-1130.264) (-1128.469) * (-1133.179) (-1132.426) [-1130.151] (-1130.688) -- 0:01:02
114500 -- (-1127.614) [-1128.980] (-1131.230) (-1128.365) * (-1134.729) (-1133.821) [-1130.556] (-1131.176) -- 0:01:01
115000 -- [-1128.661] (-1130.543) (-1128.309) (-1129.084) * (-1132.671) (-1135.820) (-1129.289) [-1132.760] -- 0:01:01
Average standard deviation of split frequencies: 0.020558
115500 -- (-1127.331) (-1132.981) [-1129.518] (-1130.002) * (-1129.359) [-1129.568] (-1129.265) (-1127.992) -- 0:01:01
116000 -- (-1131.457) (-1129.540) [-1128.089] (-1130.065) * (-1129.733) [-1131.293] (-1130.880) (-1129.967) -- 0:01:00
116500 -- (-1137.289) (-1129.260) (-1127.656) [-1129.516] * (-1129.855) (-1128.958) (-1132.808) [-1133.312] -- 0:01:00
117000 -- [-1128.930] (-1131.858) (-1129.318) (-1129.727) * (-1133.521) (-1130.273) (-1130.305) [-1131.270] -- 0:01:00
117500 -- [-1133.057] (-1130.217) (-1130.646) (-1130.308) * [-1128.396] (-1129.035) (-1128.426) (-1138.459) -- 0:01:00
118000 -- (-1135.172) (-1130.147) [-1131.369] (-1131.053) * (-1130.454) (-1129.733) [-1129.683] (-1131.299) -- 0:00:59
118500 -- (-1129.340) [-1130.449] (-1130.347) (-1129.412) * (-1127.099) [-1130.759] (-1131.414) (-1134.165) -- 0:00:59
119000 -- (-1131.056) (-1129.538) (-1130.148) [-1130.395] * [-1127.896] (-1128.676) (-1131.613) (-1132.550) -- 0:00:59
119500 -- (-1128.967) (-1129.754) (-1130.457) [-1128.879] * (-1128.015) [-1130.666] (-1128.569) (-1129.301) -- 0:00:58
120000 -- (-1128.111) [-1131.935] (-1128.136) (-1136.474) * (-1129.598) [-1130.037] (-1131.525) (-1134.419) -- 0:00:58
Average standard deviation of split frequencies: 0.023440
120500 -- (-1127.559) (-1128.625) [-1129.031] (-1131.065) * (-1129.502) (-1131.581) (-1129.261) [-1129.555] -- 0:00:58
121000 -- [-1128.887] (-1131.403) (-1133.812) (-1129.035) * (-1127.628) (-1130.355) [-1129.657] (-1130.228) -- 0:00:58
121500 -- [-1128.769] (-1132.032) (-1133.812) (-1128.581) * (-1131.405) (-1129.725) (-1129.236) [-1135.194] -- 0:00:57
122000 -- (-1128.731) (-1128.325) (-1128.740) [-1129.197] * (-1132.048) (-1129.189) (-1129.781) [-1132.811] -- 0:00:57
122500 -- [-1129.235] (-1129.399) (-1128.463) (-1130.593) * (-1131.799) (-1128.590) [-1129.587] (-1129.051) -- 0:00:57
123000 -- (-1130.350) (-1131.638) (-1128.988) [-1127.512] * (-1128.262) (-1128.411) (-1128.216) [-1129.322] -- 0:00:57
123500 -- (-1131.269) (-1137.237) [-1129.136] (-1131.441) * (-1128.706) (-1128.497) [-1128.785] (-1129.093) -- 0:00:56
124000 -- [-1130.086] (-1127.763) (-1128.499) (-1129.203) * (-1128.503) [-1127.900] (-1131.074) (-1128.779) -- 0:00:56
124500 -- (-1128.055) (-1128.139) (-1128.945) [-1129.636] * (-1127.793) (-1128.315) [-1130.226] (-1129.755) -- 0:00:56
125000 -- (-1128.082) (-1130.411) (-1127.813) [-1130.132] * [-1128.227] (-1127.583) (-1130.538) (-1128.045) -- 0:00:56
Average standard deviation of split frequencies: 0.021788
125500 -- (-1129.451) (-1129.600) (-1127.752) [-1130.227] * (-1128.586) (-1133.057) (-1128.716) [-1129.456] -- 0:00:55
126000 -- [-1129.263] (-1130.764) (-1128.549) (-1130.362) * (-1129.738) (-1131.136) [-1128.299] (-1128.697) -- 0:00:55
126500 -- (-1127.547) (-1129.037) (-1130.656) [-1129.544] * [-1129.575] (-1132.636) (-1127.871) (-1129.046) -- 0:00:55
127000 -- (-1128.306) (-1128.565) (-1129.256) [-1131.639] * [-1129.788] (-1129.898) (-1129.591) (-1129.163) -- 0:00:54
127500 -- (-1128.148) (-1131.392) [-1131.310] (-1131.917) * (-1129.234) (-1131.470) (-1129.631) [-1129.039] -- 0:01:01
128000 -- (-1128.129) (-1129.919) [-1131.696] (-1129.883) * (-1127.187) (-1132.742) [-1130.431] (-1128.049) -- 0:01:01
128500 -- (-1130.810) (-1128.121) [-1130.143] (-1126.990) * (-1129.681) (-1132.169) [-1129.523] (-1129.625) -- 0:01:01
129000 -- [-1129.646] (-1127.175) (-1131.922) (-1128.096) * (-1129.068) (-1129.867) (-1129.002) [-1131.120] -- 0:01:00
129500 -- (-1129.431) (-1129.887) [-1128.319] (-1127.326) * [-1130.355] (-1130.600) (-1129.829) (-1131.859) -- 0:01:00
130000 -- (-1129.041) (-1130.915) [-1128.102] (-1128.832) * (-1128.838) (-1130.260) (-1130.370) [-1127.904] -- 0:01:00
Average standard deviation of split frequencies: 0.023344
130500 -- (-1128.645) (-1130.438) [-1132.073] (-1130.641) * (-1129.942) (-1128.472) [-1131.015] (-1129.843) -- 0:00:59
131000 -- [-1130.497] (-1131.652) (-1128.703) (-1129.889) * (-1127.721) (-1128.573) (-1132.283) [-1128.395] -- 0:00:59
131500 -- [-1132.633] (-1130.322) (-1127.450) (-1128.636) * (-1131.203) (-1127.821) [-1129.303] (-1128.187) -- 0:00:59
132000 -- (-1132.301) [-1129.787] (-1129.228) (-1127.226) * (-1130.863) (-1127.749) [-1129.766] (-1128.198) -- 0:00:59
132500 -- (-1132.793) (-1135.119) [-1128.233] (-1130.416) * [-1135.295] (-1128.171) (-1129.700) (-1128.940) -- 0:00:58
133000 -- (-1131.347) (-1133.098) (-1128.398) [-1130.019] * (-1128.394) (-1128.578) (-1128.173) [-1129.191] -- 0:00:58
133500 -- (-1128.733) (-1130.340) (-1129.309) [-1128.297] * [-1127.909] (-1127.697) (-1128.678) (-1130.965) -- 0:00:58
134000 -- [-1127.868] (-1129.639) (-1128.923) (-1131.770) * [-1128.224] (-1127.352) (-1130.350) (-1132.353) -- 0:00:58
134500 -- (-1129.237) (-1129.788) (-1130.594) [-1128.470] * (-1129.416) (-1128.491) [-1128.430] (-1131.061) -- 0:00:57
135000 -- [-1131.738] (-1129.765) (-1134.958) (-1131.415) * (-1128.819) [-1131.680] (-1127.589) (-1130.755) -- 0:00:57
Average standard deviation of split frequencies: 0.021014
135500 -- (-1130.895) [-1128.375] (-1132.943) (-1130.085) * [-1129.860] (-1130.429) (-1132.540) (-1131.182) -- 0:00:57
136000 -- (-1128.558) (-1133.852) (-1130.604) [-1127.316] * (-1130.148) (-1128.627) [-1129.004] (-1129.798) -- 0:00:57
136500 -- [-1129.842] (-1129.255) (-1130.725) (-1127.908) * [-1130.290] (-1128.701) (-1127.077) (-1130.367) -- 0:00:56
137000 -- (-1129.415) [-1128.383] (-1129.789) (-1127.968) * (-1129.622) [-1129.395] (-1129.987) (-1137.272) -- 0:00:56
137500 -- (-1128.579) (-1132.033) (-1128.951) [-1127.944] * (-1131.280) [-1128.295] (-1127.164) (-1128.924) -- 0:00:56
138000 -- [-1129.407] (-1127.948) (-1128.040) (-1127.384) * (-1128.173) (-1128.285) (-1131.116) [-1128.835] -- 0:00:56
138500 -- (-1129.454) (-1129.078) [-1129.969] (-1132.215) * (-1129.344) [-1130.687] (-1127.474) (-1130.149) -- 0:00:55
139000 -- (-1127.850) [-1127.288] (-1128.819) (-1133.070) * (-1129.175) (-1128.307) [-1128.482] (-1131.632) -- 0:00:55
139500 -- [-1130.119] (-1127.959) (-1128.462) (-1129.165) * [-1129.611] (-1128.922) (-1129.421) (-1131.102) -- 0:00:55
140000 -- (-1127.956) (-1129.039) (-1127.834) [-1129.173] * (-1130.621) (-1128.419) (-1128.970) [-1130.224] -- 0:00:55
Average standard deviation of split frequencies: 0.021155
140500 -- (-1134.611) [-1128.117] (-1127.848) (-1128.199) * (-1129.125) [-1130.149] (-1128.323) (-1129.980) -- 0:00:55
141000 -- (-1130.139) (-1129.619) (-1132.826) [-1127.348] * [-1130.948] (-1129.362) (-1127.413) (-1130.570) -- 0:00:54
141500 -- (-1128.651) (-1129.766) (-1133.829) [-1129.089] * (-1132.350) (-1130.560) [-1127.600] (-1129.195) -- 0:00:54
142000 -- (-1127.354) (-1129.432) (-1131.796) [-1130.449] * (-1130.179) [-1129.316] (-1127.450) (-1131.933) -- 0:00:54
142500 -- (-1132.824) [-1129.209] (-1131.249) (-1128.136) * (-1127.330) (-1128.798) [-1128.242] (-1129.253) -- 0:00:54
143000 -- [-1129.267] (-1127.898) (-1130.633) (-1128.141) * (-1128.467) (-1127.399) [-1126.957] (-1129.270) -- 0:00:53
143500 -- (-1130.528) (-1127.898) [-1130.961] (-1129.592) * (-1128.712) [-1129.680] (-1131.911) (-1127.817) -- 0:00:53
144000 -- (-1129.549) (-1127.788) [-1128.627] (-1127.027) * (-1128.483) [-1129.329] (-1132.541) (-1127.962) -- 0:00:59
144500 -- (-1129.783) (-1127.915) [-1127.728] (-1128.746) * (-1132.464) (-1128.855) [-1130.983] (-1127.417) -- 0:00:59
145000 -- [-1130.996] (-1129.071) (-1131.098) (-1130.253) * (-1129.334) (-1128.330) (-1132.198) [-1128.869] -- 0:00:58
Average standard deviation of split frequencies: 0.020892
145500 -- [-1128.279] (-1129.329) (-1129.862) (-1127.379) * (-1130.604) (-1128.358) [-1128.014] (-1128.573) -- 0:00:58
146000 -- (-1127.835) (-1130.041) (-1130.744) [-1127.580] * [-1130.410] (-1131.076) (-1131.822) (-1127.828) -- 0:00:58
146500 -- (-1129.938) [-1127.305] (-1129.961) (-1128.034) * [-1129.099] (-1133.339) (-1128.096) (-1127.845) -- 0:00:58
147000 -- (-1131.882) (-1133.907) [-1129.715] (-1128.994) * (-1128.519) (-1131.760) (-1128.725) [-1127.667] -- 0:00:58
147500 -- (-1128.748) (-1131.655) (-1128.883) [-1132.810] * (-1130.419) (-1127.609) [-1128.506] (-1129.487) -- 0:00:57
148000 -- [-1127.711] (-1131.359) (-1129.535) (-1129.395) * [-1128.985] (-1129.007) (-1132.822) (-1130.502) -- 0:00:57
148500 -- (-1131.852) (-1129.181) (-1133.619) [-1128.278] * (-1128.063) (-1127.379) (-1129.817) [-1128.299] -- 0:00:57
149000 -- [-1127.682] (-1128.998) (-1132.683) (-1128.972) * (-1131.037) (-1127.660) (-1137.104) [-1129.125] -- 0:00:57
149500 -- (-1128.591) [-1130.368] (-1130.482) (-1129.956) * (-1132.043) [-1127.718] (-1132.055) (-1130.438) -- 0:00:56
150000 -- (-1128.816) (-1131.311) [-1130.531] (-1129.548) * (-1128.622) [-1128.355] (-1131.666) (-1128.082) -- 0:00:56
Average standard deviation of split frequencies: 0.023190
150500 -- (-1131.114) [-1127.446] (-1128.315) (-1128.135) * (-1129.801) [-1129.269] (-1132.571) (-1127.974) -- 0:00:56
151000 -- (-1127.072) (-1130.994) [-1127.902] (-1130.556) * (-1128.478) [-1128.300] (-1133.641) (-1129.533) -- 0:00:56
151500 -- (-1127.446) (-1132.446) [-1129.341] (-1130.258) * [-1128.762] (-1132.253) (-1128.929) (-1128.511) -- 0:00:56
152000 -- (-1130.821) (-1131.694) (-1129.336) [-1131.117] * (-1128.227) [-1127.304] (-1128.929) (-1132.337) -- 0:00:55
152500 -- (-1129.694) (-1133.661) [-1128.507] (-1129.753) * [-1128.758] (-1128.683) (-1130.233) (-1128.739) -- 0:00:55
153000 -- (-1128.529) (-1129.585) [-1131.375] (-1130.305) * (-1130.308) [-1128.057] (-1128.683) (-1127.351) -- 0:00:55
153500 -- [-1127.779] (-1129.651) (-1130.019) (-1129.493) * (-1129.963) (-1127.017) (-1131.549) [-1127.977] -- 0:00:55
154000 -- (-1132.390) [-1128.734] (-1129.001) (-1129.896) * (-1130.823) (-1129.722) (-1132.217) [-1128.156] -- 0:00:54
154500 -- [-1130.613] (-1128.905) (-1129.632) (-1132.147) * (-1132.238) [-1129.603] (-1132.075) (-1132.795) -- 0:00:54
155000 -- (-1128.345) (-1128.402) [-1133.179] (-1131.795) * [-1132.571] (-1129.603) (-1132.007) (-1131.785) -- 0:00:54
Average standard deviation of split frequencies: 0.022930
155500 -- (-1129.353) (-1128.346) (-1128.789) [-1129.347] * (-1132.718) (-1129.090) [-1132.414] (-1131.181) -- 0:00:54
156000 -- (-1130.014) (-1128.928) [-1127.898] (-1129.857) * (-1128.641) (-1127.515) (-1127.794) [-1128.368] -- 0:00:54
156500 -- (-1129.508) (-1129.209) (-1127.898) [-1129.235] * (-1127.971) (-1130.279) (-1127.898) [-1129.864] -- 0:00:53
157000 -- (-1129.351) (-1127.988) [-1128.963] (-1131.528) * (-1128.559) [-1128.826] (-1127.284) (-1127.942) -- 0:00:53
157500 -- (-1133.235) [-1129.877] (-1133.138) (-1132.775) * (-1127.963) [-1131.299] (-1128.806) (-1128.313) -- 0:00:53
158000 -- (-1134.029) (-1127.734) [-1129.185] (-1137.007) * [-1128.916] (-1128.406) (-1128.014) (-1129.067) -- 0:00:53
158500 -- (-1138.694) [-1128.149] (-1130.268) (-1131.656) * [-1129.361] (-1128.956) (-1128.239) (-1128.384) -- 0:00:53
159000 -- (-1129.604) (-1132.406) [-1133.636] (-1128.257) * [-1132.359] (-1127.855) (-1129.152) (-1130.411) -- 0:00:52
159500 -- [-1128.802] (-1130.466) (-1127.562) (-1130.094) * (-1127.930) [-1130.016] (-1129.123) (-1131.328) -- 0:00:52
160000 -- (-1132.116) [-1130.304] (-1129.820) (-1129.611) * [-1129.541] (-1134.812) (-1128.891) (-1133.312) -- 0:00:57
Average standard deviation of split frequencies: 0.022955
160500 -- (-1132.134) (-1128.413) [-1127.389] (-1129.519) * [-1130.830] (-1127.913) (-1130.529) (-1128.881) -- 0:00:57
161000 -- (-1130.604) (-1131.991) (-1129.204) [-1128.711] * (-1129.385) (-1128.406) [-1128.253] (-1129.346) -- 0:00:57
161500 -- (-1130.792) (-1130.851) (-1127.938) [-1130.203] * (-1128.818) [-1128.092] (-1128.664) (-1129.236) -- 0:00:57
162000 -- (-1129.148) [-1129.440] (-1128.793) (-1129.282) * [-1129.513] (-1128.223) (-1128.205) (-1129.742) -- 0:00:56
162500 -- (-1130.193) (-1132.081) (-1127.375) [-1129.291] * [-1127.643] (-1128.921) (-1127.576) (-1134.744) -- 0:00:56
163000 -- (-1133.084) (-1129.154) [-1127.631] (-1128.006) * (-1128.054) [-1128.630] (-1128.555) (-1130.764) -- 0:00:56
163500 -- (-1132.110) (-1127.895) [-1127.333] (-1128.289) * (-1128.929) (-1130.091) (-1130.822) [-1133.277] -- 0:00:56
164000 -- (-1134.251) [-1127.699] (-1128.794) (-1128.102) * (-1127.917) (-1132.453) [-1130.369] (-1131.035) -- 0:00:56
164500 -- (-1130.177) (-1131.661) [-1127.665] (-1128.878) * (-1129.126) (-1133.710) [-1132.911] (-1128.769) -- 0:00:55
165000 -- [-1130.875] (-1131.268) (-1128.545) (-1129.310) * [-1129.390] (-1131.229) (-1129.033) (-1130.067) -- 0:00:55
Average standard deviation of split frequencies: 0.022551
165500 -- (-1130.978) (-1128.469) (-1127.734) [-1129.401] * (-1129.343) [-1131.230] (-1129.161) (-1127.477) -- 0:00:55
166000 -- (-1130.471) (-1129.232) (-1130.212) [-1129.402] * (-1127.971) (-1132.427) (-1131.134) [-1128.943] -- 0:00:55
166500 -- (-1129.790) (-1131.729) [-1133.350] (-1131.541) * (-1131.287) (-1132.747) [-1129.971] (-1129.131) -- 0:00:55
167000 -- (-1130.640) (-1129.783) [-1130.803] (-1135.381) * (-1132.257) (-1130.309) (-1128.466) [-1129.633] -- 0:00:54
167500 -- (-1128.856) [-1128.660] (-1131.167) (-1130.669) * (-1132.226) (-1130.075) [-1128.151] (-1129.078) -- 0:00:54
168000 -- (-1128.993) [-1128.677] (-1132.683) (-1132.772) * [-1131.627] (-1130.089) (-1137.870) (-1129.734) -- 0:00:54
168500 -- (-1128.336) [-1128.980] (-1130.829) (-1131.570) * (-1131.039) (-1132.781) (-1135.879) [-1131.026] -- 0:00:54
169000 -- (-1130.395) [-1128.436] (-1130.861) (-1129.975) * [-1129.307] (-1128.787) (-1128.367) (-1128.646) -- 0:00:54
169500 -- [-1129.793] (-1127.312) (-1130.924) (-1131.249) * [-1129.535] (-1128.449) (-1127.543) (-1129.589) -- 0:00:53
170000 -- (-1131.540) (-1128.892) (-1135.312) [-1130.480] * (-1129.392) (-1127.670) (-1131.076) [-1130.140] -- 0:00:53
Average standard deviation of split frequencies: 0.019795
170500 -- (-1128.763) (-1128.770) [-1128.643] (-1132.836) * (-1132.144) (-1129.579) (-1129.575) [-1129.032] -- 0:00:53
171000 -- (-1134.447) (-1128.261) (-1130.496) [-1129.966] * (-1127.482) [-1127.538] (-1131.197) (-1128.879) -- 0:00:53
171500 -- (-1130.205) [-1129.587] (-1129.055) (-1129.606) * (-1129.325) (-1128.388) (-1135.003) [-1128.539] -- 0:00:53
172000 -- (-1129.780) (-1129.228) [-1128.033] (-1131.168) * (-1130.755) (-1128.388) (-1134.677) [-1127.204] -- 0:00:52
172500 -- (-1134.577) [-1128.631] (-1129.828) (-1131.257) * [-1130.446] (-1131.303) (-1129.416) (-1127.031) -- 0:00:52
173000 -- (-1134.023) [-1129.150] (-1130.731) (-1130.863) * (-1133.181) (-1128.751) [-1128.980] (-1128.032) -- 0:00:52
173500 -- (-1135.919) [-1127.819] (-1128.299) (-1130.147) * (-1128.663) (-1128.254) (-1128.365) [-1127.907] -- 0:00:52
174000 -- (-1131.316) [-1128.601] (-1135.375) (-1130.500) * (-1128.666) [-1128.323] (-1128.209) (-1130.862) -- 0:00:52
174500 -- [-1131.111] (-1127.866) (-1128.137) (-1128.170) * (-1127.725) (-1128.093) [-1129.832] (-1128.527) -- 0:00:52
175000 -- (-1128.245) (-1128.410) [-1128.456] (-1130.850) * (-1127.725) (-1134.535) (-1128.676) [-1127.669] -- 0:00:51
Average standard deviation of split frequencies: 0.016815
175500 -- (-1128.397) (-1127.849) [-1127.330] (-1127.892) * (-1127.714) (-1130.443) [-1130.870] (-1128.901) -- 0:00:51
176000 -- (-1128.679) (-1128.324) (-1127.424) [-1128.770] * (-1127.966) (-1127.676) [-1130.870] (-1127.450) -- 0:00:51
176500 -- [-1127.858] (-1127.384) (-1128.549) (-1128.814) * [-1127.446] (-1130.068) (-1128.765) (-1127.926) -- 0:00:55
177000 -- (-1128.093) (-1129.380) [-1129.047] (-1128.732) * (-1127.896) (-1130.274) (-1133.029) [-1128.630] -- 0:00:55
177500 -- [-1129.488] (-1129.798) (-1132.237) (-1129.206) * (-1128.428) [-1131.266] (-1129.292) (-1127.639) -- 0:00:55
178000 -- (-1129.083) [-1128.493] (-1128.375) (-1129.553) * (-1130.606) (-1131.031) [-1128.993] (-1127.976) -- 0:00:55
178500 -- (-1128.418) [-1128.434] (-1130.161) (-1128.770) * (-1132.193) (-1129.524) [-1127.342] (-1128.670) -- 0:00:55
179000 -- (-1128.135) [-1128.510] (-1130.487) (-1130.118) * [-1130.472] (-1128.370) (-1128.087) (-1129.101) -- 0:00:55
179500 -- (-1135.204) (-1133.486) [-1132.834] (-1129.465) * (-1129.892) (-1130.524) [-1128.409] (-1128.270) -- 0:00:54
180000 -- (-1134.208) (-1128.841) [-1128.046] (-1131.659) * (-1128.345) (-1138.689) [-1127.591] (-1129.705) -- 0:00:54
Average standard deviation of split frequencies: 0.016205
180500 -- (-1133.738) [-1127.785] (-1129.300) (-1128.954) * [-1128.446] (-1131.370) (-1130.543) (-1129.114) -- 0:00:54
181000 -- (-1130.795) (-1128.002) (-1127.901) [-1134.229] * (-1130.248) (-1127.688) [-1130.448] (-1131.481) -- 0:00:54
181500 -- (-1130.983) [-1127.181] (-1128.910) (-1130.319) * [-1127.661] (-1128.045) (-1129.391) (-1127.596) -- 0:00:54
182000 -- (-1135.345) [-1127.832] (-1127.469) (-1130.188) * [-1132.385] (-1129.385) (-1127.803) (-1127.134) -- 0:00:53
182500 -- (-1128.064) [-1127.380] (-1127.497) (-1127.382) * (-1129.199) (-1128.662) (-1128.412) [-1127.739] -- 0:00:53
183000 -- (-1127.697) [-1127.627] (-1127.788) (-1129.275) * (-1132.434) (-1129.289) (-1128.840) [-1128.913] -- 0:00:53
183500 -- (-1134.657) [-1129.599] (-1128.418) (-1130.747) * (-1129.516) (-1130.003) [-1129.709] (-1127.857) -- 0:00:53
184000 -- (-1132.555) (-1129.666) (-1128.170) [-1134.281] * [-1132.213] (-1137.369) (-1128.046) (-1127.825) -- 0:00:53
184500 -- (-1128.111) (-1129.233) [-1128.315] (-1137.779) * (-1130.658) (-1130.431) [-1128.371] (-1127.593) -- 0:00:53
185000 -- (-1129.076) (-1128.206) [-1128.265] (-1130.867) * (-1131.518) (-1131.474) (-1127.539) [-1127.554] -- 0:00:52
Average standard deviation of split frequencies: 0.015840
185500 -- (-1133.694) (-1128.315) [-1129.220] (-1128.690) * (-1128.710) [-1128.216] (-1130.505) (-1128.484) -- 0:00:52
186000 -- (-1134.589) [-1128.190] (-1131.917) (-1127.693) * (-1131.479) (-1128.539) [-1128.292] (-1127.769) -- 0:00:52
186500 -- (-1134.899) (-1129.321) [-1131.945] (-1128.932) * (-1127.411) [-1130.569] (-1130.609) (-1130.951) -- 0:00:52
187000 -- (-1129.953) (-1129.235) (-1131.624) [-1129.622] * (-1128.221) [-1128.888] (-1134.582) (-1134.764) -- 0:00:52
187500 -- (-1128.266) (-1130.465) (-1132.466) [-1130.127] * [-1127.705] (-1127.443) (-1131.562) (-1132.639) -- 0:00:52
188000 -- (-1130.386) [-1129.349] (-1129.352) (-1130.229) * (-1128.578) (-1131.510) (-1132.392) [-1129.450] -- 0:00:51
188500 -- (-1132.242) (-1128.022) (-1131.237) [-1127.481] * [-1129.178] (-1129.916) (-1131.514) (-1129.394) -- 0:00:51
189000 -- (-1131.493) [-1129.226] (-1130.360) (-1128.090) * (-1128.697) [-1127.667] (-1129.719) (-1133.584) -- 0:00:51
189500 -- [-1128.897] (-1127.929) (-1129.693) (-1133.590) * (-1129.330) [-1128.872] (-1127.313) (-1129.633) -- 0:00:51
190000 -- (-1131.866) (-1129.942) [-1134.942] (-1133.174) * (-1129.156) [-1127.982] (-1131.420) (-1129.939) -- 0:00:51
Average standard deviation of split frequencies: 0.016689
190500 -- (-1129.710) (-1131.123) [-1130.949] (-1132.957) * (-1128.970) (-1131.241) [-1130.154] (-1128.158) -- 0:00:50
191000 -- (-1130.909) (-1131.511) [-1131.535] (-1132.114) * (-1134.631) [-1131.237] (-1128.536) (-1127.756) -- 0:00:50
191500 -- (-1129.659) [-1131.242] (-1127.010) (-1127.962) * [-1130.477] (-1131.445) (-1130.752) (-1129.451) -- 0:00:50
192000 -- (-1132.221) (-1130.377) (-1128.200) [-1130.445] * (-1131.282) (-1129.448) [-1128.363] (-1135.244) -- 0:00:50
192500 -- (-1130.081) [-1128.440] (-1128.558) (-1131.260) * (-1130.028) (-1128.737) [-1127.965] (-1130.777) -- 0:00:54
193000 -- (-1132.223) [-1128.913] (-1127.351) (-1131.044) * (-1128.545) [-1128.749] (-1127.646) (-1130.262) -- 0:00:54
193500 -- (-1128.188) [-1127.699] (-1130.660) (-1129.209) * (-1130.626) (-1129.221) [-1130.039] (-1130.996) -- 0:00:54
194000 -- (-1129.227) (-1129.423) (-1129.644) [-1130.237] * (-1130.368) (-1131.399) [-1129.998] (-1127.574) -- 0:00:54
194500 -- (-1127.728) (-1128.517) [-1131.519] (-1128.667) * (-1130.267) [-1130.976] (-1131.896) (-1129.207) -- 0:00:53
195000 -- (-1126.986) (-1129.068) [-1128.980] (-1130.392) * (-1128.297) (-1130.882) (-1130.747) [-1129.541] -- 0:00:53
Average standard deviation of split frequencies: 0.015823
195500 -- (-1131.644) [-1129.264] (-1128.550) (-1131.096) * (-1130.081) (-1133.984) (-1128.803) [-1129.641] -- 0:00:53
196000 -- (-1130.106) [-1127.167] (-1130.582) (-1127.580) * (-1132.391) (-1132.930) [-1130.652] (-1129.451) -- 0:00:53
196500 -- [-1128.069] (-1128.125) (-1131.456) (-1127.757) * (-1134.262) [-1128.247] (-1127.536) (-1130.705) -- 0:00:53
197000 -- (-1127.892) (-1133.322) [-1133.303] (-1132.060) * (-1130.663) [-1132.268] (-1128.927) (-1128.339) -- 0:00:52
197500 -- (-1130.709) (-1131.929) [-1129.595] (-1131.501) * [-1129.215] (-1133.552) (-1129.266) (-1127.456) -- 0:00:52
198000 -- (-1128.715) (-1135.385) (-1129.669) [-1129.085] * (-1129.957) (-1132.927) [-1129.734] (-1134.923) -- 0:00:52
198500 -- [-1129.612] (-1130.858) (-1130.421) (-1129.386) * (-1129.277) (-1130.692) [-1134.749] (-1128.125) -- 0:00:52
199000 -- [-1128.063] (-1131.193) (-1130.878) (-1128.615) * (-1129.010) (-1131.606) (-1132.843) [-1128.276] -- 0:00:52
199500 -- (-1127.842) (-1130.842) [-1129.668] (-1130.134) * (-1129.001) (-1128.387) (-1133.665) [-1127.844] -- 0:00:52
200000 -- (-1127.569) (-1133.405) (-1128.440) [-1129.128] * (-1132.236) (-1128.560) [-1129.042] (-1129.017) -- 0:00:51
Average standard deviation of split frequencies: 0.017186
200500 -- [-1128.387] (-1132.116) (-1127.918) (-1136.951) * (-1128.128) (-1129.858) [-1128.974] (-1131.065) -- 0:00:51
201000 -- [-1128.616] (-1135.450) (-1128.038) (-1131.687) * (-1131.124) (-1132.023) (-1131.666) [-1128.505] -- 0:00:51
201500 -- (-1129.360) (-1136.124) [-1128.050] (-1131.024) * (-1131.650) (-1134.446) [-1131.085] (-1127.194) -- 0:00:51
202000 -- [-1127.527] (-1130.249) (-1129.744) (-1131.844) * (-1132.434) (-1130.717) (-1130.823) [-1128.698] -- 0:00:51
202500 -- (-1129.182) [-1129.386] (-1129.701) (-1136.109) * (-1127.995) (-1132.752) (-1128.459) [-1130.592] -- 0:00:51
203000 -- (-1128.018) (-1130.060) [-1128.040] (-1133.667) * (-1129.919) (-1128.305) [-1128.327] (-1130.666) -- 0:00:51
203500 -- (-1130.944) [-1129.381] (-1129.432) (-1130.654) * (-1129.868) (-1127.404) [-1129.660] (-1128.071) -- 0:00:50
204000 -- (-1127.600) (-1133.040) (-1132.011) [-1130.700] * (-1136.791) [-1127.531] (-1130.487) (-1128.521) -- 0:00:50
204500 -- (-1127.136) [-1127.764] (-1129.749) (-1127.080) * (-1130.760) (-1131.592) (-1130.254) [-1128.636] -- 0:00:50
205000 -- [-1127.569] (-1127.973) (-1129.405) (-1127.681) * [-1128.901] (-1131.114) (-1129.258) (-1128.828) -- 0:00:50
Average standard deviation of split frequencies: 0.017705
205500 -- (-1127.562) (-1129.958) [-1129.628] (-1128.173) * (-1129.546) [-1129.866] (-1129.910) (-1127.717) -- 0:00:50
206000 -- [-1127.406] (-1130.354) (-1130.157) (-1129.419) * (-1131.246) (-1130.964) [-1133.700] (-1127.780) -- 0:00:50
206500 -- [-1127.470] (-1130.165) (-1128.769) (-1130.374) * (-1128.112) (-1130.018) (-1133.012) [-1127.868] -- 0:00:49
207000 -- (-1127.258) (-1129.026) (-1130.230) [-1128.606] * [-1128.459] (-1129.618) (-1130.915) (-1128.575) -- 0:00:49
207500 -- [-1128.369] (-1128.283) (-1132.509) (-1132.249) * (-1128.475) (-1129.684) (-1128.135) [-1129.563] -- 0:00:49
208000 -- (-1131.829) (-1128.427) [-1128.974] (-1136.129) * (-1128.594) [-1129.728] (-1128.474) (-1131.330) -- 0:00:49
208500 -- (-1131.086) (-1128.911) [-1129.885] (-1134.386) * [-1128.919] (-1129.404) (-1128.705) (-1130.096) -- 0:00:49
209000 -- (-1128.662) (-1130.884) (-1134.234) [-1128.927] * [-1127.784] (-1128.499) (-1129.101) (-1127.918) -- 0:00:52
209500 -- (-1127.731) [-1130.367] (-1128.121) (-1131.044) * (-1128.059) [-1128.845] (-1133.011) (-1128.274) -- 0:00:52
210000 -- (-1128.981) (-1131.294) [-1127.181] (-1131.124) * [-1131.320] (-1127.665) (-1129.245) (-1130.923) -- 0:00:52
Average standard deviation of split frequencies: 0.015788
210500 -- [-1127.247] (-1129.868) (-1130.081) (-1128.492) * (-1133.314) (-1135.734) [-1129.242] (-1134.866) -- 0:00:52
211000 -- (-1128.746) (-1128.401) (-1130.162) [-1129.521] * (-1128.816) [-1129.092] (-1128.953) (-1129.115) -- 0:00:52
211500 -- (-1128.634) (-1128.421) [-1131.429] (-1127.025) * [-1128.880] (-1127.322) (-1130.139) (-1130.334) -- 0:00:52
212000 -- [-1129.336] (-1128.429) (-1129.510) (-1127.054) * (-1130.762) [-1128.434] (-1128.433) (-1127.658) -- 0:00:52
212500 -- [-1132.363] (-1129.535) (-1127.902) (-1128.018) * [-1129.875] (-1129.207) (-1129.826) (-1131.937) -- 0:00:51
213000 -- (-1131.568) (-1127.866) [-1131.401] (-1127.141) * (-1130.935) (-1127.501) [-1127.722] (-1129.790) -- 0:00:51
213500 -- (-1129.048) (-1129.509) [-1131.549] (-1129.749) * [-1128.145] (-1130.042) (-1129.935) (-1131.175) -- 0:00:51
214000 -- (-1129.219) (-1128.647) (-1130.385) [-1128.355] * (-1129.026) [-1129.090] (-1132.839) (-1130.718) -- 0:00:51
214500 -- (-1131.715) [-1128.735] (-1128.329) (-1130.584) * (-1129.378) [-1128.128] (-1129.140) (-1134.990) -- 0:00:51
215000 -- (-1128.085) (-1130.631) (-1129.046) [-1132.589] * [-1132.364] (-1128.349) (-1131.375) (-1129.822) -- 0:00:51
Average standard deviation of split frequencies: 0.017459
215500 -- (-1128.897) (-1130.545) (-1130.215) [-1129.997] * (-1129.809) (-1128.031) [-1128.852] (-1130.023) -- 0:00:50
216000 -- (-1128.444) [-1131.694] (-1131.440) (-1133.267) * [-1129.769] (-1130.934) (-1131.267) (-1130.155) -- 0:00:50
216500 -- [-1130.741] (-1127.558) (-1131.426) (-1136.936) * [-1128.243] (-1132.180) (-1128.024) (-1129.211) -- 0:00:50
217000 -- (-1128.770) (-1127.646) [-1131.389] (-1128.923) * (-1128.093) [-1131.519] (-1127.951) (-1128.468) -- 0:00:50
217500 -- [-1133.183] (-1129.771) (-1133.626) (-1127.597) * [-1128.093] (-1129.773) (-1128.035) (-1129.377) -- 0:00:50
218000 -- [-1128.800] (-1128.930) (-1129.340) (-1129.725) * (-1128.723) (-1130.888) [-1127.316] (-1135.784) -- 0:00:50
218500 -- (-1129.426) (-1128.418) [-1131.896] (-1129.517) * (-1128.000) (-1130.893) (-1127.411) [-1131.219] -- 0:00:50
219000 -- (-1129.848) (-1129.431) [-1128.270] (-1129.261) * (-1127.174) (-1132.529) (-1130.938) [-1128.417] -- 0:00:49
219500 -- (-1129.646) (-1127.711) [-1130.999] (-1127.941) * (-1131.191) (-1127.938) [-1128.657] (-1127.361) -- 0:00:49
220000 -- (-1128.008) (-1128.562) [-1131.033] (-1129.753) * (-1127.770) [-1127.284] (-1130.186) (-1127.275) -- 0:00:49
Average standard deviation of split frequencies: 0.017216
220500 -- [-1128.302] (-1127.254) (-1129.313) (-1128.529) * (-1130.211) [-1130.443] (-1132.204) (-1128.396) -- 0:00:49
221000 -- [-1130.380] (-1127.834) (-1129.907) (-1129.314) * (-1131.239) [-1128.661] (-1129.453) (-1129.563) -- 0:00:49
221500 -- (-1128.711) (-1132.198) (-1132.581) [-1128.357] * (-1128.615) (-1127.813) [-1128.551] (-1130.439) -- 0:00:49
222000 -- (-1130.160) (-1128.521) (-1129.647) [-1129.777] * (-1129.108) (-1128.488) (-1128.268) [-1127.030] -- 0:00:49
222500 -- (-1136.969) (-1130.058) [-1130.995] (-1129.634) * (-1128.449) (-1129.011) [-1129.275] (-1128.524) -- 0:00:48
223000 -- (-1130.662) (-1128.669) [-1127.884] (-1129.160) * [-1129.780] (-1131.093) (-1130.740) (-1130.313) -- 0:00:48
223500 -- (-1129.321) (-1128.675) [-1128.251] (-1128.155) * [-1128.950] (-1132.570) (-1127.669) (-1130.249) -- 0:00:48
224000 -- (-1128.404) (-1129.724) [-1129.742] (-1129.446) * (-1128.325) (-1129.583) (-1128.148) [-1128.066] -- 0:00:48
224500 -- (-1129.276) (-1130.850) [-1126.998] (-1131.068) * (-1128.195) [-1129.437] (-1128.762) (-1134.674) -- 0:00:48
225000 -- [-1128.621] (-1131.171) (-1127.258) (-1129.274) * (-1128.803) (-1130.434) [-1129.024] (-1131.097) -- 0:00:48
Average standard deviation of split frequencies: 0.016441
225500 -- [-1129.101] (-1130.368) (-1128.201) (-1130.180) * (-1128.894) (-1129.038) [-1127.739] (-1130.126) -- 0:00:51
226000 -- (-1129.991) [-1131.771] (-1128.643) (-1129.058) * (-1129.157) (-1131.193) (-1127.544) [-1127.495] -- 0:00:51
226500 -- [-1133.086] (-1129.640) (-1128.653) (-1131.456) * [-1128.718] (-1132.570) (-1127.589) (-1130.424) -- 0:00:51
227000 -- (-1129.403) [-1127.899] (-1127.236) (-1128.404) * (-1129.084) (-1132.636) [-1128.218] (-1128.521) -- 0:00:51
227500 -- (-1130.063) (-1127.841) (-1127.221) [-1128.115] * (-1130.598) (-1128.360) [-1128.486] (-1128.198) -- 0:00:50
228000 -- (-1129.986) (-1129.338) [-1128.050] (-1128.333) * [-1131.416] (-1129.495) (-1129.196) (-1129.780) -- 0:00:50
228500 -- (-1128.905) (-1129.633) [-1128.371] (-1137.085) * (-1128.631) (-1127.489) (-1132.908) [-1130.577] -- 0:00:50
229000 -- [-1129.008] (-1131.269) (-1129.293) (-1133.438) * (-1128.733) [-1129.217] (-1133.507) (-1132.114) -- 0:00:50
229500 -- [-1128.567] (-1131.178) (-1130.616) (-1127.607) * (-1131.731) (-1129.725) [-1134.366] (-1133.622) -- 0:00:50
230000 -- (-1130.750) (-1129.496) (-1132.414) [-1127.875] * (-1134.426) (-1128.595) [-1130.466] (-1132.991) -- 0:00:50
Average standard deviation of split frequencies: 0.016229
230500 -- (-1130.194) (-1128.862) [-1130.947] (-1129.356) * (-1130.850) [-1128.495] (-1129.353) (-1134.644) -- 0:00:50
231000 -- (-1131.872) [-1128.427] (-1130.546) (-1129.174) * (-1128.033) [-1127.780] (-1129.563) (-1134.084) -- 0:00:49
231500 -- (-1128.920) (-1129.351) (-1132.821) [-1127.792] * [-1127.291] (-1127.112) (-1128.005) (-1132.879) -- 0:00:49
232000 -- (-1128.864) [-1131.243] (-1130.906) (-1130.188) * (-1129.001) (-1130.391) [-1128.600] (-1131.650) -- 0:00:49
232500 -- [-1128.154] (-1128.982) (-1132.062) (-1132.525) * (-1132.926) [-1131.231] (-1127.244) (-1129.770) -- 0:00:49
233000 -- (-1131.494) (-1133.485) (-1129.935) [-1128.401] * (-1129.682) [-1129.763] (-1127.782) (-1130.412) -- 0:00:49
233500 -- [-1130.384] (-1129.509) (-1130.111) (-1129.357) * (-1130.568) (-1129.803) (-1129.801) [-1130.198] -- 0:00:49
234000 -- [-1130.994] (-1132.579) (-1132.774) (-1128.323) * (-1127.924) (-1136.749) [-1129.071] (-1131.316) -- 0:00:49
234500 -- (-1136.642) [-1128.389] (-1129.841) (-1129.145) * [-1128.290] (-1135.251) (-1127.849) (-1128.183) -- 0:00:48
235000 -- (-1129.948) (-1127.966) [-1129.506] (-1130.416) * [-1135.945] (-1136.376) (-1129.812) (-1127.672) -- 0:00:48
Average standard deviation of split frequencies: 0.014981
235500 -- (-1129.413) (-1129.014) [-1127.450] (-1130.433) * (-1133.939) (-1132.227) (-1130.513) [-1127.745] -- 0:00:48
236000 -- (-1131.019) (-1130.507) (-1132.642) [-1127.429] * (-1132.265) (-1131.675) (-1128.186) [-1127.893] -- 0:00:48
236500 -- (-1128.368) (-1128.350) (-1128.870) [-1127.888] * (-1131.887) (-1128.321) [-1128.187] (-1128.073) -- 0:00:48
237000 -- (-1132.090) [-1129.627] (-1130.196) (-1128.794) * [-1127.567] (-1128.688) (-1130.051) (-1129.608) -- 0:00:48
237500 -- [-1129.775] (-1128.528) (-1129.558) (-1129.863) * (-1128.257) (-1134.685) (-1133.362) [-1128.612] -- 0:00:48
238000 -- (-1129.347) [-1128.405] (-1131.330) (-1134.142) * [-1127.635] (-1130.974) (-1139.057) (-1129.443) -- 0:00:48
238500 -- (-1133.770) (-1127.741) (-1134.870) [-1131.296] * (-1130.758) (-1133.133) (-1131.394) [-1129.008] -- 0:00:47
239000 -- [-1131.411] (-1128.394) (-1130.045) (-1130.777) * (-1131.896) (-1131.655) (-1131.154) [-1130.074] -- 0:00:47
239500 -- (-1130.359) (-1127.665) [-1132.566] (-1130.092) * (-1131.327) (-1130.145) (-1132.643) [-1130.803] -- 0:00:47
240000 -- (-1129.446) [-1128.282] (-1129.622) (-1130.792) * [-1131.402] (-1130.304) (-1128.811) (-1128.826) -- 0:00:47
Average standard deviation of split frequencies: 0.015235
240500 -- (-1129.069) [-1127.266] (-1129.716) (-1130.482) * (-1129.105) (-1129.195) (-1128.169) [-1128.322] -- 0:00:47
241000 -- (-1132.996) (-1127.225) [-1129.558] (-1130.508) * (-1128.658) [-1128.339] (-1128.150) (-1131.316) -- 0:00:47
241500 -- (-1129.560) (-1128.266) (-1130.338) [-1127.971] * [-1128.486] (-1131.823) (-1130.332) (-1128.358) -- 0:00:50
242000 -- (-1128.936) (-1129.496) (-1128.082) [-1128.053] * (-1129.506) [-1133.717] (-1130.725) (-1128.463) -- 0:00:50
242500 -- (-1131.859) (-1129.558) (-1127.874) [-1128.080] * [-1129.297] (-1127.928) (-1130.817) (-1129.390) -- 0:00:49
243000 -- [-1131.301] (-1128.857) (-1127.657) (-1129.427) * [-1128.750] (-1133.784) (-1128.561) (-1131.317) -- 0:00:49
243500 -- (-1127.963) (-1130.849) [-1127.233] (-1129.907) * (-1130.065) (-1129.459) [-1128.155] (-1129.791) -- 0:00:49
244000 -- (-1127.500) (-1129.107) [-1127.159] (-1129.322) * (-1128.282) (-1131.249) (-1129.009) [-1128.736] -- 0:00:49
244500 -- [-1129.335] (-1128.242) (-1128.876) (-1132.089) * [-1127.730] (-1132.319) (-1127.490) (-1132.112) -- 0:00:49
245000 -- [-1129.395] (-1129.801) (-1129.662) (-1129.304) * [-1127.322] (-1129.765) (-1129.283) (-1129.034) -- 0:00:49
Average standard deviation of split frequencies: 0.014691
245500 -- (-1132.198) (-1127.172) (-1132.581) [-1128.442] * (-1129.345) [-1128.209] (-1129.063) (-1129.917) -- 0:00:49
246000 -- (-1127.998) [-1127.372] (-1135.040) (-1129.242) * (-1131.062) (-1127.783) [-1128.855] (-1129.088) -- 0:00:49
246500 -- (-1128.232) (-1126.901) (-1130.182) [-1128.238] * [-1129.750] (-1127.428) (-1128.556) (-1130.075) -- 0:00:48
247000 -- (-1133.215) [-1131.413] (-1130.255) (-1130.086) * (-1127.790) (-1127.629) (-1128.619) [-1128.679] -- 0:00:48
247500 -- (-1134.243) [-1130.341] (-1127.920) (-1129.143) * (-1127.903) [-1127.502] (-1127.835) (-1128.110) -- 0:00:48
248000 -- (-1131.751) (-1127.954) [-1129.674] (-1129.034) * (-1129.177) (-1127.850) [-1127.828] (-1130.489) -- 0:00:48
248500 -- (-1128.849) [-1128.028] (-1134.193) (-1129.432) * (-1130.076) (-1128.374) (-1127.671) [-1127.610] -- 0:00:48
249000 -- (-1129.111) [-1129.755] (-1130.122) (-1130.295) * (-1128.384) [-1129.557] (-1127.671) (-1127.761) -- 0:00:48
249500 -- (-1128.777) [-1128.508] (-1128.527) (-1128.869) * (-1133.374) [-1127.549] (-1128.563) (-1127.890) -- 0:00:48
250000 -- (-1131.424) (-1128.478) [-1129.447] (-1128.645) * (-1131.811) [-1128.536] (-1129.448) (-1127.452) -- 0:00:48
Average standard deviation of split frequencies: 0.015358
250500 -- (-1128.946) [-1129.584] (-1130.206) (-1128.656) * (-1132.229) (-1127.349) [-1128.310] (-1127.358) -- 0:00:47
251000 -- [-1130.652] (-1128.968) (-1130.990) (-1128.077) * [-1131.715] (-1128.652) (-1127.817) (-1128.234) -- 0:00:47
251500 -- (-1131.289) [-1128.961] (-1132.128) (-1129.412) * (-1132.104) [-1129.328] (-1128.833) (-1127.518) -- 0:00:47
252000 -- (-1128.656) [-1128.557] (-1129.632) (-1129.595) * (-1132.164) (-1128.805) (-1128.923) [-1127.945] -- 0:00:47
252500 -- (-1129.050) (-1130.062) [-1128.006] (-1132.718) * (-1127.879) (-1128.569) [-1133.369] (-1130.184) -- 0:00:47
253000 -- (-1129.307) (-1131.790) [-1129.158] (-1130.458) * (-1130.756) (-1132.800) (-1129.440) [-1128.211] -- 0:00:47
253500 -- (-1130.491) [-1130.569] (-1127.721) (-1129.589) * (-1132.517) [-1133.091] (-1130.900) (-1131.173) -- 0:00:47
254000 -- (-1128.843) [-1129.397] (-1128.104) (-1127.653) * (-1128.345) (-1128.902) (-1129.493) [-1130.683] -- 0:00:46
254500 -- (-1130.067) (-1132.112) [-1127.508] (-1129.148) * (-1127.034) [-1128.752] (-1128.839) (-1129.633) -- 0:00:46
255000 -- (-1131.859) (-1132.907) [-1128.658] (-1129.632) * (-1130.727) (-1128.008) [-1128.872] (-1133.379) -- 0:00:46
Average standard deviation of split frequencies: 0.016368
255500 -- [-1130.123] (-1131.729) (-1129.703) (-1132.973) * (-1135.538) (-1127.483) [-1130.274] (-1132.500) -- 0:00:46
256000 -- (-1131.012) (-1128.331) [-1129.390] (-1131.618) * (-1135.456) (-1129.388) [-1127.843] (-1131.481) -- 0:00:46
256500 -- (-1130.445) (-1128.523) (-1127.341) [-1127.494] * (-1133.100) [-1131.216] (-1130.918) (-1128.109) -- 0:00:46
257000 -- [-1136.549] (-1129.103) (-1127.463) (-1130.162) * [-1134.205] (-1132.480) (-1129.187) (-1129.769) -- 0:00:46
257500 -- (-1136.092) [-1129.084] (-1129.572) (-1127.189) * (-1129.004) (-1129.714) [-1129.119] (-1129.211) -- 0:00:46
258000 -- [-1127.943] (-1128.820) (-1128.893) (-1127.378) * [-1129.468] (-1129.375) (-1128.441) (-1131.052) -- 0:00:48
258500 -- [-1129.086] (-1129.875) (-1128.016) (-1129.100) * (-1128.210) (-1132.128) (-1129.383) [-1130.726] -- 0:00:48
259000 -- [-1129.941] (-1130.706) (-1134.887) (-1128.997) * (-1128.115) (-1127.551) [-1128.702] (-1132.221) -- 0:00:48
259500 -- (-1129.504) [-1129.511] (-1130.087) (-1128.945) * (-1127.602) [-1127.666] (-1130.211) (-1137.447) -- 0:00:48
260000 -- (-1129.155) [-1129.628] (-1132.539) (-1131.768) * [-1127.989] (-1128.043) (-1129.721) (-1128.040) -- 0:00:48
Average standard deviation of split frequencies: 0.015573
260500 -- [-1129.501] (-1128.864) (-1134.719) (-1127.327) * [-1127.742] (-1128.210) (-1130.568) (-1128.721) -- 0:00:48
261000 -- (-1128.491) (-1130.375) (-1133.211) [-1129.568] * (-1130.024) (-1128.280) (-1131.659) [-1127.815] -- 0:00:48
261500 -- [-1128.486] (-1128.855) (-1132.664) (-1129.372) * [-1129.034] (-1128.687) (-1130.529) (-1127.748) -- 0:00:48
262000 -- [-1130.617] (-1127.046) (-1129.777) (-1133.182) * (-1128.731) (-1128.687) (-1130.064) [-1128.948] -- 0:00:47
262500 -- [-1128.177] (-1127.019) (-1128.724) (-1131.206) * [-1128.283] (-1130.332) (-1130.754) (-1127.764) -- 0:00:47
263000 -- (-1128.437) [-1126.887] (-1129.553) (-1130.321) * (-1130.235) [-1129.464] (-1130.932) (-1129.453) -- 0:00:47
263500 -- (-1131.540) (-1128.167) [-1128.252] (-1132.381) * [-1129.577] (-1129.569) (-1128.060) (-1128.019) -- 0:00:47
264000 -- (-1130.701) (-1128.996) [-1128.051] (-1127.997) * [-1127.272] (-1129.146) (-1128.352) (-1128.510) -- 0:00:47
264500 -- (-1131.277) (-1131.355) [-1130.016] (-1127.739) * (-1127.334) (-1130.995) (-1130.743) [-1133.883] -- 0:00:47
265000 -- (-1127.976) [-1129.537] (-1130.072) (-1127.516) * [-1128.880] (-1132.948) (-1130.443) (-1131.138) -- 0:00:47
Average standard deviation of split frequencies: 0.015950
265500 -- (-1127.790) (-1128.564) (-1131.716) [-1128.812] * (-1128.035) (-1130.280) [-1132.755] (-1129.711) -- 0:00:47
266000 -- (-1130.192) [-1128.237] (-1129.754) (-1130.189) * (-1127.653) (-1128.914) [-1134.392] (-1129.441) -- 0:00:46
266500 -- (-1129.276) (-1127.795) [-1129.988] (-1132.321) * [-1127.765] (-1127.268) (-1128.947) (-1129.116) -- 0:00:46
267000 -- (-1128.879) (-1127.624) (-1131.459) [-1131.127] * [-1130.244] (-1129.884) (-1128.664) (-1127.845) -- 0:00:46
267500 -- (-1128.949) (-1127.887) (-1129.859) [-1128.215] * (-1133.471) (-1130.907) (-1129.155) [-1127.563] -- 0:00:46
268000 -- [-1130.175] (-1131.113) (-1129.912) (-1128.676) * (-1130.727) (-1130.332) [-1127.561] (-1128.727) -- 0:00:46
268500 -- (-1131.471) (-1133.765) (-1128.493) [-1129.072] * (-1129.149) (-1133.150) (-1127.540) [-1128.790] -- 0:00:46
269000 -- [-1128.169] (-1129.001) (-1127.300) (-1127.853) * (-1129.348) [-1128.152] (-1129.231) (-1128.275) -- 0:00:46
269500 -- [-1128.229] (-1130.021) (-1135.532) (-1129.927) * (-1130.102) [-1128.302] (-1128.278) (-1129.228) -- 0:00:46
270000 -- (-1128.214) (-1131.103) (-1131.885) [-1129.920] * (-1130.626) (-1132.992) [-1130.137] (-1130.308) -- 0:00:45
Average standard deviation of split frequencies: 0.016159
270500 -- (-1129.717) (-1133.166) [-1128.901] (-1128.543) * (-1132.725) (-1128.309) (-1130.068) [-1129.731] -- 0:00:45
271000 -- (-1129.230) [-1128.938] (-1130.804) (-1129.227) * (-1127.844) (-1127.453) (-1129.280) [-1129.442] -- 0:00:45
271500 -- (-1130.639) [-1128.801] (-1130.808) (-1130.348) * (-1129.773) [-1129.325] (-1129.908) (-1128.310) -- 0:00:45
272000 -- (-1129.217) [-1129.963] (-1131.217) (-1131.454) * (-1128.824) (-1127.911) (-1130.057) [-1128.745] -- 0:00:45
272500 -- (-1129.364) [-1128.316] (-1129.837) (-1134.117) * (-1129.035) [-1127.951] (-1131.598) (-1128.889) -- 0:00:45
273000 -- (-1127.607) [-1131.679] (-1132.613) (-1129.271) * (-1131.969) (-1129.692) (-1129.592) [-1127.421] -- 0:00:45
273500 -- (-1129.448) (-1130.684) [-1130.036] (-1128.511) * (-1128.222) (-1129.328) [-1131.533] (-1128.833) -- 0:00:45
274000 -- (-1127.841) (-1130.867) [-1131.280] (-1129.245) * [-1128.105] (-1128.109) (-1127.631) (-1128.754) -- 0:00:45
274500 -- [-1129.475] (-1128.725) (-1131.376) (-1130.059) * (-1128.438) (-1128.851) (-1127.631) [-1127.626] -- 0:00:47
275000 -- (-1132.399) (-1127.332) (-1129.846) [-1129.567] * (-1129.338) (-1129.165) (-1128.175) [-1128.207] -- 0:00:47
Average standard deviation of split frequencies: 0.015846
275500 -- (-1128.733) [-1128.348] (-1129.916) (-1130.437) * (-1129.391) (-1128.534) [-1128.219] (-1132.289) -- 0:00:47
276000 -- (-1129.522) (-1128.300) (-1130.056) [-1127.380] * (-1128.350) [-1128.880] (-1128.004) (-1131.286) -- 0:00:47
276500 -- (-1130.516) (-1127.655) (-1131.878) [-1129.202] * (-1133.003) (-1128.892) (-1128.613) [-1129.108] -- 0:00:47
277000 -- (-1130.639) (-1131.325) (-1130.608) [-1131.438] * [-1129.901] (-1128.379) (-1129.216) (-1130.523) -- 0:00:46
277500 -- (-1131.309) (-1127.708) [-1128.000] (-1128.344) * [-1130.773] (-1131.020) (-1130.091) (-1130.005) -- 0:00:46
278000 -- [-1131.593] (-1128.107) (-1128.522) (-1128.055) * (-1131.840) (-1130.003) [-1129.019] (-1130.169) -- 0:00:46
278500 -- [-1131.356] (-1127.792) (-1128.897) (-1129.008) * (-1131.184) (-1128.937) (-1130.799) [-1130.748] -- 0:00:46
279000 -- [-1128.830] (-1128.861) (-1129.590) (-1127.052) * (-1130.293) (-1130.136) (-1133.153) [-1127.551] -- 0:00:46
279500 -- (-1130.065) (-1128.760) (-1130.164) [-1129.530] * (-1130.868) [-1129.364] (-1130.742) (-1128.552) -- 0:00:46
280000 -- (-1131.662) (-1130.161) [-1128.537] (-1127.992) * [-1128.177] (-1128.248) (-1131.431) (-1129.018) -- 0:00:46
Average standard deviation of split frequencies: 0.016049
280500 -- [-1132.719] (-1128.123) (-1128.739) (-1127.945) * [-1129.274] (-1128.076) (-1128.311) (-1132.286) -- 0:00:46
281000 -- (-1129.917) [-1129.871] (-1130.502) (-1128.030) * (-1131.205) (-1129.036) [-1137.095] (-1131.379) -- 0:00:46
281500 -- (-1130.103) (-1129.619) (-1127.451) [-1128.532] * (-1134.728) [-1129.417] (-1137.279) (-1129.057) -- 0:00:45
282000 -- (-1128.764) (-1127.893) [-1127.136] (-1128.008) * (-1128.478) [-1130.181] (-1132.435) (-1128.889) -- 0:00:45
282500 -- (-1131.150) (-1128.032) (-1127.228) [-1128.117] * (-1128.310) (-1130.676) [-1130.900] (-1129.727) -- 0:00:45
283000 -- (-1129.954) (-1127.873) (-1127.509) [-1129.508] * (-1128.001) [-1128.082] (-1127.707) (-1128.517) -- 0:00:45
283500 -- [-1132.957] (-1127.442) (-1127.511) (-1129.285) * (-1132.433) [-1128.628] (-1127.810) (-1129.327) -- 0:00:45
284000 -- (-1130.726) (-1127.389) [-1127.120] (-1128.280) * (-1136.330) (-1131.604) [-1127.713] (-1130.312) -- 0:00:45
284500 -- (-1130.849) (-1128.231) [-1128.029] (-1128.996) * (-1128.871) [-1128.325] (-1127.652) (-1129.453) -- 0:00:45
285000 -- (-1129.354) (-1128.317) (-1131.614) [-1128.223] * [-1130.026] (-1129.345) (-1129.110) (-1127.420) -- 0:00:45
Average standard deviation of split frequencies: 0.015842
285500 -- (-1129.549) (-1128.447) (-1130.630) [-1129.396] * (-1131.159) [-1128.513] (-1128.972) (-1129.298) -- 0:00:45
286000 -- (-1127.839) (-1127.413) (-1127.835) [-1128.164] * [-1128.969] (-1131.972) (-1129.903) (-1130.928) -- 0:00:44
286500 -- (-1128.529) (-1130.683) (-1131.557) [-1130.113] * (-1129.608) [-1128.012] (-1129.982) (-1131.475) -- 0:00:44
287000 -- (-1130.321) [-1130.533] (-1133.716) (-1131.031) * [-1129.048] (-1128.979) (-1130.981) (-1128.771) -- 0:00:44
287500 -- (-1129.336) (-1131.664) [-1128.845] (-1128.052) * [-1128.209] (-1127.280) (-1130.416) (-1131.579) -- 0:00:44
288000 -- [-1130.951] (-1128.732) (-1130.351) (-1131.496) * (-1128.209) [-1128.712] (-1128.456) (-1131.971) -- 0:00:44
288500 -- (-1129.585) (-1129.897) (-1130.168) [-1127.696] * (-1130.052) (-1131.050) [-1129.997] (-1129.501) -- 0:00:44
289000 -- (-1132.837) (-1130.616) (-1129.850) [-1127.680] * (-1128.840) [-1131.751] (-1128.151) (-1128.424) -- 0:00:44
289500 -- (-1130.519) (-1130.786) [-1129.331] (-1127.356) * (-1128.711) (-1130.251) (-1129.185) [-1128.236] -- 0:00:44
290000 -- (-1128.724) [-1131.343] (-1128.331) (-1127.371) * (-1129.049) (-1128.519) [-1128.015] (-1128.348) -- 0:00:44
Average standard deviation of split frequencies: 0.016123
290500 -- (-1128.117) [-1128.624] (-1130.446) (-1127.104) * [-1128.779] (-1130.475) (-1128.256) (-1130.418) -- 0:00:46
291000 -- (-1128.923) (-1132.620) (-1128.889) [-1127.688] * (-1129.909) [-1131.017] (-1127.967) (-1129.164) -- 0:00:46
291500 -- [-1129.605] (-1128.795) (-1130.428) (-1127.688) * (-1128.387) [-1130.019] (-1132.843) (-1128.748) -- 0:00:46
292000 -- [-1130.442] (-1128.271) (-1128.319) (-1132.084) * (-1129.473) (-1128.267) [-1135.336] (-1128.829) -- 0:00:46
292500 -- (-1132.422) (-1128.978) (-1127.847) [-1132.243] * [-1129.579] (-1135.530) (-1131.474) (-1129.563) -- 0:00:45
293000 -- (-1129.075) [-1130.634] (-1129.018) (-1129.394) * (-1131.154) (-1135.412) (-1132.593) [-1128.609] -- 0:00:45
293500 -- (-1132.731) (-1127.470) [-1127.744] (-1131.456) * (-1129.080) [-1128.167] (-1132.084) (-1130.864) -- 0:00:45
294000 -- (-1129.775) (-1129.178) (-1130.231) [-1131.188] * [-1129.502] (-1129.293) (-1127.885) (-1130.905) -- 0:00:45
294500 -- [-1129.475] (-1130.136) (-1129.058) (-1132.831) * (-1130.910) (-1129.393) [-1131.290] (-1128.483) -- 0:00:45
295000 -- (-1133.585) [-1130.339] (-1131.102) (-1130.277) * (-1128.295) (-1128.219) [-1128.159] (-1128.485) -- 0:00:45
Average standard deviation of split frequencies: 0.015738
295500 -- (-1131.846) (-1127.334) (-1131.059) [-1129.280] * (-1132.102) [-1129.176] (-1129.025) (-1127.997) -- 0:00:45
296000 -- (-1133.448) [-1128.154] (-1128.849) (-1129.492) * (-1128.970) (-1131.246) [-1129.399] (-1127.854) -- 0:00:45
296500 -- (-1129.802) [-1127.194] (-1128.849) (-1131.004) * (-1128.679) [-1129.170] (-1129.547) (-1127.963) -- 0:00:45
297000 -- [-1128.204] (-1131.134) (-1129.029) (-1129.552) * (-1132.355) (-1130.239) (-1129.918) [-1127.752] -- 0:00:44
297500 -- (-1128.300) (-1129.114) [-1128.947] (-1128.248) * [-1130.754] (-1130.071) (-1131.495) (-1128.960) -- 0:00:44
298000 -- (-1128.203) (-1129.295) [-1128.398] (-1130.921) * (-1129.727) [-1129.622] (-1132.227) (-1132.987) -- 0:00:44
298500 -- [-1127.311] (-1129.139) (-1128.509) (-1129.960) * [-1128.346] (-1128.060) (-1128.827) (-1132.842) -- 0:00:44
299000 -- [-1127.432] (-1127.645) (-1127.805) (-1130.046) * [-1128.280] (-1131.916) (-1128.956) (-1131.866) -- 0:00:44
299500 -- (-1134.671) (-1128.026) (-1131.158) [-1128.794] * (-1128.401) [-1129.780] (-1129.474) (-1129.357) -- 0:00:44
300000 -- [-1133.378] (-1128.642) (-1129.497) (-1128.310) * (-1128.673) (-1134.291) [-1135.455] (-1128.483) -- 0:00:44
Average standard deviation of split frequencies: 0.014756
300500 -- (-1130.053) (-1133.167) [-1130.804] (-1133.829) * (-1128.433) [-1129.066] (-1130.436) (-1131.942) -- 0:00:44
301000 -- (-1127.798) [-1133.144] (-1129.928) (-1130.405) * [-1130.352] (-1129.449) (-1136.759) (-1131.036) -- 0:00:44
301500 -- (-1131.347) (-1132.774) [-1132.912] (-1127.719) * (-1130.079) (-1128.464) (-1130.794) [-1128.945] -- 0:00:44
302000 -- (-1129.762) [-1127.726] (-1127.247) (-1127.603) * [-1130.423] (-1128.212) (-1129.155) (-1130.776) -- 0:00:43
302500 -- (-1127.993) [-1128.415] (-1129.938) (-1128.428) * (-1130.841) (-1128.943) [-1129.385] (-1130.461) -- 0:00:43
303000 -- (-1131.681) (-1130.026) [-1131.350] (-1128.241) * (-1128.977) [-1127.325] (-1131.961) (-1128.675) -- 0:00:43
303500 -- (-1127.686) (-1129.196) (-1131.667) [-1128.516] * [-1127.799] (-1129.466) (-1130.440) (-1129.033) -- 0:00:43
304000 -- (-1127.858) (-1128.754) [-1130.127] (-1131.784) * (-1128.191) [-1128.183] (-1128.572) (-1131.179) -- 0:00:43
304500 -- (-1130.909) (-1127.467) (-1127.822) [-1127.140] * (-1129.172) (-1128.649) [-1129.163] (-1129.542) -- 0:00:43
305000 -- (-1130.889) (-1127.788) (-1128.498) [-1129.912] * [-1129.451] (-1129.796) (-1128.136) (-1127.324) -- 0:00:43
Average standard deviation of split frequencies: 0.014952
305500 -- (-1130.142) [-1127.387] (-1128.628) (-1130.796) * (-1131.512) (-1129.950) [-1128.027] (-1127.874) -- 0:00:43
306000 -- (-1129.433) (-1129.062) (-1131.254) [-1128.621] * (-1128.656) (-1130.037) (-1128.440) [-1130.403] -- 0:00:43
306500 -- (-1129.066) (-1128.195) [-1133.376] (-1131.028) * (-1129.956) [-1127.726] (-1128.012) (-1134.628) -- 0:00:42
307000 -- (-1130.881) (-1132.421) (-1131.132) [-1130.085] * [-1126.994] (-1129.996) (-1127.401) (-1130.177) -- 0:00:45
307500 -- (-1130.456) (-1131.085) [-1130.965] (-1131.888) * (-1128.030) (-1133.057) (-1127.982) [-1129.977] -- 0:00:45
308000 -- [-1129.682] (-1131.362) (-1128.089) (-1131.156) * [-1131.917] (-1129.340) (-1130.717) (-1131.834) -- 0:00:44
308500 -- (-1129.419) (-1132.744) [-1130.162] (-1129.379) * [-1128.079] (-1127.795) (-1129.750) (-1128.406) -- 0:00:44
309000 -- (-1127.680) (-1131.721) (-1131.482) [-1127.272] * (-1128.511) (-1135.350) [-1128.942] (-1128.319) -- 0:00:44
309500 -- (-1128.851) (-1131.456) (-1128.653) [-1128.092] * (-1128.696) (-1130.618) [-1128.216] (-1129.793) -- 0:00:44
310000 -- (-1130.898) [-1128.731] (-1132.588) (-1129.642) * (-1132.139) [-1129.031] (-1129.245) (-1130.521) -- 0:00:44
Average standard deviation of split frequencies: 0.014460
310500 -- (-1130.930) (-1128.904) (-1131.282) [-1128.386] * (-1134.392) (-1128.628) (-1132.927) [-1131.395] -- 0:00:44
311000 -- (-1128.910) (-1133.687) (-1128.506) [-1130.624] * (-1131.579) [-1128.191] (-1128.730) (-1133.925) -- 0:00:44
311500 -- (-1131.434) [-1130.716] (-1129.411) (-1131.954) * [-1130.610] (-1129.535) (-1128.663) (-1132.987) -- 0:00:44
312000 -- [-1129.460] (-1128.712) (-1128.073) (-1128.001) * (-1127.822) (-1129.207) [-1128.835] (-1131.347) -- 0:00:44
312500 -- (-1129.387) [-1127.948] (-1129.563) (-1132.061) * [-1127.663] (-1130.419) (-1129.550) (-1129.999) -- 0:00:44
313000 -- (-1129.814) (-1129.205) [-1128.949] (-1127.723) * (-1129.106) (-1130.756) [-1128.131] (-1129.223) -- 0:00:43
313500 -- [-1129.630] (-1129.767) (-1128.999) (-1131.099) * [-1130.161] (-1129.023) (-1128.328) (-1131.109) -- 0:00:43
314000 -- (-1129.358) (-1133.675) [-1130.005] (-1127.351) * (-1130.348) (-1128.126) (-1129.336) [-1128.342] -- 0:00:43
314500 -- [-1130.440] (-1131.583) (-1131.453) (-1129.195) * (-1131.798) [-1128.680] (-1131.824) (-1130.834) -- 0:00:43
315000 -- [-1131.884] (-1129.625) (-1129.892) (-1129.266) * (-1129.829) [-1129.990] (-1130.155) (-1129.792) -- 0:00:43
Average standard deviation of split frequencies: 0.014304
315500 -- (-1127.973) (-1130.287) [-1133.106] (-1129.964) * (-1128.964) [-1130.632] (-1130.884) (-1128.717) -- 0:00:43
316000 -- (-1129.016) [-1127.745] (-1133.014) (-1129.974) * (-1130.109) [-1127.716] (-1127.343) (-1132.415) -- 0:00:43
316500 -- [-1128.870] (-1129.904) (-1129.157) (-1133.848) * (-1128.600) (-1128.798) (-1127.239) [-1135.049] -- 0:00:43
317000 -- (-1128.244) (-1129.166) [-1127.809] (-1129.385) * (-1128.277) (-1131.792) (-1127.810) [-1129.150] -- 0:00:43
317500 -- (-1127.158) (-1129.288) [-1127.071] (-1131.469) * (-1129.670) [-1128.375] (-1129.195) (-1130.201) -- 0:00:42
318000 -- (-1130.680) (-1130.143) [-1129.004] (-1127.884) * [-1128.724] (-1127.800) (-1130.500) (-1131.144) -- 0:00:42
318500 -- (-1129.245) [-1130.154] (-1127.707) (-1129.370) * (-1129.062) [-1128.303] (-1129.284) (-1128.129) -- 0:00:42
319000 -- (-1129.104) (-1129.869) (-1127.077) [-1134.302] * (-1127.900) (-1132.862) [-1127.904] (-1132.688) -- 0:00:42
319500 -- (-1129.653) [-1129.474] (-1129.872) (-1129.102) * (-1129.670) (-1130.103) (-1127.903) [-1131.331] -- 0:00:42
320000 -- (-1131.211) (-1132.907) [-1127.215] (-1130.521) * (-1128.368) (-1130.604) (-1127.187) [-1131.941] -- 0:00:42
Average standard deviation of split frequencies: 0.013750
320500 -- (-1132.582) [-1130.029] (-1128.379) (-1131.379) * [-1129.369] (-1128.679) (-1130.240) (-1133.020) -- 0:00:42
321000 -- (-1130.908) [-1128.010] (-1127.548) (-1128.524) * (-1128.715) [-1128.091] (-1128.315) (-1131.560) -- 0:00:42
321500 -- (-1130.540) [-1128.013] (-1128.777) (-1128.629) * (-1129.936) (-1128.135) (-1129.447) [-1130.292] -- 0:00:42
322000 -- (-1129.970) [-1127.967] (-1129.269) (-1131.122) * (-1130.795) (-1129.179) (-1130.001) [-1131.619] -- 0:00:42
322500 -- (-1128.109) (-1129.110) (-1130.184) [-1130.774] * (-1128.329) (-1133.238) (-1128.195) [-1130.347] -- 0:00:42
323000 -- (-1127.880) (-1131.015) (-1131.755) [-1130.431] * (-1128.474) (-1131.092) [-1129.457] (-1130.777) -- 0:00:41
323500 -- (-1128.523) (-1131.768) [-1130.364] (-1128.697) * (-1132.991) (-1133.707) [-1128.442] (-1129.955) -- 0:00:43
324000 -- (-1128.499) [-1127.726] (-1129.957) (-1129.281) * (-1130.697) (-1129.294) (-1128.366) [-1131.148] -- 0:00:43
324500 -- (-1129.230) (-1129.954) [-1128.380] (-1128.488) * (-1127.887) (-1131.469) [-1127.383] (-1129.775) -- 0:00:43
325000 -- (-1129.751) (-1130.517) (-1128.469) [-1130.230] * (-1129.019) [-1130.109] (-1129.886) (-1129.063) -- 0:00:43
Average standard deviation of split frequencies: 0.013440
325500 -- (-1129.345) [-1128.301] (-1128.469) (-1128.005) * (-1128.215) [-1128.243] (-1134.238) (-1129.199) -- 0:00:43
326000 -- (-1130.043) (-1129.131) [-1127.952] (-1127.813) * [-1129.923] (-1127.562) (-1128.130) (-1128.772) -- 0:00:43
326500 -- (-1131.650) (-1129.197) [-1127.158] (-1128.488) * (-1128.752) (-1131.563) (-1131.777) [-1128.134] -- 0:00:43
327000 -- (-1132.480) (-1130.112) (-1131.757) [-1128.655] * (-1128.926) [-1127.560] (-1128.919) (-1127.592) -- 0:00:43
327500 -- (-1129.537) (-1128.134) [-1131.428] (-1128.457) * (-1128.372) (-1127.518) (-1130.801) [-1127.337] -- 0:00:43
328000 -- (-1129.630) (-1128.879) (-1133.786) [-1128.188] * (-1128.350) [-1127.628] (-1134.186) (-1128.521) -- 0:00:43
328500 -- (-1129.411) (-1129.003) (-1130.476) [-1130.337] * [-1132.064] (-1128.731) (-1129.893) (-1127.655) -- 0:00:42
329000 -- (-1128.492) (-1128.962) [-1128.639] (-1129.437) * [-1132.494] (-1127.166) (-1129.931) (-1127.737) -- 0:00:42
329500 -- (-1129.908) (-1128.348) (-1133.124) [-1129.832] * (-1127.310) (-1129.014) [-1128.165] (-1129.033) -- 0:00:42
330000 -- [-1130.559] (-1128.322) (-1128.523) (-1131.486) * (-1129.025) [-1127.465] (-1127.836) (-1128.135) -- 0:00:42
Average standard deviation of split frequencies: 0.013166
330500 -- (-1132.299) (-1128.131) [-1130.067] (-1132.417) * (-1130.485) [-1127.618] (-1128.368) (-1129.174) -- 0:00:42
331000 -- (-1135.884) (-1127.727) (-1131.979) [-1129.896] * (-1127.985) [-1127.963] (-1127.558) (-1130.443) -- 0:00:42
331500 -- (-1133.996) (-1131.877) [-1132.112] (-1129.835) * (-1128.976) (-1131.333) (-1129.463) [-1130.261] -- 0:00:42
332000 -- (-1129.942) (-1129.301) (-1130.861) [-1128.788] * (-1127.734) (-1132.343) [-1129.207] (-1129.055) -- 0:00:42
332500 -- (-1130.582) [-1128.533] (-1132.515) (-1128.819) * (-1127.093) (-1132.749) (-1130.379) [-1128.886] -- 0:00:42
333000 -- (-1134.131) (-1128.005) (-1133.280) [-1127.534] * (-1128.431) [-1128.416] (-1138.499) (-1131.269) -- 0:00:42
333500 -- (-1134.178) (-1133.028) (-1129.382) [-1129.646] * [-1134.332] (-1128.548) (-1129.734) (-1128.728) -- 0:00:41
334000 -- (-1132.904) (-1133.106) [-1130.330] (-1128.446) * [-1128.397] (-1127.147) (-1134.738) (-1130.365) -- 0:00:41
334500 -- (-1129.837) [-1127.135] (-1128.838) (-1129.298) * (-1127.799) (-1127.637) (-1135.342) [-1127.441] -- 0:00:41
335000 -- [-1131.008] (-1130.423) (-1128.561) (-1128.972) * (-1127.469) (-1128.177) (-1130.533) [-1130.713] -- 0:00:41
Average standard deviation of split frequencies: 0.013617
335500 -- (-1129.813) [-1128.588] (-1129.985) (-1132.057) * (-1129.892) (-1135.653) (-1129.627) [-1128.151] -- 0:00:41
336000 -- [-1128.989] (-1128.166) (-1129.914) (-1128.192) * (-1130.106) (-1129.660) (-1128.657) [-1127.460] -- 0:00:41
336500 -- (-1132.620) (-1129.964) (-1129.531) [-1129.425] * (-1131.007) (-1127.071) (-1128.457) [-1133.509] -- 0:00:41
337000 -- [-1131.785] (-1132.718) (-1127.049) (-1130.910) * (-1130.941) (-1126.949) (-1128.497) [-1130.582] -- 0:00:41
337500 -- (-1130.741) (-1129.105) (-1127.257) [-1129.318] * (-1130.741) (-1128.292) [-1127.366] (-1129.516) -- 0:00:41
338000 -- [-1127.655] (-1132.461) (-1128.343) (-1129.307) * (-1130.920) [-1127.374] (-1128.140) (-1131.357) -- 0:00:41
338500 -- (-1127.662) [-1131.152] (-1127.092) (-1131.812) * (-1128.439) [-1129.498] (-1128.493) (-1127.915) -- 0:00:41
339000 -- (-1129.320) (-1130.731) [-1127.360] (-1131.653) * (-1129.644) [-1131.097] (-1129.240) (-1132.066) -- 0:00:40
339500 -- [-1128.425] (-1129.718) (-1127.202) (-1129.409) * (-1133.168) (-1127.816) [-1131.575] (-1129.564) -- 0:00:42
340000 -- (-1131.098) (-1129.401) [-1127.446] (-1131.363) * (-1132.091) (-1129.095) (-1132.354) [-1129.450] -- 0:00:42
Average standard deviation of split frequencies: 0.012373
340500 -- (-1131.507) (-1128.087) (-1128.183) [-1130.093] * [-1132.621] (-1128.639) (-1130.407) (-1129.737) -- 0:00:42
341000 -- [-1130.533] (-1128.087) (-1127.277) (-1131.473) * (-1127.734) [-1129.823] (-1130.027) (-1132.707) -- 0:00:42
341500 -- (-1132.229) (-1128.824) [-1130.097] (-1129.243) * (-1127.471) [-1128.600] (-1130.337) (-1130.793) -- 0:00:42
342000 -- (-1132.275) [-1127.623] (-1131.403) (-1128.570) * (-1128.432) (-1129.369) (-1130.822) [-1127.898] -- 0:00:42
342500 -- (-1128.005) [-1127.788] (-1131.636) (-1127.312) * (-1128.165) (-1130.991) (-1129.004) [-1128.953] -- 0:00:42
343000 -- (-1129.715) [-1129.778] (-1137.992) (-1127.580) * (-1128.063) (-1131.509) (-1129.480) [-1128.322] -- 0:00:42
343500 -- (-1129.362) (-1131.469) [-1131.414] (-1129.697) * [-1128.385] (-1127.857) (-1129.215) (-1128.575) -- 0:00:42
344000 -- [-1129.002] (-1130.689) (-1131.045) (-1129.271) * [-1127.727] (-1128.240) (-1133.958) (-1129.662) -- 0:00:41
344500 -- (-1128.108) [-1129.489] (-1130.465) (-1127.453) * (-1127.330) (-1135.401) [-1134.172] (-1129.513) -- 0:00:41
345000 -- (-1128.737) (-1128.744) (-1130.713) [-1129.514] * (-1128.203) [-1128.516] (-1128.764) (-1129.395) -- 0:00:41
Average standard deviation of split frequencies: 0.013464
345500 -- [-1130.132] (-1130.940) (-1128.996) (-1127.258) * (-1128.248) [-1128.766] (-1131.886) (-1129.095) -- 0:00:41
346000 -- (-1128.188) (-1133.808) [-1129.994] (-1128.739) * (-1133.031) (-1129.319) [-1130.252] (-1128.631) -- 0:00:41
346500 -- (-1127.718) (-1131.987) (-1128.231) [-1128.008] * [-1128.617] (-1128.611) (-1132.848) (-1128.839) -- 0:00:41
347000 -- (-1131.678) (-1130.938) (-1126.947) [-1127.797] * (-1131.324) (-1131.527) [-1130.745] (-1130.651) -- 0:00:41
347500 -- (-1129.397) (-1128.861) [-1128.896] (-1128.323) * (-1131.989) [-1130.590] (-1128.660) (-1130.518) -- 0:00:41
348000 -- [-1131.744] (-1130.146) (-1132.008) (-1128.400) * (-1129.977) (-1132.041) (-1128.309) [-1129.468] -- 0:00:41
348500 -- (-1129.004) (-1128.480) [-1128.021] (-1127.734) * (-1131.830) (-1130.539) [-1127.710] (-1128.016) -- 0:00:41
349000 -- (-1131.754) (-1128.170) (-1130.921) [-1127.720] * [-1135.020] (-1127.533) (-1132.282) (-1129.047) -- 0:00:41
349500 -- (-1128.430) [-1129.558] (-1128.537) (-1127.813) * (-1132.138) [-1128.748] (-1132.239) (-1129.067) -- 0:00:40
350000 -- [-1130.252] (-1132.028) (-1128.937) (-1127.820) * (-1132.626) (-1127.756) [-1133.262] (-1127.580) -- 0:00:40
Average standard deviation of split frequencies: 0.013206
350500 -- [-1130.121] (-1130.513) (-1129.535) (-1127.841) * (-1133.532) [-1127.756] (-1129.785) (-1128.923) -- 0:00:40
351000 -- (-1128.326) (-1129.470) [-1129.803] (-1129.293) * (-1130.539) [-1127.520] (-1127.972) (-1128.766) -- 0:00:40
351500 -- (-1128.684) [-1127.974] (-1131.938) (-1130.649) * (-1128.053) (-1127.519) (-1127.594) [-1129.792] -- 0:00:40
352000 -- [-1128.492] (-1128.316) (-1130.326) (-1130.849) * (-1127.629) (-1129.377) [-1128.699] (-1130.278) -- 0:00:40
352500 -- [-1131.368] (-1129.500) (-1129.587) (-1128.322) * (-1130.071) (-1127.580) [-1128.185] (-1131.418) -- 0:00:40
353000 -- (-1129.512) [-1128.416] (-1129.257) (-1130.500) * (-1131.457) (-1132.386) [-1127.306] (-1128.899) -- 0:00:40
353500 -- [-1128.893] (-1128.613) (-1128.713) (-1131.624) * (-1128.876) (-1130.224) (-1128.795) [-1129.047] -- 0:00:40
354000 -- [-1128.046] (-1135.337) (-1128.287) (-1138.202) * (-1129.504) [-1131.801] (-1131.280) (-1129.357) -- 0:00:40
354500 -- [-1127.764] (-1128.732) (-1131.848) (-1127.681) * (-1129.525) (-1135.787) (-1131.710) [-1128.464] -- 0:00:40
355000 -- (-1128.323) [-1129.831] (-1136.067) (-1128.273) * (-1130.906) [-1135.079] (-1131.153) (-1128.098) -- 0:00:39
Average standard deviation of split frequencies: 0.012930
355500 -- (-1128.293) [-1129.344] (-1129.349) (-1128.867) * (-1132.557) (-1129.982) (-1130.032) [-1127.768] -- 0:00:41
356000 -- (-1127.250) (-1129.291) (-1130.424) [-1128.973] * (-1134.628) (-1127.468) (-1131.541) [-1127.469] -- 0:00:41
356500 -- (-1129.456) (-1131.325) [-1131.112] (-1133.248) * (-1132.560) [-1128.956] (-1131.783) (-1128.793) -- 0:00:41
357000 -- (-1130.729) (-1130.993) [-1130.182] (-1128.430) * (-1132.314) (-1129.426) (-1134.885) [-1127.748] -- 0:00:41
357500 -- (-1129.700) (-1130.391) [-1128.254] (-1128.067) * [-1133.948] (-1129.256) (-1134.515) (-1129.458) -- 0:00:41
358000 -- [-1127.929] (-1129.366) (-1128.448) (-1132.690) * (-1131.035) (-1133.521) [-1135.077] (-1130.295) -- 0:00:41
358500 -- (-1128.456) (-1131.305) [-1130.459] (-1127.768) * [-1128.192] (-1128.996) (-1129.543) (-1135.395) -- 0:00:41
359000 -- (-1128.612) [-1131.900] (-1130.459) (-1127.081) * (-1129.913) (-1131.315) [-1132.640] (-1135.433) -- 0:00:41
359500 -- (-1130.668) [-1130.369] (-1130.947) (-1127.027) * [-1128.962] (-1132.090) (-1129.205) (-1130.554) -- 0:00:40
360000 -- (-1129.307) [-1129.565] (-1129.660) (-1129.766) * [-1127.137] (-1128.927) (-1129.041) (-1128.225) -- 0:00:40
Average standard deviation of split frequencies: 0.012071
360500 -- (-1131.367) (-1131.851) (-1128.965) [-1128.100] * (-1127.589) (-1129.767) (-1128.171) [-1129.326] -- 0:00:40
361000 -- (-1127.834) (-1127.425) [-1129.792] (-1127.994) * (-1130.123) (-1128.982) (-1128.146) [-1130.280] -- 0:00:40
361500 -- (-1132.055) [-1128.066] (-1130.797) (-1128.054) * (-1130.202) (-1128.590) [-1127.325] (-1128.774) -- 0:00:40
362000 -- [-1134.687] (-1132.502) (-1131.031) (-1128.439) * [-1128.664] (-1128.564) (-1130.431) (-1130.751) -- 0:00:40
362500 -- (-1130.071) (-1133.813) [-1129.447] (-1127.567) * (-1127.483) [-1130.104] (-1130.976) (-1130.461) -- 0:00:40
363000 -- [-1132.066] (-1132.235) (-1129.407) (-1128.396) * (-1129.455) (-1132.472) (-1131.555) [-1128.688] -- 0:00:40
363500 -- (-1129.238) (-1134.319) [-1128.633] (-1129.234) * [-1130.339] (-1129.167) (-1133.002) (-1128.238) -- 0:00:40
364000 -- [-1128.499] (-1129.091) (-1127.715) (-1127.994) * (-1130.939) (-1129.661) (-1130.235) [-1128.571] -- 0:00:40
364500 -- (-1129.010) (-1127.996) (-1131.345) [-1126.868] * (-1128.769) (-1129.754) (-1132.346) [-1128.317] -- 0:00:40
365000 -- (-1130.021) (-1128.662) (-1131.464) [-1127.732] * [-1128.066] (-1128.395) (-1128.725) (-1127.766) -- 0:00:40
Average standard deviation of split frequencies: 0.011592
365500 -- (-1130.552) [-1127.879] (-1134.306) (-1127.848) * [-1128.836] (-1129.221) (-1129.803) (-1128.013) -- 0:00:39
366000 -- (-1131.594) [-1128.305] (-1127.951) (-1131.712) * [-1128.805] (-1129.761) (-1132.618) (-1127.262) -- 0:00:39
366500 -- [-1132.101] (-1127.454) (-1129.167) (-1128.594) * (-1128.050) (-1129.383) [-1129.351] (-1130.173) -- 0:00:39
367000 -- (-1128.323) (-1127.441) [-1128.711] (-1128.807) * (-1128.149) (-1128.584) (-1129.549) [-1129.941] -- 0:00:39
367500 -- [-1129.706] (-1128.150) (-1132.353) (-1127.501) * (-1128.388) [-1129.140] (-1128.064) (-1132.216) -- 0:00:39
368000 -- (-1128.775) (-1128.982) [-1132.346] (-1127.613) * (-1127.769) [-1128.127] (-1127.698) (-1132.429) -- 0:00:39
368500 -- (-1130.102) (-1131.388) [-1129.566] (-1127.734) * (-1129.833) [-1127.460] (-1129.368) (-1129.348) -- 0:00:39
369000 -- (-1129.381) [-1129.173] (-1129.990) (-1129.893) * (-1129.423) (-1132.564) [-1127.524] (-1128.538) -- 0:00:39
369500 -- (-1129.644) (-1129.502) [-1129.532] (-1129.503) * (-1131.950) (-1130.410) (-1129.056) [-1127.608] -- 0:00:39
370000 -- (-1129.124) [-1128.504] (-1129.215) (-1132.787) * (-1129.340) (-1128.441) [-1130.379] (-1128.120) -- 0:00:39
Average standard deviation of split frequencies: 0.011670
370500 -- (-1129.344) (-1128.505) [-1127.242] (-1128.176) * (-1127.928) [-1129.411] (-1129.010) (-1128.048) -- 0:00:39
371000 -- (-1131.692) (-1128.418) (-1129.465) [-1128.482] * (-1127.926) (-1129.558) (-1131.928) [-1128.321] -- 0:00:38
371500 -- (-1129.516) [-1131.858] (-1128.531) (-1140.455) * (-1128.224) [-1132.385] (-1130.895) (-1129.494) -- 0:00:38
372000 -- (-1128.180) [-1128.956] (-1128.160) (-1133.527) * (-1127.943) (-1127.994) (-1131.210) [-1127.931] -- 0:00:40
372500 -- [-1129.221] (-1127.881) (-1127.033) (-1131.480) * (-1127.479) [-1127.258] (-1130.050) (-1128.662) -- 0:00:40
373000 -- [-1132.031] (-1128.378) (-1128.377) (-1133.058) * (-1128.003) (-1128.234) [-1129.362] (-1129.175) -- 0:00:40
373500 -- (-1131.468) (-1127.904) (-1128.251) [-1131.875] * (-1132.468) (-1131.960) [-1129.868] (-1128.540) -- 0:00:40
374000 -- (-1129.061) (-1128.488) [-1127.834] (-1127.997) * (-1132.810) (-1130.553) [-1130.740] (-1132.026) -- 0:00:40
374500 -- [-1130.130] (-1128.867) (-1129.050) (-1127.132) * (-1130.003) (-1128.211) [-1130.405] (-1129.727) -- 0:00:40
375000 -- [-1129.390] (-1127.716) (-1135.733) (-1130.319) * (-1133.152) [-1130.290] (-1139.135) (-1130.170) -- 0:00:40
Average standard deviation of split frequencies: 0.011136
375500 -- (-1127.588) [-1129.193] (-1132.703) (-1133.730) * (-1129.541) (-1128.089) (-1130.004) [-1131.824] -- 0:00:39
376000 -- [-1132.574] (-1131.451) (-1133.769) (-1127.921) * (-1130.283) (-1131.302) (-1132.980) [-1130.095] -- 0:00:39
376500 -- (-1132.552) (-1131.718) (-1129.579) [-1129.610] * [-1130.036] (-1128.893) (-1130.747) (-1128.371) -- 0:00:39
377000 -- [-1133.177] (-1131.635) (-1134.956) (-1129.540) * (-1132.052) [-1129.286] (-1130.283) (-1128.272) -- 0:00:39
377500 -- [-1127.632] (-1128.843) (-1129.767) (-1128.325) * (-1132.245) [-1131.484] (-1128.647) (-1134.399) -- 0:00:39
378000 -- (-1127.527) [-1131.796] (-1135.163) (-1127.176) * (-1131.052) (-1129.895) [-1128.801] (-1127.696) -- 0:00:39
378500 -- (-1127.891) (-1129.048) (-1131.364) [-1128.694] * [-1134.608] (-1130.796) (-1130.863) (-1127.454) -- 0:00:39
379000 -- [-1127.287] (-1131.512) (-1128.060) (-1127.695) * (-1127.871) [-1129.500] (-1128.293) (-1129.739) -- 0:00:39
379500 -- (-1128.046) (-1131.697) [-1131.116] (-1128.208) * (-1128.930) (-1128.715) [-1128.834] (-1129.483) -- 0:00:39
380000 -- (-1128.623) (-1130.921) [-1131.334] (-1129.065) * (-1128.167) (-1129.742) [-1128.489] (-1131.008) -- 0:00:39
Average standard deviation of split frequencies: 0.012019
380500 -- (-1128.363) (-1129.286) [-1129.495] (-1128.000) * (-1128.032) [-1128.238] (-1130.301) (-1128.988) -- 0:00:39
381000 -- (-1127.244) (-1130.000) (-1130.465) [-1132.143] * [-1131.083] (-1131.664) (-1129.586) (-1131.268) -- 0:00:38
381500 -- [-1128.920] (-1131.414) (-1130.223) (-1128.042) * [-1132.009] (-1129.157) (-1130.055) (-1132.794) -- 0:00:38
382000 -- [-1131.461] (-1129.658) (-1128.022) (-1130.842) * [-1127.286] (-1128.464) (-1129.021) (-1127.425) -- 0:00:38
382500 -- (-1128.621) [-1129.393] (-1128.156) (-1127.404) * [-1128.306] (-1130.108) (-1127.550) (-1128.387) -- 0:00:38
383000 -- (-1129.839) (-1128.666) [-1131.161] (-1129.050) * (-1130.000) (-1132.326) [-1128.074] (-1130.247) -- 0:00:38
383500 -- (-1130.150) (-1127.865) [-1132.690] (-1128.918) * (-1132.356) [-1127.905] (-1128.085) (-1129.588) -- 0:00:38
384000 -- (-1128.945) [-1130.770] (-1129.736) (-1128.762) * [-1127.960] (-1126.903) (-1128.160) (-1129.639) -- 0:00:38
384500 -- (-1128.535) (-1128.677) (-1129.713) [-1130.244] * (-1130.555) (-1129.101) [-1127.693] (-1131.699) -- 0:00:38
385000 -- [-1131.405] (-1129.057) (-1131.147) (-1134.098) * (-1128.245) (-1129.040) (-1128.832) [-1130.200] -- 0:00:38
Average standard deviation of split frequencies: 0.011063
385500 -- [-1128.004] (-1129.958) (-1127.942) (-1131.171) * (-1128.638) (-1129.526) (-1128.569) [-1130.200] -- 0:00:38
386000 -- (-1129.190) (-1127.528) (-1127.935) [-1128.270] * (-1132.323) (-1130.073) [-1130.981] (-1129.090) -- 0:00:38
386500 -- (-1128.456) (-1128.069) (-1128.082) [-1129.049] * (-1130.800) (-1128.410) (-1132.419) [-1129.639] -- 0:00:38
387000 -- (-1130.505) (-1128.870) [-1128.084] (-1129.545) * (-1131.041) [-1127.606] (-1132.259) (-1129.409) -- 0:00:38
387500 -- (-1131.501) [-1127.016] (-1131.023) (-1127.823) * (-1128.710) [-1127.473] (-1131.396) (-1130.628) -- 0:00:37
388000 -- (-1129.465) [-1128.900] (-1130.332) (-1129.528) * (-1129.296) [-1128.667] (-1130.323) (-1134.163) -- 0:00:39
388500 -- (-1130.161) (-1128.905) (-1130.910) [-1128.365] * (-1129.355) (-1128.910) [-1130.761] (-1129.795) -- 0:00:39
389000 -- (-1130.421) (-1129.179) [-1132.236] (-1131.303) * (-1129.849) (-1129.634) [-1132.541] (-1131.800) -- 0:00:39
389500 -- (-1130.755) (-1130.345) [-1131.048] (-1127.614) * (-1128.587) [-1130.287] (-1130.155) (-1131.980) -- 0:00:39
390000 -- [-1130.867] (-1128.443) (-1130.376) (-1128.403) * (-1128.388) [-1128.130] (-1130.504) (-1132.693) -- 0:00:39
Average standard deviation of split frequencies: 0.010647
390500 -- (-1130.512) (-1129.346) [-1129.375] (-1128.355) * (-1128.187) (-1127.553) (-1130.793) [-1127.598] -- 0:00:39
391000 -- (-1128.947) (-1128.995) [-1128.909] (-1128.412) * [-1127.834] (-1133.406) (-1129.507) (-1128.635) -- 0:00:38
391500 -- (-1129.375) (-1130.463) [-1131.872] (-1136.936) * (-1128.082) (-1132.635) [-1128.506] (-1128.451) -- 0:00:38
392000 -- (-1128.585) (-1128.882) (-1131.135) [-1130.827] * (-1127.958) (-1134.433) [-1127.546] (-1130.022) -- 0:00:38
392500 -- (-1129.830) (-1128.433) [-1127.234] (-1129.106) * (-1130.284) (-1128.268) [-1129.893] (-1133.913) -- 0:00:38
393000 -- (-1130.730) [-1127.902] (-1128.099) (-1129.101) * (-1128.264) (-1134.188) (-1128.308) [-1130.521] -- 0:00:38
393500 -- (-1128.658) [-1128.287] (-1129.796) (-1130.670) * [-1127.482] (-1127.908) (-1128.308) (-1131.074) -- 0:00:38
394000 -- [-1132.272] (-1131.270) (-1133.529) (-1133.430) * [-1132.631] (-1127.345) (-1130.489) (-1133.825) -- 0:00:38
394500 -- [-1127.745] (-1134.707) (-1132.296) (-1130.479) * (-1132.500) (-1130.604) (-1128.772) [-1131.005] -- 0:00:38
395000 -- (-1128.925) (-1131.342) (-1130.142) [-1130.418] * (-1130.802) (-1128.713) [-1128.373] (-1130.694) -- 0:00:38
Average standard deviation of split frequencies: 0.011134
395500 -- (-1128.859) (-1131.318) (-1127.667) [-1128.159] * (-1129.833) (-1130.758) [-1128.792] (-1134.320) -- 0:00:38
396000 -- (-1128.050) [-1128.954] (-1127.766) (-1131.336) * (-1128.771) [-1128.262] (-1130.105) (-1128.887) -- 0:00:38
396500 -- (-1131.272) (-1129.932) [-1128.377] (-1127.770) * [-1129.373] (-1129.483) (-1131.313) (-1128.485) -- 0:00:38
397000 -- (-1129.711) (-1128.774) (-1128.250) [-1127.247] * (-1131.322) (-1132.995) (-1129.606) [-1127.407] -- 0:00:37
397500 -- (-1130.046) (-1128.297) [-1131.754] (-1127.236) * (-1131.221) (-1133.825) (-1127.804) [-1128.457] -- 0:00:37
398000 -- (-1133.856) [-1128.439] (-1127.745) (-1131.971) * (-1130.308) [-1128.239] (-1128.087) (-1128.548) -- 0:00:37
398500 -- [-1127.770] (-1127.560) (-1130.456) (-1132.332) * (-1129.540) (-1127.987) [-1129.162] (-1129.647) -- 0:00:37
399000 -- (-1129.134) (-1128.363) (-1129.247) [-1130.672] * (-1131.314) (-1132.573) [-1128.880] (-1135.484) -- 0:00:37
399500 -- (-1128.446) [-1127.766] (-1128.851) (-1131.278) * (-1130.476) [-1130.398] (-1128.811) (-1129.242) -- 0:00:37
400000 -- (-1128.353) (-1128.455) [-1128.559] (-1132.229) * [-1129.209] (-1127.059) (-1131.033) (-1128.169) -- 0:00:37
Average standard deviation of split frequencies: 0.010935
400500 -- (-1128.376) (-1127.923) [-1129.215] (-1129.855) * (-1127.953) (-1129.688) (-1134.067) [-1127.796] -- 0:00:37
401000 -- (-1128.902) [-1127.616] (-1127.963) (-1128.843) * [-1127.625] (-1128.810) (-1127.595) (-1128.928) -- 0:00:37
401500 -- (-1128.515) (-1128.512) [-1128.810] (-1129.463) * (-1127.891) (-1132.924) [-1127.825] (-1127.710) -- 0:00:37
402000 -- [-1132.608] (-1127.987) (-1127.337) (-1129.437) * [-1128.731] (-1127.652) (-1131.437) (-1128.119) -- 0:00:37
402500 -- (-1128.339) (-1128.176) (-1128.735) [-1130.474] * (-1128.055) (-1130.143) (-1129.710) [-1127.845] -- 0:00:37
403000 -- (-1128.465) (-1130.694) [-1128.036] (-1130.055) * [-1127.975] (-1129.900) (-1130.388) (-1128.221) -- 0:00:37
403500 -- [-1127.997] (-1129.961) (-1129.892) (-1130.719) * (-1128.288) (-1128.819) (-1130.980) [-1128.059] -- 0:00:36
404000 -- (-1130.287) (-1129.023) [-1127.287] (-1130.066) * (-1127.996) (-1129.918) [-1127.568] (-1130.317) -- 0:00:36
404500 -- (-1127.558) (-1128.526) (-1128.427) [-1133.883] * (-1130.133) (-1129.935) (-1129.417) [-1128.636] -- 0:00:38
405000 -- (-1127.557) [-1130.741] (-1128.394) (-1131.266) * (-1130.735) [-1127.096] (-1132.732) (-1128.861) -- 0:00:38
Average standard deviation of split frequencies: 0.010791
405500 -- (-1132.237) (-1129.399) [-1130.228] (-1131.538) * [-1128.071] (-1128.303) (-1131.437) (-1128.994) -- 0:00:38
406000 -- (-1131.728) (-1132.696) (-1129.443) [-1128.390] * [-1133.720] (-1131.873) (-1132.619) (-1129.492) -- 0:00:38
406500 -- (-1128.596) (-1128.346) (-1128.967) [-1129.510] * [-1129.891] (-1132.250) (-1128.116) (-1130.509) -- 0:00:37
407000 -- [-1128.210] (-1130.139) (-1129.506) (-1130.966) * (-1128.861) [-1129.422] (-1128.770) (-1128.367) -- 0:00:37
407500 -- (-1131.804) (-1130.528) [-1131.072] (-1129.183) * (-1128.577) (-1128.524) [-1128.039] (-1128.390) -- 0:00:37
408000 -- [-1131.808] (-1132.525) (-1129.953) (-1129.134) * (-1128.289) (-1129.612) [-1127.790] (-1132.291) -- 0:00:37
408500 -- (-1130.503) (-1129.939) (-1132.327) [-1129.069] * (-1128.533) [-1129.229] (-1130.362) (-1130.238) -- 0:00:37
409000 -- (-1132.567) (-1129.757) (-1128.225) [-1128.998] * (-1129.971) (-1128.978) (-1130.633) [-1127.640] -- 0:00:37
409500 -- [-1129.310] (-1129.916) (-1127.643) (-1127.864) * [-1129.236] (-1129.489) (-1132.500) (-1129.227) -- 0:00:37
410000 -- (-1131.933) (-1128.342) (-1126.974) [-1127.601] * (-1129.557) (-1128.577) (-1129.941) [-1129.303] -- 0:00:37
Average standard deviation of split frequencies: 0.010196
410500 -- (-1131.753) [-1128.276] (-1127.049) (-1129.173) * (-1132.518) [-1128.420] (-1138.148) (-1134.908) -- 0:00:37
411000 -- (-1130.350) (-1130.353) [-1127.317] (-1136.694) * (-1129.251) [-1128.773] (-1137.995) (-1131.646) -- 0:00:37
411500 -- [-1130.137] (-1128.999) (-1127.733) (-1131.241) * (-1130.297) [-1130.812] (-1128.247) (-1128.395) -- 0:00:37
412000 -- [-1128.568] (-1128.106) (-1129.443) (-1131.153) * (-1130.994) (-1128.151) [-1130.592] (-1128.091) -- 0:00:37
412500 -- [-1128.267] (-1129.858) (-1129.066) (-1133.183) * (-1130.219) (-1127.887) (-1129.054) [-1128.053] -- 0:00:37
413000 -- (-1130.199) (-1130.070) (-1129.701) [-1128.544] * (-1130.068) (-1128.813) [-1128.305] (-1128.376) -- 0:00:36
413500 -- (-1129.995) (-1128.061) (-1129.746) [-1128.542] * (-1129.381) (-1134.254) [-1131.102] (-1129.595) -- 0:00:36
414000 -- [-1131.259] (-1127.881) (-1129.029) (-1127.774) * [-1129.072] (-1132.353) (-1129.872) (-1137.313) -- 0:00:36
414500 -- [-1130.608] (-1130.139) (-1129.598) (-1129.424) * [-1129.919] (-1134.411) (-1128.416) (-1128.875) -- 0:00:36
415000 -- (-1131.549) [-1128.138] (-1131.355) (-1127.780) * (-1129.839) (-1131.258) [-1134.316] (-1129.701) -- 0:00:36
Average standard deviation of split frequencies: 0.010465
415500 -- (-1131.919) (-1129.846) [-1130.103] (-1128.286) * (-1132.280) (-1129.057) (-1130.418) [-1129.599] -- 0:00:36
416000 -- (-1128.436) [-1128.866] (-1131.452) (-1127.648) * (-1128.409) [-1129.557] (-1127.745) (-1132.993) -- 0:00:36
416500 -- [-1127.720] (-1128.230) (-1128.977) (-1129.283) * (-1128.302) (-1128.501) (-1130.247) [-1132.182] -- 0:00:36
417000 -- (-1128.533) [-1128.109] (-1130.687) (-1129.107) * [-1127.857] (-1127.613) (-1128.568) (-1135.469) -- 0:00:36
417500 -- (-1127.861) [-1129.416] (-1128.134) (-1128.697) * [-1128.923] (-1129.525) (-1129.938) (-1134.840) -- 0:00:36
418000 -- [-1131.041] (-1128.286) (-1129.381) (-1128.521) * (-1128.825) [-1127.127] (-1128.027) (-1130.535) -- 0:00:36
418500 -- (-1127.988) [-1128.054] (-1130.108) (-1127.844) * [-1128.592] (-1127.867) (-1132.512) (-1129.382) -- 0:00:36
419000 -- [-1127.798] (-1132.930) (-1129.046) (-1128.742) * (-1129.927) (-1129.500) (-1129.041) [-1129.501] -- 0:00:36
419500 -- (-1131.297) [-1127.958] (-1131.011) (-1129.684) * (-1131.829) [-1130.421] (-1129.148) (-1129.392) -- 0:00:35
420000 -- (-1131.960) (-1127.704) (-1132.635) [-1128.968] * (-1130.507) (-1130.255) (-1128.683) [-1128.566] -- 0:00:35
Average standard deviation of split frequencies: 0.010283
420500 -- (-1128.561) (-1128.339) (-1136.782) [-1128.348] * (-1129.001) (-1130.125) [-1127.944] (-1129.645) -- 0:00:37
421000 -- (-1129.371) [-1128.715] (-1127.956) (-1128.416) * [-1128.371] (-1129.984) (-1129.298) (-1127.776) -- 0:00:37
421500 -- (-1132.051) [-1128.792] (-1128.532) (-1130.053) * (-1129.901) (-1129.088) [-1131.706] (-1132.200) -- 0:00:37
422000 -- (-1132.316) (-1130.793) (-1128.548) [-1130.123] * (-1129.078) [-1127.770] (-1128.615) (-1133.159) -- 0:00:36
422500 -- (-1130.745) (-1132.854) (-1130.118) [-1129.755] * [-1129.270] (-1129.055) (-1127.984) (-1133.160) -- 0:00:36
423000 -- (-1131.532) (-1129.551) [-1130.537] (-1130.857) * [-1129.081] (-1129.711) (-1130.588) (-1129.347) -- 0:00:36
423500 -- (-1131.970) [-1128.895] (-1128.110) (-1135.777) * (-1128.546) [-1129.559] (-1131.339) (-1127.689) -- 0:00:36
424000 -- (-1129.279) (-1128.583) (-1132.734) [-1129.666] * (-1127.647) (-1130.873) (-1129.815) [-1130.353] -- 0:00:36
424500 -- (-1131.754) (-1130.460) [-1134.102] (-1130.066) * (-1129.827) [-1130.191] (-1127.585) (-1129.660) -- 0:00:36
425000 -- (-1130.697) (-1130.226) [-1132.070] (-1131.384) * (-1128.889) (-1130.373) [-1127.501] (-1128.663) -- 0:00:36
Average standard deviation of split frequencies: 0.010089
425500 -- (-1128.940) [-1129.229] (-1127.606) (-1129.427) * (-1127.306) (-1132.303) [-1130.626] (-1130.697) -- 0:00:36
426000 -- (-1131.059) (-1130.322) [-1129.089] (-1133.993) * [-1127.644] (-1129.831) (-1130.317) (-1132.126) -- 0:00:36
426500 -- (-1131.163) (-1127.997) [-1128.816] (-1131.723) * (-1127.837) [-1128.885] (-1133.784) (-1132.687) -- 0:00:36
427000 -- (-1133.396) (-1128.233) [-1127.209] (-1130.962) * (-1130.229) (-1129.008) (-1132.112) [-1132.883] -- 0:00:36
427500 -- [-1128.535] (-1128.045) (-1132.191) (-1128.842) * (-1132.069) (-1132.564) [-1129.340] (-1132.700) -- 0:00:36
428000 -- (-1127.433) [-1127.975] (-1128.301) (-1128.746) * (-1129.026) (-1128.539) [-1129.343] (-1132.170) -- 0:00:36
428500 -- (-1129.677) [-1129.245] (-1128.877) (-1129.212) * [-1130.400] (-1127.534) (-1128.719) (-1131.718) -- 0:00:36
429000 -- (-1127.906) (-1129.002) (-1128.683) [-1128.034] * (-1127.965) (-1128.261) (-1127.953) [-1130.201] -- 0:00:35
429500 -- [-1128.074] (-1129.272) (-1131.033) (-1130.209) * [-1128.512] (-1128.317) (-1128.944) (-1128.813) -- 0:00:35
430000 -- (-1130.708) (-1128.266) (-1131.388) [-1130.996] * (-1129.313) (-1129.303) (-1128.842) [-1128.167] -- 0:00:35
Average standard deviation of split frequencies: 0.009916
430500 -- (-1133.185) [-1133.477] (-1129.160) (-1129.087) * (-1129.197) [-1128.352] (-1131.951) (-1127.295) -- 0:00:35
431000 -- [-1128.044] (-1127.969) (-1127.682) (-1129.053) * (-1128.995) [-1128.072] (-1130.312) (-1127.732) -- 0:00:35
431500 -- (-1128.207) [-1129.088] (-1128.299) (-1130.155) * [-1130.199] (-1130.060) (-1128.966) (-1128.385) -- 0:00:35
432000 -- (-1131.321) (-1128.042) (-1127.990) [-1131.239] * (-1130.499) (-1129.851) (-1128.911) [-1130.907] -- 0:00:35
432500 -- (-1130.029) (-1127.830) [-1131.673] (-1130.826) * (-1132.700) (-1129.957) [-1129.406] (-1129.205) -- 0:00:35
433000 -- (-1128.608) (-1131.971) [-1127.591] (-1130.146) * (-1131.967) (-1128.754) (-1129.643) [-1127.432] -- 0:00:35
433500 -- [-1127.849] (-1126.932) (-1128.025) (-1127.278) * (-1131.508) (-1127.389) (-1127.055) [-1128.889] -- 0:00:35
434000 -- (-1128.527) (-1128.416) [-1127.166] (-1127.866) * (-1128.298) (-1128.570) [-1127.804] (-1129.123) -- 0:00:35
434500 -- [-1128.573] (-1129.024) (-1127.246) (-1129.465) * [-1130.183] (-1129.156) (-1129.971) (-1129.392) -- 0:00:35
435000 -- (-1130.433) [-1132.834] (-1127.410) (-1129.409) * (-1130.986) (-1128.649) (-1128.135) [-1131.474] -- 0:00:35
Average standard deviation of split frequencies: 0.010136
435500 -- (-1130.379) [-1127.300] (-1127.689) (-1127.750) * (-1128.577) [-1128.293] (-1128.226) (-1128.358) -- 0:00:34
436000 -- (-1129.422) [-1127.297] (-1129.210) (-1128.228) * [-1128.427] (-1127.477) (-1128.723) (-1127.490) -- 0:00:34
436500 -- (-1129.154) (-1129.717) [-1128.812] (-1134.314) * (-1128.790) [-1128.979] (-1130.047) (-1128.494) -- 0:00:34
437000 -- [-1130.410] (-1128.231) (-1135.650) (-1128.450) * (-1129.794) (-1131.122) [-1128.570] (-1128.590) -- 0:00:36
437500 -- (-1128.364) (-1129.408) [-1129.575] (-1129.276) * (-1129.748) (-1130.442) [-1130.213] (-1128.695) -- 0:00:36
438000 -- [-1128.063] (-1129.009) (-1129.900) (-1127.830) * (-1129.028) (-1132.111) [-1129.300] (-1130.242) -- 0:00:35
438500 -- (-1128.640) (-1129.707) [-1130.635] (-1127.957) * (-1130.429) [-1135.349] (-1137.376) (-1129.979) -- 0:00:35
439000 -- [-1128.988] (-1127.954) (-1133.259) (-1130.027) * (-1130.408) [-1133.349] (-1130.347) (-1128.940) -- 0:00:35
439500 -- [-1127.460] (-1128.903) (-1132.979) (-1128.045) * (-1129.326) (-1128.344) [-1130.963] (-1127.462) -- 0:00:35
440000 -- (-1127.639) (-1127.262) (-1133.064) [-1127.493] * (-1128.918) [-1128.128] (-1128.312) (-1127.651) -- 0:00:35
Average standard deviation of split frequencies: 0.010029
440500 -- (-1129.215) [-1127.624] (-1128.939) (-1127.322) * [-1126.972] (-1129.378) (-1132.017) (-1127.655) -- 0:00:35
441000 -- (-1131.690) [-1127.410] (-1130.621) (-1129.756) * (-1129.905) (-1127.822) (-1130.477) [-1127.469] -- 0:00:35
441500 -- [-1133.486] (-1129.674) (-1130.679) (-1128.444) * (-1129.000) [-1129.707] (-1127.723) (-1128.360) -- 0:00:35
442000 -- (-1127.828) (-1128.110) (-1129.044) [-1128.360] * (-1127.654) [-1131.040] (-1128.301) (-1128.773) -- 0:00:35
442500 -- [-1127.340] (-1129.203) (-1131.586) (-1130.241) * (-1129.483) (-1130.217) (-1127.714) [-1127.509] -- 0:00:35
443000 -- (-1130.117) (-1129.821) [-1131.955] (-1131.595) * (-1129.046) (-1129.836) [-1128.801] (-1130.718) -- 0:00:35
443500 -- (-1131.063) (-1136.720) (-1130.706) [-1127.452] * [-1130.143] (-1132.333) (-1134.222) (-1130.856) -- 0:00:35
444000 -- (-1128.764) (-1128.467) (-1127.458) [-1127.433] * (-1128.917) [-1131.831] (-1133.879) (-1130.224) -- 0:00:35
444500 -- (-1129.342) (-1128.017) (-1128.251) [-1128.378] * (-1128.513) (-1128.763) (-1131.913) [-1130.153] -- 0:00:34
445000 -- (-1128.358) (-1129.372) [-1134.723] (-1128.269) * [-1129.116] (-1129.634) (-1131.589) (-1129.660) -- 0:00:34
Average standard deviation of split frequencies: 0.009909
445500 -- (-1130.060) [-1128.365] (-1132.516) (-1129.304) * (-1134.153) (-1127.638) [-1127.666] (-1129.790) -- 0:00:34
446000 -- (-1129.649) [-1128.362] (-1129.577) (-1127.781) * (-1128.631) (-1129.657) [-1128.385] (-1131.206) -- 0:00:34
446500 -- [-1129.354] (-1127.642) (-1129.157) (-1127.788) * (-1128.948) (-1130.190) (-1134.274) [-1129.502] -- 0:00:34
447000 -- (-1129.861) [-1131.414] (-1130.760) (-1128.348) * (-1129.680) [-1132.130] (-1132.110) (-1129.156) -- 0:00:34
447500 -- (-1128.693) (-1127.355) [-1129.163] (-1128.210) * [-1129.711] (-1129.071) (-1127.137) (-1128.459) -- 0:00:34
448000 -- (-1128.651) (-1128.287) (-1129.698) [-1130.096] * (-1130.779) (-1127.392) [-1128.614] (-1128.636) -- 0:00:34
448500 -- (-1129.644) (-1128.664) [-1129.398] (-1127.255) * (-1131.681) (-1128.336) [-1128.834] (-1128.679) -- 0:00:34
449000 -- (-1129.124) (-1128.201) [-1129.570] (-1127.466) * (-1128.170) [-1128.637] (-1127.924) (-1128.555) -- 0:00:34
449500 -- (-1132.497) (-1129.761) (-1129.289) [-1130.866] * (-1129.394) (-1131.119) [-1127.875] (-1131.907) -- 0:00:34
450000 -- (-1134.502) (-1132.259) [-1129.295] (-1133.339) * (-1130.396) (-1129.419) [-1129.012] (-1135.173) -- 0:00:34
Average standard deviation of split frequencies: 0.009741
450500 -- [-1128.953] (-1128.816) (-1129.832) (-1130.915) * (-1131.099) (-1128.233) (-1131.422) [-1129.047] -- 0:00:34
451000 -- (-1129.297) [-1128.292] (-1128.789) (-1132.751) * [-1128.882] (-1128.618) (-1127.835) (-1127.769) -- 0:00:34
451500 -- (-1128.440) [-1128.177] (-1128.908) (-1128.167) * (-1128.495) (-1129.262) [-1128.080] (-1127.984) -- 0:00:34
452000 -- (-1128.629) [-1127.339] (-1131.663) (-1128.580) * (-1127.823) (-1128.927) (-1128.254) [-1129.993] -- 0:00:33
452500 -- (-1130.157) (-1127.138) [-1132.049] (-1129.872) * (-1128.587) [-1128.048] (-1128.302) (-1132.222) -- 0:00:33
453000 -- (-1129.552) (-1127.421) [-1127.503] (-1129.193) * (-1130.785) (-1128.132) (-1128.989) [-1130.638] -- 0:00:33
453500 -- (-1129.568) (-1128.627) (-1130.441) [-1128.163] * (-1131.714) (-1128.158) (-1127.493) [-1133.808] -- 0:00:34
454000 -- (-1129.437) (-1129.895) (-1129.101) [-1129.733] * (-1130.496) (-1128.352) [-1130.148] (-1132.200) -- 0:00:34
454500 -- (-1129.322) (-1130.313) [-1129.201] (-1131.245) * (-1129.266) (-1130.611) (-1128.587) [-1129.801] -- 0:00:34
455000 -- (-1127.111) [-1130.641] (-1128.196) (-1128.553) * (-1131.539) (-1130.532) [-1128.244] (-1127.085) -- 0:00:34
Average standard deviation of split frequencies: 0.009950
455500 -- [-1130.508] (-1130.714) (-1129.329) (-1128.010) * (-1129.780) (-1128.632) [-1128.743] (-1130.344) -- 0:00:34
456000 -- (-1130.111) (-1127.309) (-1127.889) [-1130.214] * (-1129.905) [-1129.381] (-1130.387) (-1131.964) -- 0:00:34
456500 -- (-1132.206) (-1127.949) [-1127.580] (-1127.810) * (-1130.456) (-1129.348) [-1129.555] (-1130.654) -- 0:00:34
457000 -- (-1127.754) (-1127.714) [-1127.900] (-1128.805) * (-1128.520) [-1129.733] (-1130.397) (-1129.734) -- 0:00:34
457500 -- (-1130.055) [-1131.362] (-1128.375) (-1128.594) * (-1129.554) (-1129.329) [-1127.557] (-1130.935) -- 0:00:34
458000 -- (-1128.111) [-1128.591] (-1128.550) (-1128.368) * (-1131.110) (-1129.808) (-1128.196) [-1127.276] -- 0:00:34
458500 -- (-1130.079) [-1128.396] (-1129.022) (-1129.712) * (-1130.251) [-1127.903] (-1128.566) (-1128.531) -- 0:00:34
459000 -- (-1130.337) [-1127.557] (-1131.411) (-1128.231) * [-1128.694] (-1130.772) (-1128.467) (-1128.326) -- 0:00:34
459500 -- (-1127.720) (-1129.861) [-1129.156] (-1128.665) * (-1132.251) (-1129.138) [-1128.176] (-1131.432) -- 0:00:34
460000 -- (-1128.784) (-1128.358) (-1129.982) [-1128.489] * (-1132.785) (-1131.091) [-1131.278] (-1134.189) -- 0:00:34
Average standard deviation of split frequencies: 0.009785
460500 -- (-1128.192) (-1127.204) (-1130.661) [-1130.618] * (-1131.301) [-1128.014] (-1129.798) (-1132.776) -- 0:00:33
461000 -- (-1128.839) (-1127.485) [-1129.479] (-1130.496) * (-1129.848) (-1127.358) [-1128.192] (-1128.390) -- 0:00:33
461500 -- (-1131.656) [-1129.203] (-1132.855) (-1131.052) * [-1129.255] (-1127.724) (-1127.809) (-1131.021) -- 0:00:33
462000 -- (-1129.618) (-1132.613) (-1132.366) [-1127.981] * [-1127.816] (-1127.763) (-1127.513) (-1133.599) -- 0:00:33
462500 -- (-1130.467) (-1129.917) (-1131.073) [-1128.197] * (-1130.628) (-1130.125) (-1133.110) [-1128.417] -- 0:00:33
463000 -- (-1129.951) (-1130.033) (-1133.077) [-1128.507] * (-1130.919) (-1132.724) (-1130.922) [-1129.980] -- 0:00:33
463500 -- [-1129.354] (-1128.159) (-1130.961) (-1131.700) * [-1128.833] (-1131.853) (-1127.417) (-1130.811) -- 0:00:33
464000 -- (-1131.047) [-1129.556] (-1128.347) (-1132.843) * (-1131.053) (-1129.264) (-1128.115) [-1129.153] -- 0:00:33
464500 -- (-1134.127) (-1129.864) [-1127.662] (-1130.362) * (-1132.087) (-1131.081) [-1129.902] (-1130.604) -- 0:00:33
465000 -- (-1130.196) [-1128.566] (-1135.215) (-1129.114) * [-1128.644] (-1129.832) (-1127.522) (-1132.485) -- 0:00:33
Average standard deviation of split frequencies: 0.010685
465500 -- (-1129.083) (-1127.960) (-1129.616) [-1130.872] * (-1128.177) (-1130.722) [-1127.965] (-1131.504) -- 0:00:33
466000 -- (-1128.760) [-1129.017] (-1128.024) (-1130.702) * (-1129.001) (-1133.010) [-1129.341] (-1129.684) -- 0:00:33
466500 -- (-1129.786) [-1126.953] (-1129.098) (-1130.944) * [-1128.668] (-1130.448) (-1133.059) (-1130.840) -- 0:00:33
467000 -- (-1131.018) (-1127.953) (-1128.809) [-1129.979] * (-1127.245) (-1128.760) (-1132.231) [-1128.917] -- 0:00:33
467500 -- [-1127.987] (-1128.055) (-1132.029) (-1134.914) * (-1128.591) (-1127.875) [-1127.981] (-1129.003) -- 0:00:33
468000 -- [-1127.973] (-1129.626) (-1130.534) (-1130.321) * [-1128.265] (-1129.102) (-1127.568) (-1130.040) -- 0:00:32
468500 -- (-1128.406) [-1130.500] (-1129.711) (-1127.749) * (-1129.013) (-1129.982) [-1127.457] (-1128.635) -- 0:00:32
469000 -- (-1130.973) [-1130.056] (-1129.383) (-1127.651) * [-1129.972] (-1128.658) (-1127.288) (-1129.383) -- 0:00:32
469500 -- (-1131.019) (-1129.731) (-1129.048) [-1127.656] * (-1129.074) [-1128.314] (-1130.776) (-1129.049) -- 0:00:32
470000 -- [-1130.317] (-1127.906) (-1133.425) (-1130.109) * (-1129.938) (-1127.949) [-1130.078] (-1127.463) -- 0:00:33
Average standard deviation of split frequencies: 0.011080
470500 -- (-1130.189) [-1130.098] (-1128.174) (-1129.447) * [-1127.860] (-1129.169) (-1129.561) (-1129.161) -- 0:00:33
471000 -- (-1129.517) (-1127.298) (-1129.467) [-1129.303] * (-1127.807) (-1128.396) [-1129.531] (-1131.026) -- 0:00:33
471500 -- (-1135.911) (-1130.574) (-1128.499) [-1129.869] * (-1127.508) (-1128.475) (-1127.234) [-1129.160] -- 0:00:33
472000 -- (-1129.478) [-1130.444] (-1129.465) (-1134.544) * (-1127.508) (-1129.420) [-1127.163] (-1131.377) -- 0:00:33
472500 -- (-1128.389) [-1128.921] (-1131.097) (-1133.085) * [-1129.912] (-1128.463) (-1128.521) (-1127.741) -- 0:00:33
473000 -- [-1127.931] (-1127.775) (-1132.136) (-1130.214) * [-1133.293] (-1128.343) (-1130.762) (-1128.381) -- 0:00:33
473500 -- (-1128.397) (-1131.399) [-1127.951] (-1131.001) * (-1129.057) (-1133.226) (-1129.452) [-1128.340] -- 0:00:33
474000 -- [-1128.016] (-1130.488) (-1128.653) (-1133.013) * (-1134.361) (-1137.234) [-1128.565] (-1130.662) -- 0:00:33
474500 -- (-1128.643) (-1131.168) [-1129.547] (-1129.154) * (-1127.643) [-1130.621] (-1127.826) (-1129.146) -- 0:00:33
475000 -- (-1130.616) (-1129.090) [-1127.511] (-1130.803) * (-1129.277) (-1133.516) [-1129.508] (-1131.665) -- 0:00:33
Average standard deviation of split frequencies: 0.011637
475500 -- [-1129.832] (-1132.042) (-1129.173) (-1132.797) * [-1128.573] (-1130.762) (-1129.082) (-1131.691) -- 0:00:33
476000 -- (-1131.517) [-1130.438] (-1128.577) (-1131.159) * [-1127.786] (-1131.657) (-1127.921) (-1128.267) -- 0:00:33
476500 -- [-1129.993] (-1130.763) (-1129.075) (-1130.269) * (-1132.166) (-1132.682) [-1133.241] (-1131.775) -- 0:00:32
477000 -- (-1127.420) (-1128.417) [-1127.244] (-1129.684) * (-1131.014) (-1128.337) [-1127.153] (-1129.635) -- 0:00:32
477500 -- (-1128.111) [-1129.234] (-1129.179) (-1129.994) * (-1131.727) [-1130.385] (-1128.024) (-1129.392) -- 0:00:32
478000 -- (-1130.113) (-1127.930) (-1129.933) [-1130.674] * (-1128.560) (-1128.403) (-1127.968) [-1128.289] -- 0:00:32
478500 -- (-1131.829) [-1128.876] (-1129.072) (-1130.343) * (-1132.862) [-1131.991] (-1134.443) (-1128.848) -- 0:00:32
479000 -- (-1129.349) (-1130.778) [-1130.046] (-1127.174) * (-1129.110) (-1128.035) (-1132.779) [-1128.360] -- 0:00:32
479500 -- (-1130.116) [-1131.994] (-1130.737) (-1131.448) * [-1128.748] (-1128.017) (-1130.341) (-1129.994) -- 0:00:32
480000 -- (-1128.967) [-1130.708] (-1130.679) (-1129.594) * (-1130.230) (-1129.919) (-1129.708) [-1130.238] -- 0:00:32
Average standard deviation of split frequencies: 0.010972
480500 -- (-1127.716) (-1130.782) (-1130.563) [-1128.608] * (-1131.895) (-1130.245) (-1129.428) [-1130.234] -- 0:00:32
481000 -- (-1130.293) (-1130.882) (-1129.518) [-1130.694] * (-1133.183) [-1129.697] (-1127.120) (-1137.537) -- 0:00:32
481500 -- (-1129.395) (-1127.879) (-1127.879) [-1128.244] * [-1131.641] (-1131.276) (-1128.225) (-1127.997) -- 0:00:32
482000 -- [-1130.027] (-1131.419) (-1129.355) (-1130.147) * (-1127.313) (-1130.370) (-1130.978) [-1129.128] -- 0:00:32
482500 -- (-1129.762) (-1133.034) [-1129.769] (-1135.272) * (-1127.091) (-1128.417) [-1129.236] (-1129.476) -- 0:00:32
483000 -- [-1129.199] (-1132.450) (-1127.497) (-1129.093) * (-1129.363) (-1128.594) (-1128.126) [-1128.010] -- 0:00:32
483500 -- (-1133.361) (-1127.880) (-1134.830) [-1128.286] * (-1134.647) (-1129.116) (-1128.442) [-1132.778] -- 0:00:32
484000 -- (-1132.704) (-1127.880) [-1129.209] (-1129.031) * (-1131.496) (-1128.610) (-1131.264) [-1128.889] -- 0:00:31
484500 -- (-1131.383) (-1129.029) [-1128.871] (-1130.166) * (-1133.590) [-1129.515] (-1131.146) (-1129.462) -- 0:00:31
485000 -- (-1128.344) (-1129.109) (-1133.416) [-1128.605] * (-1133.305) [-1128.976] (-1132.680) (-1129.524) -- 0:00:31
Average standard deviation of split frequencies: 0.011337
485500 -- [-1128.182] (-1128.440) (-1131.082) (-1127.706) * (-1128.744) [-1129.139] (-1129.271) (-1134.921) -- 0:00:31
486000 -- (-1129.901) (-1129.693) (-1131.575) [-1128.618] * [-1128.742] (-1128.129) (-1130.708) (-1135.825) -- 0:00:32
486500 -- (-1129.368) (-1129.445) [-1130.104] (-1128.020) * (-1134.081) [-1128.129] (-1134.892) (-1133.102) -- 0:00:32
487000 -- [-1129.975] (-1128.529) (-1128.418) (-1128.807) * [-1129.116] (-1128.032) (-1130.612) (-1131.360) -- 0:00:32
487500 -- (-1128.603) (-1128.595) (-1128.724) [-1130.503] * [-1131.508] (-1128.203) (-1127.251) (-1130.453) -- 0:00:32
488000 -- [-1128.084] (-1129.168) (-1132.229) (-1130.199) * (-1132.320) (-1131.329) [-1127.182] (-1130.053) -- 0:00:32
488500 -- (-1132.591) (-1128.096) (-1127.783) [-1129.470] * (-1129.903) (-1130.079) [-1127.674] (-1129.468) -- 0:00:32
489000 -- (-1134.209) (-1128.072) [-1128.486] (-1128.237) * [-1128.621] (-1130.642) (-1128.340) (-1128.306) -- 0:00:32
489500 -- (-1128.458) [-1128.729] (-1130.658) (-1131.446) * (-1127.600) [-1130.208] (-1128.029) (-1127.727) -- 0:00:32
490000 -- (-1127.571) [-1127.761] (-1128.649) (-1131.006) * (-1130.035) (-1131.083) (-1128.883) [-1128.785] -- 0:00:32
Average standard deviation of split frequencies: 0.011109
490500 -- [-1127.505] (-1129.568) (-1128.493) (-1129.842) * [-1128.934] (-1130.745) (-1129.753) (-1128.387) -- 0:00:32
491000 -- (-1128.714) (-1130.135) (-1128.573) [-1137.015] * (-1129.938) (-1132.651) [-1128.260] (-1127.509) -- 0:00:32
491500 -- (-1128.265) [-1129.285] (-1131.227) (-1128.757) * (-1127.757) [-1127.224] (-1129.944) (-1128.466) -- 0:00:32
492000 -- (-1127.865) (-1130.004) (-1128.372) [-1128.245] * (-1129.359) (-1128.232) (-1129.253) [-1129.100] -- 0:00:32
492500 -- (-1131.028) (-1129.730) (-1128.697) [-1128.717] * (-1129.527) [-1130.311] (-1133.638) (-1127.688) -- 0:00:31
493000 -- (-1129.848) (-1131.191) [-1130.888] (-1129.215) * (-1132.907) (-1129.329) (-1128.525) [-1128.325] -- 0:00:31
493500 -- (-1129.768) [-1129.367] (-1127.566) (-1130.027) * (-1130.348) (-1130.482) [-1129.263] (-1127.317) -- 0:00:31
494000 -- (-1127.838) (-1129.202) [-1127.892] (-1128.797) * (-1130.802) (-1131.258) [-1128.149] (-1127.529) -- 0:00:31
494500 -- (-1131.196) (-1130.022) (-1129.116) [-1130.418] * (-1130.495) [-1130.808] (-1129.931) (-1127.456) -- 0:00:31
495000 -- [-1129.649] (-1128.257) (-1132.361) (-1133.199) * [-1128.443] (-1128.516) (-1127.760) (-1131.830) -- 0:00:31
Average standard deviation of split frequencies: 0.010633
495500 -- (-1130.816) (-1128.016) (-1135.546) [-1130.926] * (-1128.403) (-1128.808) (-1133.125) [-1129.692] -- 0:00:31
496000 -- [-1129.136] (-1127.210) (-1127.812) (-1131.630) * (-1128.311) [-1130.957] (-1127.792) (-1129.171) -- 0:00:31
496500 -- (-1128.942) (-1130.651) [-1127.556] (-1132.456) * (-1127.826) (-1130.339) (-1128.211) [-1131.520] -- 0:00:31
497000 -- [-1127.800] (-1128.827) (-1129.099) (-1133.343) * (-1128.716) [-1130.706] (-1128.685) (-1128.781) -- 0:00:31
497500 -- (-1128.303) [-1130.016] (-1131.376) (-1131.866) * (-1128.120) (-1137.452) (-1127.838) [-1129.325] -- 0:00:31
498000 -- (-1130.361) [-1128.776] (-1130.640) (-1128.983) * (-1128.364) [-1127.914] (-1130.239) (-1133.972) -- 0:00:31
498500 -- (-1128.229) [-1129.693] (-1130.122) (-1131.440) * (-1131.479) (-1127.922) [-1130.204] (-1129.278) -- 0:00:31
499000 -- (-1128.475) (-1139.490) [-1128.798] (-1130.766) * (-1130.744) [-1128.310] (-1127.338) (-1127.824) -- 0:00:31
499500 -- [-1128.008] (-1130.745) (-1129.169) (-1129.067) * (-1129.927) (-1128.302) [-1129.716] (-1130.412) -- 0:00:31
500000 -- [-1128.260] (-1134.126) (-1131.561) (-1128.813) * [-1128.552] (-1128.143) (-1132.505) (-1132.152) -- 0:00:31
Average standard deviation of split frequencies: 0.009886
500500 -- (-1128.224) (-1128.905) (-1129.920) [-1127.954] * (-1129.061) [-1129.680] (-1127.503) (-1129.488) -- 0:00:30
501000 -- (-1131.335) (-1129.993) (-1128.936) [-1127.831] * (-1129.818) (-1131.889) (-1130.675) [-1127.610] -- 0:00:30
501500 -- (-1129.356) (-1134.068) (-1131.353) [-1128.684] * (-1130.870) [-1127.347] (-1127.799) (-1128.002) -- 0:00:30
502000 -- (-1131.687) [-1128.695] (-1128.569) (-1130.533) * (-1131.559) (-1130.259) (-1127.835) [-1128.371] -- 0:00:30
502500 -- (-1131.825) (-1129.059) (-1129.152) [-1130.115] * (-1134.201) (-1130.035) (-1127.812) [-1127.554] -- 0:00:31
503000 -- [-1131.478] (-1130.712) (-1130.693) (-1127.811) * (-1136.265) (-1128.663) (-1130.180) [-1127.569] -- 0:00:31
503500 -- (-1132.322) (-1131.696) (-1128.602) [-1127.288] * (-1132.813) (-1130.267) (-1132.005) [-1129.965] -- 0:00:31
504000 -- (-1135.249) (-1133.625) [-1128.889] (-1127.292) * [-1132.886] (-1131.655) (-1134.672) (-1129.766) -- 0:00:31
504500 -- (-1130.836) (-1131.707) (-1132.502) [-1127.626] * (-1130.594) (-1129.301) (-1130.569) [-1127.966] -- 0:00:31
505000 -- (-1128.531) (-1135.002) [-1130.563] (-1127.613) * (-1129.734) (-1128.330) (-1128.073) [-1128.389] -- 0:00:31
Average standard deviation of split frequencies: 0.009724
505500 -- (-1129.419) [-1130.765] (-1130.024) (-1128.338) * (-1129.440) (-1128.124) [-1127.732] (-1130.628) -- 0:00:31
506000 -- (-1128.055) (-1131.241) (-1130.044) [-1129.051] * [-1130.401] (-1127.288) (-1127.607) (-1128.349) -- 0:00:31
506500 -- [-1128.019] (-1129.659) (-1131.031) (-1127.047) * [-1129.284] (-1127.417) (-1127.318) (-1128.016) -- 0:00:31
507000 -- (-1127.259) (-1128.871) [-1129.887] (-1133.814) * (-1129.347) (-1127.051) [-1129.325] (-1127.927) -- 0:00:31
507500 -- [-1130.539] (-1127.679) (-1130.921) (-1131.617) * (-1128.437) (-1127.750) (-1133.766) [-1127.658] -- 0:00:31
508000 -- (-1128.141) [-1129.872] (-1138.570) (-1129.210) * (-1130.022) (-1128.796) [-1129.935] (-1127.131) -- 0:00:30
508500 -- (-1128.813) (-1131.077) (-1129.464) [-1128.178] * (-1129.918) [-1128.271] (-1129.985) (-1128.114) -- 0:00:30
509000 -- (-1128.518) [-1127.956] (-1132.565) (-1128.301) * (-1128.116) [-1131.422] (-1128.920) (-1127.044) -- 0:00:30
509500 -- (-1129.030) (-1128.994) (-1130.588) [-1129.063] * [-1132.729] (-1129.540) (-1131.678) (-1131.268) -- 0:00:30
510000 -- (-1128.915) [-1127.857] (-1129.504) (-1130.567) * [-1131.030] (-1133.106) (-1130.901) (-1131.519) -- 0:00:30
Average standard deviation of split frequencies: 0.009462
510500 -- (-1129.867) [-1128.095] (-1127.877) (-1131.334) * [-1129.980] (-1128.504) (-1131.260) (-1131.882) -- 0:00:30
511000 -- (-1129.125) (-1129.124) [-1128.190] (-1129.845) * (-1128.262) (-1129.889) (-1129.167) [-1132.117] -- 0:00:30
511500 -- (-1130.966) [-1129.023] (-1130.137) (-1129.252) * [-1128.571] (-1131.409) (-1132.197) (-1127.894) -- 0:00:30
512000 -- (-1128.793) (-1131.738) [-1129.325] (-1128.108) * (-1127.177) (-1129.365) [-1130.147] (-1128.596) -- 0:00:30
512500 -- (-1128.863) (-1128.186) [-1130.647] (-1128.858) * (-1128.495) (-1128.724) (-1130.783) [-1130.427] -- 0:00:30
513000 -- (-1131.281) (-1128.138) (-1129.807) [-1130.984] * (-1130.999) [-1128.843] (-1128.791) (-1129.765) -- 0:00:30
513500 -- [-1128.469] (-1130.544) (-1127.142) (-1129.278) * (-1131.256) (-1130.037) (-1129.581) [-1129.348] -- 0:00:30
514000 -- [-1129.260] (-1128.926) (-1127.849) (-1132.808) * [-1129.632] (-1129.965) (-1131.022) (-1128.677) -- 0:00:30
514500 -- (-1133.300) (-1131.794) [-1127.849] (-1127.981) * (-1129.513) (-1130.402) (-1129.757) [-1129.116] -- 0:00:30
515000 -- (-1128.119) (-1127.759) [-1129.130] (-1138.329) * (-1128.072) (-1129.108) [-1129.289] (-1127.467) -- 0:00:30
Average standard deviation of split frequencies: 0.009136
515500 -- (-1127.278) [-1131.131] (-1130.976) (-1130.153) * (-1129.103) [-1129.792] (-1130.881) (-1127.920) -- 0:00:30
516000 -- [-1127.434] (-1129.793) (-1132.498) (-1129.591) * (-1129.448) (-1130.224) (-1128.286) [-1127.726] -- 0:00:30
516500 -- [-1127.511] (-1129.569) (-1130.278) (-1130.558) * (-1132.792) [-1129.223] (-1128.704) (-1129.230) -- 0:00:29
517000 -- (-1127.387) (-1130.024) (-1129.845) [-1129.908] * [-1129.377] (-1129.122) (-1129.748) (-1127.224) -- 0:00:29
517500 -- (-1129.603) [-1130.323] (-1130.678) (-1132.882) * (-1132.222) [-1129.222] (-1127.525) (-1132.969) -- 0:00:29
518000 -- (-1128.659) [-1130.656] (-1129.159) (-1130.224) * (-1129.617) (-1128.759) (-1129.378) [-1130.303] -- 0:00:29
518500 -- [-1128.962] (-1129.729) (-1128.715) (-1127.397) * (-1130.326) [-1129.300] (-1128.204) (-1127.823) -- 0:00:30
519000 -- [-1129.555] (-1129.371) (-1128.724) (-1127.555) * (-1130.080) [-1128.895] (-1129.396) (-1127.398) -- 0:00:30
519500 -- (-1133.203) [-1128.457] (-1128.298) (-1129.285) * (-1130.790) [-1128.602] (-1127.521) (-1128.875) -- 0:00:30
520000 -- (-1132.753) (-1127.426) (-1128.968) [-1130.560] * (-1128.822) (-1129.118) [-1128.814] (-1128.692) -- 0:00:30
Average standard deviation of split frequencies: 0.008884
520500 -- (-1129.138) [-1127.511] (-1127.655) (-1130.313) * (-1130.021) (-1134.869) (-1130.448) [-1129.396] -- 0:00:30
521000 -- [-1129.083] (-1127.350) (-1129.373) (-1130.056) * (-1128.380) [-1128.053] (-1130.557) (-1127.326) -- 0:00:30
521500 -- (-1130.808) (-1129.631) [-1129.128] (-1130.020) * (-1127.695) [-1133.501] (-1129.114) (-1127.919) -- 0:00:30
522000 -- (-1133.381) (-1129.114) (-1130.862) [-1127.711] * (-1127.837) (-1128.257) (-1132.316) [-1128.266] -- 0:00:30
522500 -- (-1128.541) (-1128.769) [-1133.556] (-1129.255) * [-1129.291] (-1127.860) (-1131.709) (-1127.969) -- 0:00:30
523000 -- (-1128.396) (-1131.428) (-1131.091) [-1129.442] * (-1129.208) (-1129.393) [-1128.639] (-1128.784) -- 0:00:30
523500 -- (-1127.970) (-1128.733) [-1129.120] (-1131.926) * (-1129.209) (-1130.410) (-1128.452) [-1128.384] -- 0:00:30
524000 -- (-1135.597) [-1129.975] (-1132.954) (-1127.935) * (-1127.567) [-1128.642] (-1128.775) (-1129.148) -- 0:00:29
524500 -- (-1132.756) (-1129.619) (-1128.799) [-1127.534] * [-1127.455] (-1129.959) (-1127.975) (-1129.076) -- 0:00:29
525000 -- (-1130.619) [-1128.253] (-1128.285) (-1129.720) * (-1127.979) [-1128.777] (-1127.290) (-1131.771) -- 0:00:29
Average standard deviation of split frequencies: 0.008626
525500 -- (-1127.092) [-1128.349] (-1127.786) (-1129.116) * [-1127.699] (-1128.693) (-1128.180) (-1131.527) -- 0:00:29
526000 -- (-1128.551) (-1130.049) [-1130.407] (-1130.390) * [-1129.567] (-1129.036) (-1131.200) (-1130.530) -- 0:00:29
526500 -- [-1131.142] (-1130.879) (-1128.409) (-1129.655) * (-1129.566) (-1129.293) [-1131.861] (-1130.770) -- 0:00:29
527000 -- (-1129.729) (-1132.960) [-1128.346] (-1129.593) * [-1128.235] (-1130.791) (-1132.406) (-1128.315) -- 0:00:29
527500 -- (-1131.594) (-1129.128) [-1132.701] (-1128.494) * (-1128.446) (-1132.971) [-1128.210] (-1127.932) -- 0:00:29
528000 -- (-1130.043) (-1127.754) (-1129.571) [-1130.174] * (-1128.542) (-1128.216) (-1128.765) [-1128.699] -- 0:00:29
528500 -- (-1129.236) (-1129.070) (-1128.127) [-1128.160] * [-1128.461] (-1130.501) (-1128.900) (-1128.787) -- 0:00:29
529000 -- (-1130.956) (-1128.782) (-1127.772) [-1133.105] * (-1130.449) (-1129.178) (-1132.842) [-1127.517] -- 0:00:29
529500 -- (-1130.232) (-1128.785) (-1129.276) [-1127.528] * (-1132.762) (-1132.040) (-1130.994) [-1130.282] -- 0:00:29
530000 -- (-1127.400) (-1129.582) [-1130.218] (-1130.135) * (-1133.212) (-1130.211) (-1129.965) [-1128.291] -- 0:00:29
Average standard deviation of split frequencies: 0.008717
530500 -- (-1128.363) [-1129.351] (-1130.604) (-1128.808) * [-1129.195] (-1128.301) (-1127.518) (-1128.163) -- 0:00:29
531000 -- (-1127.998) (-1130.743) [-1127.932] (-1132.619) * (-1128.708) (-1128.705) [-1127.768] (-1129.634) -- 0:00:29
531500 -- (-1133.034) (-1130.063) (-1128.605) [-1128.846] * (-1132.233) (-1127.365) [-1129.893] (-1128.548) -- 0:00:29
532000 -- (-1130.065) (-1130.707) (-1129.420) [-1127.869] * (-1127.987) [-1127.583] (-1130.668) (-1131.231) -- 0:00:29
532500 -- (-1129.633) (-1133.072) (-1128.964) [-1129.291] * [-1127.676] (-1128.730) (-1129.009) (-1130.469) -- 0:00:28
533000 -- (-1130.590) (-1129.465) [-1127.908] (-1128.383) * [-1131.476] (-1129.604) (-1131.193) (-1131.097) -- 0:00:29
533500 -- (-1128.126) [-1132.800] (-1129.080) (-1127.996) * (-1128.274) [-1129.081] (-1134.462) (-1131.345) -- 0:00:29
534000 -- (-1129.410) [-1128.335] (-1126.872) (-1128.121) * (-1130.905) (-1128.329) [-1131.073] (-1127.216) -- 0:00:29
534500 -- [-1129.146] (-1132.897) (-1127.302) (-1132.487) * [-1129.837] (-1129.629) (-1130.187) (-1127.216) -- 0:00:29
535000 -- (-1129.370) (-1128.712) (-1127.346) [-1128.746] * [-1130.133] (-1132.122) (-1129.943) (-1129.136) -- 0:00:29
Average standard deviation of split frequencies: 0.008685
535500 -- [-1131.180] (-1130.907) (-1128.284) (-1131.814) * (-1129.972) (-1135.833) [-1128.224] (-1130.928) -- 0:00:29
536000 -- [-1131.390] (-1129.056) (-1129.811) (-1132.556) * (-1128.277) [-1131.294] (-1128.343) (-1128.520) -- 0:00:29
536500 -- (-1130.141) (-1131.494) (-1128.270) [-1127.769] * [-1129.283] (-1127.818) (-1128.539) (-1132.303) -- 0:00:29
537000 -- (-1130.307) (-1127.137) (-1128.619) [-1128.434] * (-1135.017) (-1129.308) (-1128.657) [-1131.571] -- 0:00:29
537500 -- (-1130.985) (-1127.862) (-1128.823) [-1129.748] * [-1127.229] (-1129.300) (-1128.106) (-1128.585) -- 0:00:29
538000 -- (-1131.789) [-1127.361] (-1127.174) (-1129.699) * (-1129.863) (-1128.445) (-1128.171) [-1129.816] -- 0:00:29
538500 -- (-1133.913) (-1132.684) (-1127.175) [-1129.138] * [-1130.698] (-1128.994) (-1127.703) (-1127.863) -- 0:00:29
539000 -- (-1130.223) [-1128.933] (-1129.929) (-1129.862) * (-1136.696) [-1128.702] (-1128.343) (-1128.179) -- 0:00:29
539500 -- (-1127.927) (-1128.401) (-1127.793) [-1128.829] * (-1129.951) (-1129.291) (-1128.828) [-1128.571] -- 0:00:29
540000 -- [-1127.973] (-1128.253) (-1130.997) (-1128.925) * (-1129.192) (-1129.474) (-1130.109) [-1128.951] -- 0:00:28
Average standard deviation of split frequencies: 0.008773
540500 -- (-1129.181) (-1127.399) (-1130.571) [-1132.805] * (-1132.660) (-1129.129) [-1129.204] (-1128.579) -- 0:00:28
541000 -- [-1129.031] (-1127.943) (-1132.747) (-1127.556) * (-1128.576) [-1128.063] (-1128.911) (-1130.684) -- 0:00:28
541500 -- [-1129.048] (-1128.993) (-1129.070) (-1131.479) * (-1129.799) (-1128.355) (-1130.742) [-1129.652] -- 0:00:28
542000 -- (-1134.321) (-1129.929) (-1133.057) [-1128.824] * (-1130.096) (-1127.247) (-1131.944) [-1127.491] -- 0:00:28
542500 -- (-1128.835) [-1127.715] (-1132.358) (-1135.626) * [-1128.376] (-1132.664) (-1128.092) (-1129.091) -- 0:00:28
543000 -- (-1130.099) (-1132.271) [-1130.153] (-1127.487) * (-1127.214) (-1130.250) [-1127.456] (-1129.706) -- 0:00:28
543500 -- [-1128.959] (-1127.924) (-1128.624) (-1127.454) * (-1132.503) [-1128.636] (-1129.207) (-1129.372) -- 0:00:28
544000 -- [-1128.597] (-1128.170) (-1128.011) (-1128.549) * [-1131.912] (-1130.849) (-1127.786) (-1131.867) -- 0:00:28
544500 -- (-1128.482) (-1129.444) [-1130.202] (-1127.477) * (-1129.624) [-1128.269] (-1127.266) (-1133.074) -- 0:00:28
545000 -- (-1132.233) [-1128.806] (-1130.158) (-1128.290) * (-1136.084) (-1129.053) [-1129.074] (-1133.349) -- 0:00:28
Average standard deviation of split frequencies: 0.008418
545500 -- (-1131.182) (-1130.528) (-1129.740) [-1128.741] * (-1133.063) (-1129.810) [-1127.482] (-1132.742) -- 0:00:28
546000 -- [-1128.067] (-1132.557) (-1127.820) (-1127.512) * (-1128.459) (-1128.465) [-1127.559] (-1128.826) -- 0:00:28
546500 -- (-1131.854) (-1130.650) [-1128.049] (-1130.502) * (-1128.043) (-1134.296) (-1127.326) [-1132.335] -- 0:00:28
547000 -- (-1130.160) [-1133.293] (-1128.430) (-1131.330) * (-1132.866) (-1132.424) (-1127.533) [-1127.956] -- 0:00:28
547500 -- (-1130.840) (-1137.013) (-1132.745) [-1128.463] * (-1128.102) (-1131.111) (-1128.763) [-1131.046] -- 0:00:28
548000 -- (-1132.094) (-1129.510) [-1130.516] (-1131.151) * (-1129.603) (-1128.282) [-1128.723] (-1128.368) -- 0:00:28
548500 -- [-1129.987] (-1129.907) (-1131.887) (-1129.743) * (-1127.343) (-1129.716) (-1130.136) [-1128.343] -- 0:00:28
549000 -- (-1130.640) (-1130.171) (-1129.544) [-1127.143] * (-1128.391) (-1127.660) [-1127.887] (-1127.594) -- 0:00:28
549500 -- [-1129.612] (-1128.901) (-1138.975) (-1127.799) * [-1127.040] (-1128.259) (-1129.028) (-1129.637) -- 0:00:28
550000 -- (-1129.721) (-1128.680) (-1129.279) [-1130.086] * (-1127.859) [-1129.166] (-1129.460) (-1128.076) -- 0:00:28
Average standard deviation of split frequencies: 0.008026
550500 -- (-1130.771) (-1129.237) (-1128.635) [-1128.525] * (-1130.926) [-1129.062] (-1129.336) (-1130.970) -- 0:00:28
551000 -- (-1131.470) [-1127.276] (-1129.016) (-1127.899) * (-1128.746) (-1130.981) (-1128.899) [-1127.657] -- 0:00:28
551500 -- (-1133.454) (-1128.871) [-1130.513] (-1128.754) * (-1128.133) (-1131.820) [-1130.215] (-1132.384) -- 0:00:28
552000 -- [-1133.457] (-1127.506) (-1132.660) (-1128.937) * (-1130.605) (-1131.958) (-1131.446) [-1130.786] -- 0:00:28
552500 -- [-1133.875] (-1129.153) (-1130.929) (-1128.637) * (-1134.579) [-1130.539] (-1128.952) (-1128.572) -- 0:00:28
553000 -- (-1133.435) (-1130.088) [-1128.033] (-1130.218) * [-1130.394] (-1128.466) (-1129.668) (-1129.219) -- 0:00:28
553500 -- (-1131.828) (-1130.928) [-1129.363] (-1132.242) * (-1130.440) [-1127.072] (-1128.430) (-1128.897) -- 0:00:28
554000 -- (-1129.535) (-1128.773) [-1128.568] (-1128.456) * (-1130.395) (-1127.087) [-1130.405] (-1127.740) -- 0:00:28
554500 -- (-1133.490) (-1130.335) (-1128.027) [-1128.537] * (-1132.892) (-1127.341) (-1129.863) [-1127.888] -- 0:00:28
555000 -- (-1130.783) [-1131.824] (-1128.128) (-1130.075) * (-1128.810) (-1129.480) (-1130.789) [-1129.375] -- 0:00:28
Average standard deviation of split frequencies: 0.008129
555500 -- (-1130.333) [-1127.255] (-1128.049) (-1130.165) * [-1130.213] (-1129.337) (-1129.992) (-1128.197) -- 0:00:28
556000 -- (-1128.693) (-1129.150) (-1128.137) [-1130.228] * (-1128.346) (-1129.338) [-1128.433] (-1128.524) -- 0:00:27
556500 -- (-1128.242) [-1129.392] (-1128.771) (-1130.106) * (-1129.725) [-1128.603] (-1128.437) (-1128.921) -- 0:00:27
557000 -- (-1130.668) (-1127.547) [-1129.645] (-1128.414) * (-1129.331) [-1128.369] (-1128.811) (-1129.508) -- 0:00:27
557500 -- (-1129.006) (-1129.403) [-1131.490] (-1131.301) * [-1127.751] (-1128.154) (-1131.935) (-1129.051) -- 0:00:27
558000 -- (-1129.161) [-1131.512] (-1128.780) (-1129.396) * [-1127.894] (-1128.224) (-1129.676) (-1129.154) -- 0:00:27
558500 -- (-1127.173) [-1128.243] (-1129.671) (-1129.250) * (-1127.641) (-1132.266) (-1135.745) [-1129.637] -- 0:00:27
559000 -- (-1127.668) [-1133.064] (-1127.902) (-1127.497) * (-1130.747) (-1132.139) (-1134.557) [-1127.301] -- 0:00:27
559500 -- (-1127.364) (-1132.659) [-1129.409] (-1128.154) * (-1133.524) (-1131.552) (-1127.622) [-1127.141] -- 0:00:27
560000 -- (-1129.074) [-1131.889] (-1127.387) (-1129.678) * (-1131.763) [-1133.880] (-1128.323) (-1127.139) -- 0:00:27
Average standard deviation of split frequencies: 0.008260
560500 -- (-1129.157) (-1131.149) [-1128.741] (-1129.834) * (-1129.794) (-1129.543) (-1128.336) [-1128.032] -- 0:00:27
561000 -- (-1130.930) (-1131.891) [-1129.185] (-1128.740) * (-1129.007) (-1134.842) (-1127.976) [-1128.083] -- 0:00:27
561500 -- [-1130.722] (-1129.696) (-1129.339) (-1133.799) * (-1129.386) (-1131.282) (-1128.437) [-1128.012] -- 0:00:27
562000 -- (-1129.074) [-1128.412] (-1128.645) (-1128.353) * (-1129.959) [-1129.077] (-1129.406) (-1128.344) -- 0:00:27
562500 -- [-1127.138] (-1130.563) (-1128.140) (-1128.596) * (-1129.265) (-1130.540) (-1129.495) [-1128.577] -- 0:00:27
563000 -- (-1129.073) [-1128.549] (-1127.758) (-1132.151) * (-1130.791) [-1128.674] (-1133.938) (-1127.472) -- 0:00:27
563500 -- (-1131.916) [-1128.092] (-1130.238) (-1129.398) * (-1130.437) (-1136.836) (-1128.976) [-1127.050] -- 0:00:27
564000 -- (-1134.417) [-1130.014] (-1127.531) (-1129.056) * (-1129.854) [-1129.599] (-1128.491) (-1127.647) -- 0:00:27
564500 -- (-1130.711) [-1133.733] (-1129.905) (-1129.058) * (-1129.145) (-1127.485) (-1131.071) [-1128.315] -- 0:00:27
565000 -- [-1129.450] (-1128.334) (-1127.257) (-1129.030) * (-1128.009) (-1129.247) [-1129.044] (-1127.964) -- 0:00:27
Average standard deviation of split frequencies: 0.008770
565500 -- (-1128.457) (-1130.220) (-1127.892) [-1129.517] * (-1129.346) (-1131.003) (-1127.740) [-1129.995] -- 0:00:27
566000 -- [-1128.801] (-1127.540) (-1129.082) (-1131.607) * (-1129.507) (-1131.306) [-1127.739] (-1131.779) -- 0:00:27
566500 -- (-1127.597) (-1127.680) (-1132.399) [-1130.625] * (-1135.791) (-1132.743) [-1127.434] (-1129.402) -- 0:00:27
567000 -- (-1130.815) [-1128.939] (-1130.239) (-1130.147) * (-1128.230) (-1130.477) [-1128.043] (-1128.952) -- 0:00:27
567500 -- [-1133.018] (-1131.860) (-1129.847) (-1131.231) * (-1129.956) (-1131.469) (-1128.520) [-1130.288] -- 0:00:27
568000 -- (-1132.462) (-1127.528) [-1128.838] (-1127.686) * (-1129.428) [-1127.263] (-1129.124) (-1129.239) -- 0:00:27
568500 -- (-1137.498) [-1128.423] (-1129.415) (-1129.054) * [-1128.133] (-1129.259) (-1130.250) (-1129.374) -- 0:00:27
569000 -- (-1134.831) (-1128.589) (-1128.048) [-1128.262] * [-1130.114] (-1129.147) (-1131.171) (-1129.895) -- 0:00:27
569500 -- (-1130.475) (-1128.480) [-1127.972] (-1127.541) * (-1128.849) (-1128.164) (-1128.608) [-1128.270] -- 0:00:27
570000 -- (-1128.930) [-1128.896] (-1127.763) (-1128.000) * (-1128.375) (-1128.667) [-1129.219] (-1128.187) -- 0:00:27
Average standard deviation of split frequencies: 0.009087
570500 -- [-1129.078] (-1127.793) (-1128.539) (-1127.890) * (-1129.903) [-1130.039] (-1129.329) (-1128.745) -- 0:00:27
571000 -- (-1128.343) [-1128.803] (-1128.531) (-1128.019) * (-1127.091) (-1128.480) [-1130.085] (-1127.952) -- 0:00:27
571500 -- [-1128.354] (-1128.749) (-1128.495) (-1130.549) * (-1129.005) (-1129.388) (-1129.731) [-1130.011] -- 0:00:26
572000 -- (-1127.180) [-1127.203] (-1132.277) (-1132.320) * (-1129.615) [-1132.385] (-1129.255) (-1127.814) -- 0:00:26
572500 -- [-1128.800] (-1128.450) (-1129.711) (-1129.256) * [-1129.427] (-1129.341) (-1127.748) (-1132.190) -- 0:00:26
573000 -- (-1127.457) [-1128.458] (-1127.662) (-1131.521) * (-1127.621) (-1136.226) (-1127.530) [-1130.650] -- 0:00:26
573500 -- [-1127.436] (-1129.662) (-1127.955) (-1131.383) * [-1127.109] (-1133.432) (-1127.947) (-1132.259) -- 0:00:26
574000 -- (-1135.174) [-1133.695] (-1127.731) (-1130.295) * (-1127.329) [-1131.435] (-1130.953) (-1139.703) -- 0:00:26
574500 -- [-1130.869] (-1134.355) (-1130.030) (-1131.475) * (-1128.267) (-1129.788) [-1127.952] (-1136.547) -- 0:00:26
575000 -- (-1130.885) [-1129.821] (-1130.290) (-1132.479) * (-1128.041) [-1128.470] (-1128.625) (-1135.787) -- 0:00:26
Average standard deviation of split frequencies: 0.008858
575500 -- (-1128.562) [-1130.529] (-1129.178) (-1128.804) * (-1128.216) (-1128.034) (-1129.256) [-1132.129] -- 0:00:26
576000 -- (-1127.989) (-1128.711) (-1129.300) [-1128.941] * (-1127.395) [-1127.570] (-1129.350) (-1132.771) -- 0:00:26
576500 -- (-1127.282) (-1131.314) [-1128.130] (-1130.282) * (-1135.404) (-1129.855) [-1130.254] (-1130.692) -- 0:00:26
577000 -- (-1128.383) (-1129.363) [-1127.745] (-1132.268) * (-1128.308) [-1128.263] (-1126.882) (-1130.390) -- 0:00:26
577500 -- (-1131.337) (-1128.291) (-1129.644) [-1132.152] * (-1129.673) (-1127.911) [-1126.938] (-1130.236) -- 0:00:26
578000 -- (-1132.944) [-1127.561] (-1128.059) (-1134.547) * [-1131.779] (-1127.822) (-1130.148) (-1127.770) -- 0:00:26
578500 -- (-1130.265) [-1128.641] (-1129.797) (-1130.537) * [-1134.654] (-1129.200) (-1129.373) (-1127.850) -- 0:00:26
579000 -- (-1128.019) (-1131.781) [-1131.742] (-1128.084) * (-1131.961) [-1131.040] (-1130.834) (-1129.828) -- 0:00:26
579500 -- (-1129.043) (-1132.433) (-1129.842) [-1128.547] * (-1129.659) (-1130.362) [-1128.937] (-1128.179) -- 0:00:26
580000 -- (-1130.275) (-1128.897) [-1127.587] (-1129.675) * [-1130.492] (-1131.029) (-1127.827) (-1129.494) -- 0:00:26
Average standard deviation of split frequencies: 0.009169
580500 -- (-1129.157) [-1128.575] (-1130.997) (-1129.333) * (-1129.805) (-1131.170) (-1129.500) [-1129.817] -- 0:00:26
581000 -- (-1132.792) [-1128.517] (-1129.179) (-1128.035) * (-1131.129) [-1128.852] (-1129.171) (-1129.956) -- 0:00:26
581500 -- (-1129.022) (-1129.414) [-1127.657] (-1127.937) * (-1129.870) (-1128.029) (-1129.978) [-1130.642] -- 0:00:26
582000 -- (-1129.977) (-1131.557) (-1127.528) [-1127.203] * (-1129.975) (-1128.349) [-1133.192] (-1129.880) -- 0:00:26
582500 -- (-1131.127) [-1132.643] (-1129.138) (-1130.313) * (-1128.937) (-1128.010) [-1132.440] (-1129.299) -- 0:00:26
583000 -- (-1127.970) [-1127.379] (-1132.221) (-1129.682) * (-1131.295) (-1128.479) (-1128.733) [-1128.240] -- 0:00:26
583500 -- (-1129.083) [-1127.589] (-1130.559) (-1128.558) * (-1130.378) [-1128.636] (-1128.233) (-1128.855) -- 0:00:26
584000 -- [-1128.589] (-1127.756) (-1131.142) (-1128.743) * (-1130.305) [-1128.228] (-1128.489) (-1127.428) -- 0:00:26
584500 -- (-1127.462) (-1128.110) [-1130.294] (-1129.344) * (-1129.497) (-1132.612) [-1128.134] (-1130.375) -- 0:00:26
585000 -- [-1128.396] (-1130.664) (-1130.539) (-1129.400) * (-1129.711) [-1128.213] (-1128.010) (-1132.131) -- 0:00:26
Average standard deviation of split frequencies: 0.008849
585500 -- [-1129.119] (-1128.199) (-1129.498) (-1128.842) * (-1128.037) (-1134.427) (-1128.325) [-1127.785] -- 0:00:26
586000 -- (-1131.024) [-1129.844] (-1131.016) (-1127.003) * (-1128.811) [-1132.170] (-1127.360) (-1129.431) -- 0:00:26
586500 -- (-1132.416) (-1128.298) (-1132.857) [-1127.062] * (-1127.492) (-1129.894) [-1129.525] (-1127.199) -- 0:00:26
587000 -- (-1129.589) (-1133.529) [-1131.509] (-1130.580) * (-1127.632) (-1130.200) [-1132.872] (-1128.261) -- 0:00:26
587500 -- (-1128.357) (-1129.081) [-1133.563] (-1131.456) * (-1129.337) (-1129.366) (-1131.751) [-1131.392] -- 0:00:25
588000 -- [-1131.118] (-1132.340) (-1130.568) (-1128.709) * (-1129.247) [-1130.401] (-1129.317) (-1129.493) -- 0:00:25
588500 -- (-1131.830) (-1127.808) (-1127.390) [-1129.295] * (-1130.384) [-1130.851] (-1128.775) (-1129.972) -- 0:00:25
589000 -- (-1129.167) (-1128.081) [-1127.908] (-1129.047) * (-1132.243) (-1132.878) [-1129.399] (-1132.010) -- 0:00:25
589500 -- (-1127.640) (-1127.826) (-1134.088) [-1129.140] * (-1131.027) (-1132.809) [-1131.568] (-1128.461) -- 0:00:25
590000 -- [-1127.340] (-1129.436) (-1130.117) (-1128.914) * (-1128.057) (-1131.504) (-1131.318) [-1130.468] -- 0:00:25
Average standard deviation of split frequencies: 0.008685
590500 -- [-1128.062] (-1127.061) (-1136.169) (-1129.532) * (-1128.513) (-1128.598) (-1130.951) [-1129.316] -- 0:00:25
591000 -- (-1128.416) [-1132.113] (-1133.520) (-1130.253) * (-1130.240) [-1128.747] (-1129.553) (-1129.619) -- 0:00:25
591500 -- (-1129.796) (-1130.063) [-1128.868] (-1128.126) * (-1127.990) (-1130.564) (-1128.065) [-1127.831] -- 0:00:25
592000 -- (-1129.360) (-1131.644) (-1135.638) [-1128.517] * (-1129.674) [-1129.173] (-1129.302) (-1127.918) -- 0:00:25
592500 -- (-1129.753) (-1137.817) [-1131.193] (-1130.534) * [-1129.635] (-1130.140) (-1129.681) (-1127.830) -- 0:00:25
593000 -- [-1127.991] (-1129.860) (-1128.350) (-1131.317) * (-1129.835) (-1128.755) [-1129.306] (-1131.565) -- 0:00:25
593500 -- (-1130.057) [-1129.386] (-1127.973) (-1128.867) * [-1129.505] (-1129.023) (-1132.296) (-1128.120) -- 0:00:25
594000 -- (-1128.215) [-1129.889] (-1126.966) (-1128.715) * (-1130.817) (-1130.225) (-1130.729) [-1131.544] -- 0:00:25
594500 -- (-1130.061) (-1127.695) (-1129.354) [-1128.882] * (-1129.219) (-1133.908) (-1127.565) [-1127.663] -- 0:00:25
595000 -- (-1135.997) (-1135.680) [-1128.626] (-1132.346) * (-1130.444) (-1136.243) [-1129.716] (-1128.670) -- 0:00:25
Average standard deviation of split frequencies: 0.009026
595500 -- (-1133.378) [-1127.571] (-1133.272) (-1129.468) * (-1128.782) (-1133.032) (-1131.314) [-1130.590] -- 0:00:25
596000 -- (-1128.391) (-1127.886) [-1128.329] (-1129.111) * (-1130.803) (-1130.425) (-1130.176) [-1131.252] -- 0:00:25
596500 -- (-1132.459) (-1131.360) [-1128.366] (-1131.927) * [-1129.065] (-1131.735) (-1133.240) (-1129.092) -- 0:00:25
597000 -- (-1129.242) [-1130.268] (-1130.240) (-1127.924) * [-1129.414] (-1131.820) (-1131.569) (-1129.514) -- 0:00:25
597500 -- (-1127.230) (-1134.377) (-1127.873) [-1130.136] * (-1128.588) (-1128.996) (-1131.016) [-1128.676] -- 0:00:25
598000 -- (-1127.019) (-1129.548) (-1128.882) [-1128.186] * (-1128.657) (-1129.712) (-1130.866) [-1130.261] -- 0:00:25
598500 -- [-1128.062] (-1127.458) (-1128.765) (-1128.693) * [-1127.593] (-1129.712) (-1130.767) (-1131.431) -- 0:00:25
599000 -- [-1129.285] (-1128.040) (-1130.090) (-1132.671) * (-1127.631) [-1127.373] (-1131.864) (-1129.395) -- 0:00:25
599500 -- (-1134.315) (-1127.997) (-1138.427) [-1130.048] * (-1128.808) (-1128.993) [-1135.591] (-1131.099) -- 0:00:25
600000 -- [-1131.409] (-1129.456) (-1129.239) (-1131.861) * (-1128.260) (-1128.236) (-1131.038) [-1134.214] -- 0:00:25
Average standard deviation of split frequencies: 0.008540
600500 -- (-1128.639) (-1128.836) [-1130.260] (-1129.931) * [-1129.699] (-1130.156) (-1130.023) (-1130.771) -- 0:00:25
601000 -- (-1132.450) (-1129.755) (-1130.611) [-1129.742] * [-1130.678] (-1130.859) (-1128.018) (-1129.407) -- 0:00:25
601500 -- [-1129.234] (-1128.700) (-1127.874) (-1129.633) * (-1128.581) (-1128.424) (-1133.438) [-1127.696] -- 0:00:25
602000 -- (-1128.296) (-1128.214) [-1128.341] (-1128.756) * (-1131.522) (-1128.558) (-1129.611) [-1129.406] -- 0:00:25
602500 -- (-1127.688) (-1128.822) [-1130.663] (-1127.434) * (-1130.369) (-1128.378) (-1130.622) [-1129.824] -- 0:00:25
603000 -- (-1128.874) (-1128.398) (-1129.956) [-1128.676] * (-1127.977) (-1133.266) (-1133.279) [-1128.250] -- 0:00:25
603500 -- [-1132.481] (-1130.754) (-1131.333) (-1130.799) * (-1128.196) [-1131.032] (-1133.190) (-1127.771) -- 0:00:24
604000 -- (-1129.411) (-1131.546) [-1128.172] (-1127.972) * (-1129.381) (-1130.210) (-1134.269) [-1128.282] -- 0:00:24
604500 -- (-1129.221) [-1128.900] (-1130.166) (-1129.971) * (-1129.629) (-1127.598) (-1130.561) [-1131.815] -- 0:00:24
605000 -- [-1127.477] (-1131.036) (-1129.919) (-1129.890) * (-1127.719) (-1128.067) [-1129.810] (-1134.181) -- 0:00:24
Average standard deviation of split frequencies: 0.008282
605500 -- (-1130.756) (-1127.794) (-1129.760) [-1130.174] * (-1128.322) (-1128.745) (-1130.964) [-1128.255] -- 0:00:24
606000 -- (-1131.016) [-1128.328] (-1128.775) (-1133.070) * [-1128.617] (-1134.982) (-1130.644) (-1130.064) -- 0:00:24
606500 -- (-1130.040) (-1130.858) (-1128.297) [-1132.019] * (-1127.873) (-1130.213) (-1130.295) [-1129.041] -- 0:00:24
607000 -- (-1130.425) (-1134.445) [-1130.316] (-1128.292) * [-1129.348] (-1129.686) (-1130.193) (-1128.500) -- 0:00:24
607500 -- (-1129.392) [-1128.652] (-1129.718) (-1129.094) * (-1129.857) (-1129.784) (-1129.102) [-1128.465] -- 0:00:24
608000 -- (-1127.873) (-1130.147) [-1128.468] (-1128.946) * (-1129.908) (-1128.306) [-1127.876] (-1129.917) -- 0:00:24
608500 -- (-1132.703) [-1128.565] (-1128.009) (-1130.282) * [-1129.588] (-1128.362) (-1129.418) (-1129.965) -- 0:00:24
609000 -- (-1129.741) (-1129.242) (-1128.978) [-1129.096] * (-1128.925) (-1130.019) [-1128.022] (-1128.368) -- 0:00:24
609500 -- (-1128.185) (-1127.252) (-1128.706) [-1129.361] * (-1127.935) [-1129.009] (-1129.723) (-1131.719) -- 0:00:24
610000 -- [-1130.942] (-1127.925) (-1129.113) (-1128.332) * (-1127.976) (-1128.332) [-1128.009] (-1129.664) -- 0:00:24
Average standard deviation of split frequencies: 0.008401
610500 -- (-1130.107) (-1129.214) (-1129.063) [-1127.865] * [-1129.137] (-1129.993) (-1127.404) (-1128.869) -- 0:00:24
611000 -- (-1131.860) (-1129.064) (-1129.583) [-1127.193] * (-1129.302) (-1129.843) [-1127.578] (-1130.905) -- 0:00:24
611500 -- (-1127.896) (-1131.147) [-1129.379] (-1127.477) * (-1128.811) [-1130.550] (-1128.016) (-1134.572) -- 0:00:24
612000 -- (-1127.640) [-1130.888] (-1128.218) (-1130.585) * (-1127.353) (-1133.099) (-1129.858) [-1131.035] -- 0:00:24
612500 -- (-1129.468) (-1130.692) [-1131.646] (-1129.449) * (-1128.237) (-1131.503) (-1128.947) [-1130.578] -- 0:00:24
613000 -- (-1129.792) (-1127.560) (-1127.613) [-1130.147] * (-1129.824) [-1128.073] (-1129.114) (-1130.283) -- 0:00:24
613500 -- (-1127.336) (-1130.233) [-1128.834] (-1127.361) * (-1128.276) (-1128.112) (-1127.605) [-1130.928] -- 0:00:24
614000 -- (-1130.115) (-1128.799) (-1129.725) [-1130.476] * (-1127.070) (-1129.102) (-1127.925) [-1132.229] -- 0:00:24
614500 -- (-1131.695) (-1129.941) (-1130.472) [-1129.064] * (-1129.937) (-1130.592) (-1132.699) [-1127.521] -- 0:00:24
615000 -- (-1129.547) [-1131.278] (-1138.896) (-1128.322) * [-1129.588] (-1132.003) (-1128.663) (-1127.773) -- 0:00:24
Average standard deviation of split frequencies: 0.008148
615500 -- [-1130.704] (-1130.069) (-1130.093) (-1129.717) * (-1128.666) (-1138.282) (-1129.719) [-1131.704] -- 0:00:24
616000 -- (-1129.653) (-1128.580) [-1128.539] (-1138.057) * (-1127.164) (-1127.801) (-1127.415) [-1140.417] -- 0:00:24
616500 -- (-1128.326) (-1129.741) (-1130.770) [-1136.386] * [-1129.505] (-1127.455) (-1127.391) (-1131.030) -- 0:00:24
617000 -- [-1127.865] (-1127.916) (-1127.393) (-1134.366) * (-1130.309) [-1129.568] (-1128.852) (-1128.221) -- 0:00:24
617500 -- (-1127.477) (-1132.475) (-1130.197) [-1130.184] * (-1130.096) (-1131.128) [-1127.706] (-1129.244) -- 0:00:24
618000 -- [-1127.640] (-1131.851) (-1130.382) (-1128.387) * [-1129.672] (-1128.951) (-1129.675) (-1127.348) -- 0:00:24
618500 -- (-1128.356) [-1127.926] (-1130.521) (-1128.048) * (-1127.502) (-1129.352) (-1127.106) [-1129.608] -- 0:00:24
619000 -- [-1128.642] (-1127.926) (-1132.932) (-1127.896) * [-1129.149] (-1129.239) (-1131.789) (-1129.017) -- 0:00:24
619500 -- (-1132.032) (-1127.833) (-1130.882) [-1127.406] * [-1128.441] (-1127.262) (-1127.687) (-1128.515) -- 0:00:23
620000 -- (-1131.301) (-1129.086) (-1128.731) [-1130.275] * [-1128.861] (-1129.464) (-1129.557) (-1133.780) -- 0:00:23
Average standard deviation of split frequencies: 0.007372
620500 -- (-1131.650) (-1129.515) (-1130.970) [-1132.987] * [-1133.015] (-1128.881) (-1128.100) (-1130.385) -- 0:00:23
621000 -- (-1128.789) (-1129.470) (-1137.435) [-1128.301] * (-1130.850) [-1127.796] (-1128.234) (-1126.985) -- 0:00:23
621500 -- (-1127.650) (-1128.976) [-1130.842] (-1128.973) * (-1127.833) [-1128.084] (-1127.270) (-1129.432) -- 0:00:23
622000 -- [-1128.393] (-1133.311) (-1130.710) (-1131.689) * (-1128.256) [-1129.101] (-1129.186) (-1129.244) -- 0:00:23
622500 -- (-1128.713) (-1131.110) (-1127.856) [-1127.577] * (-1130.278) (-1128.317) (-1128.560) [-1127.795] -- 0:00:23
623000 -- (-1130.872) (-1131.197) [-1131.582] (-1129.584) * (-1127.621) [-1128.705] (-1131.032) (-1128.633) -- 0:00:23
623500 -- [-1128.666] (-1130.905) (-1136.265) (-1129.727) * (-1128.225) (-1129.924) [-1129.486] (-1128.567) -- 0:00:23
624000 -- (-1127.851) (-1128.209) (-1130.213) [-1128.701] * (-1127.784) (-1129.358) [-1127.840] (-1128.792) -- 0:00:23
624500 -- [-1128.391] (-1128.180) (-1130.508) (-1130.434) * (-1129.639) (-1127.960) [-1127.625] (-1129.291) -- 0:00:23
625000 -- (-1128.819) [-1128.581] (-1130.361) (-1131.113) * (-1129.446) (-1130.865) [-1130.382] (-1129.053) -- 0:00:23
Average standard deviation of split frequencies: 0.007486
625500 -- (-1127.990) (-1128.273) (-1128.726) [-1128.425] * (-1129.415) (-1134.250) (-1131.523) [-1128.254] -- 0:00:23
626000 -- (-1127.952) (-1131.951) (-1128.007) [-1129.077] * (-1129.555) (-1129.933) [-1130.627] (-1128.981) -- 0:00:23
626500 -- (-1127.682) (-1128.162) (-1130.731) [-1131.664] * [-1128.399] (-1128.238) (-1131.698) (-1128.108) -- 0:00:23
627000 -- (-1129.763) (-1132.773) (-1130.309) [-1131.452] * (-1128.584) [-1129.270] (-1127.513) (-1127.966) -- 0:00:23
627500 -- (-1130.337) (-1130.902) [-1127.902] (-1131.722) * (-1129.021) (-1128.535) (-1128.998) [-1133.580] -- 0:00:23
628000 -- (-1129.683) (-1130.888) (-1130.359) [-1127.725] * (-1130.304) (-1131.770) (-1134.072) [-1133.233] -- 0:00:23
628500 -- (-1135.578) [-1127.602] (-1129.353) (-1129.461) * (-1129.647) [-1132.795] (-1130.135) (-1130.297) -- 0:00:23
629000 -- [-1128.179] (-1128.174) (-1128.395) (-1130.683) * (-1128.733) (-1134.067) [-1129.600] (-1128.138) -- 0:00:23
629500 -- [-1130.203] (-1127.265) (-1129.638) (-1128.758) * (-1133.449) [-1133.235] (-1130.925) (-1129.822) -- 0:00:23
630000 -- [-1128.798] (-1127.650) (-1128.022) (-1129.099) * (-1128.547) (-1130.275) [-1129.494] (-1130.153) -- 0:00:23
Average standard deviation of split frequencies: 0.007563
630500 -- (-1128.857) (-1131.929) [-1130.464] (-1128.198) * (-1133.196) [-1128.201] (-1131.248) (-1130.012) -- 0:00:23
631000 -- (-1127.674) [-1128.230] (-1130.092) (-1129.590) * (-1133.363) (-1127.705) (-1128.397) [-1133.107] -- 0:00:23
631500 -- (-1129.084) [-1127.865] (-1137.095) (-1130.476) * (-1138.168) [-1128.631] (-1128.225) (-1130.208) -- 0:00:23
632000 -- [-1128.452] (-1131.572) (-1128.590) (-1129.109) * (-1130.823) (-1133.203) [-1129.173] (-1127.969) -- 0:00:23
632500 -- (-1129.357) (-1132.445) [-1128.315] (-1130.371) * (-1135.232) (-1129.508) (-1130.928) [-1128.845] -- 0:00:23
633000 -- (-1131.473) (-1128.167) (-1129.068) [-1129.286] * (-1128.216) [-1131.177] (-1135.466) (-1132.568) -- 0:00:23
633500 -- (-1134.929) [-1128.104] (-1133.205) (-1128.911) * (-1129.856) (-1130.958) [-1130.403] (-1131.853) -- 0:00:23
634000 -- (-1132.372) [-1131.046] (-1130.772) (-1130.042) * (-1128.495) (-1132.013) (-1130.716) [-1128.916] -- 0:00:23
634500 -- (-1131.244) [-1129.704] (-1128.229) (-1128.551) * [-1129.494] (-1129.720) (-1128.827) (-1128.693) -- 0:00:23
635000 -- (-1131.156) [-1128.841] (-1128.881) (-1127.576) * [-1127.812] (-1130.965) (-1131.960) (-1127.808) -- 0:00:22
Average standard deviation of split frequencies: 0.007586
635500 -- (-1130.508) (-1127.497) [-1133.644] (-1131.996) * (-1129.802) (-1129.572) (-1129.090) [-1130.940] -- 0:00:22
636000 -- [-1129.516] (-1127.263) (-1129.221) (-1130.328) * (-1128.654) (-1131.494) (-1131.227) [-1128.457] -- 0:00:22
636500 -- (-1127.813) (-1129.843) (-1127.872) [-1128.917] * [-1128.082] (-1130.320) (-1134.484) (-1129.640) -- 0:00:22
637000 -- (-1127.600) [-1129.273] (-1127.692) (-1128.724) * (-1129.342) [-1127.935] (-1130.167) (-1131.672) -- 0:00:22
637500 -- (-1128.321) (-1129.099) [-1127.956] (-1129.603) * [-1129.062] (-1127.109) (-1130.453) (-1128.215) -- 0:00:22
638000 -- [-1128.519] (-1129.180) (-1127.899) (-1133.500) * [-1131.854] (-1128.686) (-1131.690) (-1129.725) -- 0:00:22
638500 -- (-1127.817) [-1129.589] (-1129.551) (-1135.112) * (-1129.012) (-1131.333) (-1128.948) [-1128.595] -- 0:00:22
639000 -- (-1128.411) (-1132.686) (-1127.789) [-1128.804] * (-1129.937) (-1130.912) [-1129.019] (-1129.294) -- 0:00:22
639500 -- [-1128.268] (-1127.307) (-1127.626) (-1129.344) * (-1127.847) (-1130.628) (-1129.594) [-1128.674] -- 0:00:22
640000 -- [-1128.306] (-1129.124) (-1128.970) (-1131.328) * [-1132.883] (-1128.327) (-1130.099) (-1132.027) -- 0:00:22
Average standard deviation of split frequencies: 0.007012
640500 -- [-1130.143] (-1129.142) (-1129.416) (-1130.463) * (-1131.565) (-1128.410) (-1127.728) [-1129.492] -- 0:00:22
641000 -- [-1128.397] (-1128.832) (-1130.420) (-1129.616) * (-1133.145) (-1132.130) (-1131.106) [-1128.242] -- 0:00:22
641500 -- (-1127.464) (-1131.504) (-1128.799) [-1129.835] * [-1129.030] (-1127.405) (-1129.729) (-1128.140) -- 0:00:22
642000 -- (-1128.046) (-1131.188) [-1128.311] (-1131.116) * (-1128.063) (-1130.867) [-1128.189] (-1131.374) -- 0:00:22
642500 -- (-1131.021) [-1129.363] (-1129.714) (-1129.313) * (-1127.883) [-1127.193] (-1128.266) (-1130.860) -- 0:00:22
643000 -- [-1130.632] (-1129.338) (-1130.147) (-1131.513) * [-1128.068] (-1127.279) (-1131.182) (-1129.625) -- 0:00:22
643500 -- (-1128.891) [-1128.419] (-1129.920) (-1128.840) * (-1127.449) (-1127.203) [-1129.807] (-1127.996) -- 0:00:22
644000 -- (-1133.339) (-1129.178) [-1129.918] (-1128.015) * [-1127.645] (-1130.542) (-1129.772) (-1127.952) -- 0:00:22
644500 -- [-1129.251] (-1130.955) (-1128.689) (-1127.684) * [-1127.578] (-1130.534) (-1130.031) (-1127.153) -- 0:00:22
645000 -- (-1128.231) (-1133.100) [-1127.780] (-1128.076) * (-1128.638) (-1128.818) (-1127.622) [-1127.676] -- 0:00:22
Average standard deviation of split frequencies: 0.007169
645500 -- [-1129.919] (-1136.689) (-1128.142) (-1132.362) * [-1127.946] (-1128.796) (-1128.424) (-1130.535) -- 0:00:22
646000 -- (-1128.665) [-1129.395] (-1128.550) (-1130.527) * (-1130.430) (-1129.323) (-1129.254) [-1129.868] -- 0:00:22
646500 -- (-1129.016) (-1127.055) [-1128.867] (-1129.601) * (-1127.414) (-1130.507) [-1128.983] (-1130.325) -- 0:00:22
647000 -- (-1132.730) (-1128.176) [-1131.805] (-1130.719) * (-1127.837) (-1131.035) [-1129.271] (-1130.011) -- 0:00:22
647500 -- [-1141.513] (-1128.885) (-1128.529) (-1129.392) * (-1128.610) (-1129.426) (-1132.570) [-1128.789] -- 0:00:22
648000 -- (-1136.684) [-1128.327] (-1128.582) (-1131.037) * (-1129.231) (-1127.990) (-1127.736) [-1131.248] -- 0:00:22
648500 -- (-1130.525) (-1132.243) (-1128.774) [-1130.330] * (-1128.434) (-1133.357) (-1128.770) [-1131.151] -- 0:00:22
649000 -- [-1130.783] (-1127.354) (-1128.280) (-1131.638) * (-1127.962) (-1131.439) (-1131.080) [-1129.896] -- 0:00:22
649500 -- [-1133.158] (-1131.481) (-1128.069) (-1128.732) * [-1129.855] (-1134.302) (-1129.608) (-1130.174) -- 0:00:22
650000 -- (-1128.168) (-1131.394) [-1132.307] (-1127.682) * (-1129.615) [-1129.651] (-1129.852) (-1128.602) -- 0:00:22
Average standard deviation of split frequencies: 0.007330
650500 -- (-1131.471) (-1132.786) [-1130.468] (-1128.110) * [-1129.737] (-1128.456) (-1130.737) (-1129.078) -- 0:00:22
651000 -- (-1128.137) (-1130.540) [-1134.568] (-1133.491) * (-1129.347) (-1127.404) (-1128.245) [-1129.073] -- 0:00:21
651500 -- (-1128.043) (-1130.889) (-1127.818) [-1128.482] * (-1131.504) (-1127.638) [-1128.446] (-1129.326) -- 0:00:21
652000 -- (-1129.072) [-1132.136] (-1128.304) (-1133.159) * [-1132.531] (-1131.350) (-1129.544) (-1128.468) -- 0:00:21
652500 -- (-1127.734) [-1129.901] (-1127.936) (-1129.103) * (-1131.337) (-1132.387) (-1130.260) [-1127.444] -- 0:00:21
653000 -- [-1127.598] (-1128.185) (-1129.741) (-1130.576) * (-1127.990) (-1130.933) (-1130.164) [-1127.411] -- 0:00:21
653500 -- (-1127.965) (-1127.750) (-1128.873) [-1128.217] * (-1128.103) (-1133.052) [-1128.439] (-1127.586) -- 0:00:21
654000 -- (-1127.914) [-1135.137] (-1130.140) (-1128.554) * (-1128.802) [-1127.078] (-1129.643) (-1127.734) -- 0:00:21
654500 -- (-1132.593) (-1128.762) [-1129.880] (-1128.233) * [-1131.850] (-1131.338) (-1127.511) (-1128.037) -- 0:00:21
655000 -- (-1128.660) (-1129.452) (-1127.893) [-1129.538] * (-1132.157) (-1130.150) [-1127.597] (-1129.703) -- 0:00:21
Average standard deviation of split frequencies: 0.007947
655500 -- (-1128.480) (-1128.078) (-1128.657) [-1134.108] * (-1128.802) [-1128.731] (-1127.415) (-1127.915) -- 0:00:21
656000 -- (-1128.082) (-1127.724) [-1129.855] (-1135.438) * (-1129.093) [-1130.606] (-1127.380) (-1129.913) -- 0:00:21
656500 -- (-1133.992) (-1127.689) (-1132.204) [-1127.567] * (-1128.719) [-1130.870] (-1127.397) (-1132.737) -- 0:00:21
657000 -- (-1132.492) (-1128.510) (-1127.591) [-1127.327] * (-1128.418) (-1130.372) [-1128.054] (-1128.985) -- 0:00:21
657500 -- [-1130.326] (-1129.961) (-1131.461) (-1130.803) * (-1128.520) (-1130.864) [-1128.814] (-1129.302) -- 0:00:21
658000 -- (-1129.044) (-1130.133) (-1127.264) [-1129.993] * [-1128.695] (-1130.129) (-1128.231) (-1128.035) -- 0:00:21
658500 -- (-1129.904) (-1128.069) (-1127.790) [-1127.590] * (-1133.398) (-1132.651) [-1128.101] (-1127.981) -- 0:00:21
659000 -- (-1130.897) (-1129.061) [-1129.773] (-1129.451) * (-1130.018) (-1130.357) (-1130.335) [-1127.486] -- 0:00:21
659500 -- (-1128.678) (-1127.646) (-1127.527) [-1129.532] * (-1130.712) (-1127.954) (-1128.625) [-1128.361] -- 0:00:21
660000 -- (-1129.894) [-1127.394] (-1130.829) (-1128.792) * (-1128.800) [-1128.646] (-1129.428) (-1128.556) -- 0:00:21
Average standard deviation of split frequencies: 0.008101
660500 -- (-1132.493) (-1128.090) (-1131.330) [-1128.810] * [-1129.178] (-1127.375) (-1129.496) (-1127.982) -- 0:00:21
661000 -- [-1129.554] (-1128.188) (-1129.399) (-1132.731) * (-1130.701) (-1130.488) [-1129.976] (-1127.837) -- 0:00:21
661500 -- (-1132.500) (-1128.704) (-1130.563) [-1129.525] * (-1131.461) [-1127.564] (-1131.453) (-1127.698) -- 0:00:21
662000 -- (-1139.756) (-1129.706) (-1131.241) [-1130.595] * (-1130.636) (-1135.563) (-1127.469) [-1130.067] -- 0:00:21
662500 -- [-1130.716] (-1129.511) (-1135.084) (-1135.768) * (-1127.661) (-1130.296) (-1128.738) [-1129.655] -- 0:00:21
663000 -- (-1128.820) (-1128.123) (-1129.850) [-1130.804] * [-1127.765] (-1127.799) (-1131.884) (-1133.274) -- 0:00:21
663500 -- (-1128.336) (-1131.457) [-1130.610] (-1129.641) * (-1127.493) (-1130.366) [-1128.528] (-1133.223) -- 0:00:21
664000 -- (-1128.243) [-1127.959] (-1127.862) (-1133.713) * (-1128.308) [-1128.243] (-1128.220) (-1132.435) -- 0:00:21
664500 -- (-1130.319) (-1131.082) [-1128.153] (-1130.209) * (-1128.534) [-1130.623] (-1128.740) (-1129.267) -- 0:00:21
665000 -- (-1129.419) (-1131.733) [-1129.366] (-1127.688) * [-1128.600] (-1129.982) (-1129.018) (-1128.530) -- 0:00:21
Average standard deviation of split frequencies: 0.008286
665500 -- (-1128.407) (-1129.643) (-1128.949) [-1127.428] * [-1128.336] (-1127.096) (-1128.484) (-1129.862) -- 0:00:21
666000 -- (-1129.564) (-1127.520) [-1134.406] (-1132.955) * (-1133.149) [-1129.227] (-1129.642) (-1129.973) -- 0:00:21
666500 -- [-1129.738] (-1127.703) (-1132.152) (-1127.201) * (-1128.338) (-1128.861) (-1128.263) [-1130.363] -- 0:00:21
667000 -- [-1132.233] (-1130.608) (-1129.802) (-1129.999) * (-1127.536) (-1128.909) [-1127.638] (-1129.498) -- 0:00:20
667500 -- (-1129.515) (-1128.593) [-1128.294] (-1128.325) * (-1128.584) [-1127.158] (-1131.157) (-1131.377) -- 0:00:20
668000 -- (-1128.876) (-1127.701) [-1129.171] (-1129.387) * (-1131.905) [-1127.432] (-1128.189) (-1135.272) -- 0:00:20
668500 -- [-1128.821] (-1127.894) (-1128.543) (-1130.062) * (-1131.045) [-1127.499] (-1129.527) (-1128.243) -- 0:00:20
669000 -- (-1128.992) (-1127.695) (-1128.298) [-1130.465] * (-1127.728) (-1129.815) [-1131.765] (-1129.758) -- 0:00:20
669500 -- (-1130.141) (-1130.375) (-1129.883) [-1132.375] * (-1128.334) (-1134.910) (-1129.868) [-1128.821] -- 0:00:20
670000 -- [-1128.087] (-1129.394) (-1129.483) (-1128.969) * [-1128.802] (-1129.836) (-1128.047) (-1128.569) -- 0:00:20
Average standard deviation of split frequencies: 0.008393
670500 -- (-1127.200) [-1128.854] (-1129.428) (-1130.567) * (-1133.076) [-1129.544] (-1128.826) (-1129.895) -- 0:00:20
671000 -- (-1128.272) (-1128.122) (-1130.435) [-1129.272] * (-1129.438) [-1129.935] (-1130.246) (-1133.231) -- 0:00:20
671500 -- (-1130.685) [-1129.059] (-1127.430) (-1129.876) * [-1127.666] (-1128.601) (-1129.345) (-1128.942) -- 0:00:20
672000 -- (-1128.743) (-1131.657) (-1128.236) [-1128.237] * (-1127.683) [-1129.115] (-1128.722) (-1128.788) -- 0:00:20
672500 -- (-1129.386) (-1132.873) (-1127.276) [-1130.030] * (-1133.226) (-1127.976) [-1129.213] (-1129.028) -- 0:00:20
673000 -- (-1129.491) (-1129.868) [-1127.839] (-1127.934) * (-1132.434) [-1126.986] (-1128.509) (-1128.058) -- 0:00:20
673500 -- (-1129.349) (-1131.966) [-1127.477] (-1128.114) * (-1133.222) (-1129.839) [-1129.209] (-1128.981) -- 0:00:20
674000 -- (-1129.470) (-1127.242) (-1133.608) [-1129.563] * [-1131.127] (-1130.281) (-1132.606) (-1129.165) -- 0:00:20
674500 -- (-1129.032) (-1128.126) [-1128.486] (-1127.439) * (-1129.042) (-1129.826) (-1128.841) [-1127.634] -- 0:00:20
675000 -- (-1128.361) (-1129.293) [-1127.469] (-1128.486) * (-1130.811) (-1131.641) [-1129.337] (-1127.175) -- 0:00:20
Average standard deviation of split frequencies: 0.008450
675500 -- (-1129.030) (-1133.707) [-1127.777] (-1127.351) * (-1129.200) (-1133.516) [-1129.581] (-1127.626) -- 0:00:20
676000 -- (-1129.227) (-1128.456) (-1128.838) [-1129.759] * (-1129.481) (-1133.760) (-1130.364) [-1130.806] -- 0:00:20
676500 -- (-1129.531) [-1130.510] (-1130.844) (-1127.606) * (-1139.646) (-1134.699) (-1134.664) [-1132.775] -- 0:00:20
677000 -- (-1128.142) (-1129.884) (-1130.628) [-1128.311] * (-1131.478) (-1130.075) (-1127.515) [-1130.952] -- 0:00:20
677500 -- [-1130.433] (-1127.450) (-1130.003) (-1130.757) * (-1133.252) [-1128.293] (-1128.538) (-1130.230) -- 0:00:20
678000 -- (-1130.727) (-1127.807) [-1128.989] (-1128.804) * [-1127.693] (-1129.253) (-1127.905) (-1130.195) -- 0:00:20
678500 -- [-1129.663] (-1127.089) (-1131.519) (-1129.429) * [-1127.855] (-1128.289) (-1129.688) (-1131.750) -- 0:00:20
679000 -- (-1131.038) (-1128.434) (-1128.796) [-1128.793] * (-1130.612) (-1127.897) (-1128.722) [-1129.459] -- 0:00:20
679500 -- (-1130.875) (-1131.209) (-1129.044) [-1135.724] * (-1127.515) (-1131.464) (-1129.522) [-1128.207] -- 0:00:20
680000 -- [-1127.917] (-1128.547) (-1129.432) (-1130.679) * [-1127.307] (-1128.675) (-1129.514) (-1128.569) -- 0:00:20
Average standard deviation of split frequencies: 0.007964
680500 -- (-1128.686) (-1129.287) [-1133.062] (-1136.847) * (-1128.637) [-1127.678] (-1129.385) (-1129.876) -- 0:00:20
681000 -- (-1134.155) [-1127.581] (-1130.123) (-1128.703) * (-1131.536) [-1128.102] (-1128.497) (-1131.087) -- 0:00:20
681500 -- (-1127.270) (-1134.158) [-1129.982] (-1127.479) * (-1134.960) (-1131.376) [-1129.260] (-1131.456) -- 0:00:20
682000 -- (-1129.526) (-1132.769) (-1129.847) [-1127.598] * (-1132.688) (-1128.541) (-1129.246) [-1128.437] -- 0:00:20
682500 -- [-1127.611] (-1128.502) (-1129.787) (-1128.410) * (-1129.282) [-1128.322] (-1130.404) (-1128.438) -- 0:00:20
683000 -- (-1128.302) (-1128.185) (-1128.918) [-1128.451] * (-1134.130) [-1128.000] (-1128.172) (-1128.741) -- 0:00:19
683500 -- (-1131.181) [-1130.543] (-1128.772) (-1129.349) * (-1131.474) (-1127.710) [-1131.867] (-1128.098) -- 0:00:19
684000 -- (-1129.405) (-1129.955) (-1131.545) [-1129.113] * [-1128.215] (-1128.241) (-1130.498) (-1127.624) -- 0:00:19
684500 -- (-1128.608) (-1128.493) (-1130.331) [-1132.454] * (-1127.433) (-1128.989) [-1128.429] (-1129.813) -- 0:00:19
685000 -- [-1129.623] (-1130.493) (-1129.754) (-1129.260) * (-1133.795) (-1130.177) (-1128.328) [-1128.173] -- 0:00:19
Average standard deviation of split frequencies: 0.007988
685500 -- (-1136.329) [-1127.093] (-1132.881) (-1128.297) * [-1127.942] (-1128.070) (-1129.399) (-1128.173) -- 0:00:19
686000 -- (-1129.670) [-1129.506] (-1131.144) (-1130.786) * [-1127.506] (-1129.140) (-1128.756) (-1130.018) -- 0:00:19
686500 -- [-1129.980] (-1129.542) (-1127.610) (-1130.852) * (-1127.512) [-1127.954] (-1128.401) (-1129.547) -- 0:00:19
687000 -- [-1129.339] (-1131.203) (-1132.739) (-1127.797) * [-1128.439] (-1129.234) (-1134.287) (-1129.015) -- 0:00:19
687500 -- [-1127.880] (-1129.309) (-1130.841) (-1130.960) * (-1128.076) (-1130.186) (-1137.484) [-1128.176] -- 0:00:19
688000 -- (-1131.722) (-1128.005) (-1127.828) [-1130.917] * (-1127.729) (-1128.724) [-1128.963] (-1127.612) -- 0:00:19
688500 -- (-1134.357) [-1127.058] (-1130.233) (-1134.602) * [-1130.504] (-1129.916) (-1127.073) (-1130.590) -- 0:00:19
689000 -- (-1131.905) (-1130.192) [-1128.354] (-1130.422) * [-1130.699] (-1129.669) (-1128.026) (-1133.989) -- 0:00:19
689500 -- (-1130.995) (-1131.601) [-1127.462] (-1128.933) * (-1128.858) (-1127.617) [-1127.838] (-1134.362) -- 0:00:19
690000 -- (-1128.845) (-1127.047) [-1127.646] (-1128.877) * (-1127.425) (-1127.828) [-1127.996] (-1134.926) -- 0:00:19
Average standard deviation of split frequencies: 0.007977
690500 -- [-1129.773] (-1127.031) (-1128.883) (-1129.586) * (-1127.493) (-1129.044) (-1130.464) [-1131.046] -- 0:00:19
691000 -- (-1131.695) (-1130.455) (-1128.690) [-1127.656] * [-1127.588] (-1127.078) (-1130.471) (-1130.898) -- 0:00:19
691500 -- (-1132.609) (-1129.650) [-1128.743] (-1129.116) * (-1127.547) [-1127.078] (-1128.578) (-1129.176) -- 0:00:19
692000 -- (-1128.548) (-1128.771) (-1130.517) [-1128.037] * (-1129.934) (-1127.790) [-1134.853] (-1128.481) -- 0:00:19
692500 -- (-1130.572) [-1129.185] (-1129.266) (-1132.180) * (-1131.942) (-1127.300) (-1128.467) [-1128.451] -- 0:00:19
693000 -- (-1127.649) (-1129.556) (-1129.765) [-1131.350] * [-1131.466] (-1127.352) (-1129.165) (-1136.024) -- 0:00:19
693500 -- (-1127.995) [-1129.577] (-1128.016) (-1128.406) * (-1128.695) (-1129.115) [-1127.683] (-1129.025) -- 0:00:19
694000 -- (-1127.652) [-1132.422] (-1129.187) (-1128.400) * (-1128.068) [-1133.421] (-1127.973) (-1130.567) -- 0:00:19
694500 -- (-1128.286) (-1128.434) [-1131.824] (-1129.807) * (-1130.648) (-1130.637) [-1130.150] (-1132.746) -- 0:00:19
695000 -- (-1128.130) [-1129.695] (-1127.228) (-1132.423) * [-1131.516] (-1133.510) (-1129.739) (-1128.243) -- 0:00:19
Average standard deviation of split frequencies: 0.008367
695500 -- (-1135.641) (-1139.151) [-1127.527] (-1127.457) * (-1129.058) [-1134.886] (-1127.474) (-1129.306) -- 0:00:19
696000 -- (-1129.888) (-1130.630) [-1129.088] (-1128.700) * (-1129.495) [-1127.576] (-1127.653) (-1132.100) -- 0:00:19
696500 -- (-1130.164) (-1129.993) (-1128.140) [-1126.911] * [-1129.361] (-1128.912) (-1128.605) (-1130.743) -- 0:00:19
697000 -- [-1128.159] (-1129.210) (-1138.688) (-1128.550) * (-1128.929) [-1129.974] (-1127.644) (-1132.668) -- 0:00:19
697500 -- (-1129.537) [-1129.819] (-1130.848) (-1129.731) * (-1129.406) (-1129.047) [-1130.046] (-1127.659) -- 0:00:19
698000 -- (-1127.452) (-1128.946) [-1132.199] (-1131.805) * [-1128.723] (-1128.029) (-1130.577) (-1127.785) -- 0:00:19
698500 -- (-1131.620) (-1132.729) [-1127.700] (-1130.524) * (-1130.413) (-1128.674) (-1131.901) [-1128.963] -- 0:00:18
699000 -- (-1128.281) (-1131.979) [-1129.228] (-1129.246) * [-1128.451] (-1128.674) (-1129.338) (-1128.592) -- 0:00:18
699500 -- (-1128.053) (-1129.135) [-1131.973] (-1130.311) * (-1130.055) [-1129.061] (-1129.563) (-1132.041) -- 0:00:18
700000 -- (-1128.584) (-1129.278) [-1133.834] (-1130.088) * (-1129.856) (-1129.159) (-1129.810) [-1128.566] -- 0:00:18
Average standard deviation of split frequencies: 0.008074
700500 -- [-1128.232] (-1129.192) (-1131.371) (-1129.065) * (-1130.272) [-1131.102] (-1130.889) (-1128.878) -- 0:00:18
701000 -- (-1128.494) (-1129.810) [-1130.219] (-1131.115) * (-1128.818) (-1128.487) [-1129.951] (-1130.987) -- 0:00:18
701500 -- [-1129.901] (-1127.678) (-1129.871) (-1130.521) * [-1128.161] (-1129.072) (-1128.456) (-1134.100) -- 0:00:18
702000 -- (-1127.576) (-1128.312) [-1128.977] (-1128.440) * (-1127.979) [-1127.836] (-1129.791) (-1132.337) -- 0:00:18
702500 -- (-1131.271) (-1127.223) [-1132.929] (-1129.480) * (-1130.708) [-1130.212] (-1128.840) (-1131.539) -- 0:00:18
703000 -- (-1129.718) [-1127.993] (-1132.208) (-1130.104) * [-1131.678] (-1128.457) (-1129.150) (-1130.211) -- 0:00:18
703500 -- (-1134.996) [-1128.031] (-1132.509) (-1129.024) * (-1128.719) (-1129.344) (-1131.780) [-1130.107] -- 0:00:18
704000 -- (-1130.218) (-1128.094) (-1128.805) [-1131.266] * (-1130.082) (-1129.346) (-1133.917) [-1129.324] -- 0:00:18
704500 -- (-1132.593) [-1127.717] (-1129.586) (-1129.471) * (-1130.396) [-1129.735] (-1129.392) (-1131.213) -- 0:00:18
705000 -- (-1131.129) [-1129.254] (-1134.290) (-1127.610) * (-1128.687) [-1128.680] (-1128.732) (-1130.089) -- 0:00:18
Average standard deviation of split frequencies: 0.008327
705500 -- [-1130.412] (-1130.566) (-1129.917) (-1128.274) * (-1128.474) (-1129.939) [-1129.550] (-1128.172) -- 0:00:18
706000 -- (-1129.042) (-1132.762) (-1129.771) [-1129.145] * (-1129.722) (-1128.345) (-1129.253) [-1127.855] -- 0:00:18
706500 -- [-1128.928] (-1128.393) (-1129.344) (-1127.868) * (-1132.521) [-1128.469] (-1129.878) (-1129.664) -- 0:00:18
707000 -- (-1129.264) (-1131.104) (-1128.983) [-1127.799] * (-1130.317) (-1129.179) [-1128.474] (-1133.001) -- 0:00:18
707500 -- (-1127.256) (-1128.772) [-1129.333] (-1128.329) * (-1130.981) (-1128.104) (-1128.438) [-1129.546] -- 0:00:18
708000 -- (-1128.030) (-1127.696) [-1128.833] (-1129.305) * (-1129.159) (-1127.319) (-1128.844) [-1131.705] -- 0:00:18
708500 -- (-1130.049) (-1127.307) [-1128.004] (-1127.945) * (-1129.693) (-1130.594) (-1128.840) [-1128.522] -- 0:00:18
709000 -- (-1129.293) [-1127.758] (-1128.394) (-1129.875) * (-1128.951) (-1129.219) [-1128.006] (-1131.364) -- 0:00:18
709500 -- [-1128.843] (-1130.796) (-1127.718) (-1129.933) * (-1128.584) (-1130.198) [-1128.454] (-1130.013) -- 0:00:18
710000 -- (-1129.621) (-1130.636) (-1127.568) [-1129.230] * (-1128.611) (-1127.693) (-1128.543) [-1130.772] -- 0:00:18
Average standard deviation of split frequencies: 0.008116
710500 -- (-1128.043) [-1132.413] (-1133.078) (-1129.846) * (-1131.734) [-1127.731] (-1131.359) (-1128.077) -- 0:00:18
711000 -- (-1133.767) (-1128.414) (-1128.423) [-1128.813] * [-1128.522] (-1128.380) (-1128.678) (-1127.388) -- 0:00:18
711500 -- (-1132.828) (-1128.889) [-1129.742] (-1127.686) * (-1128.690) (-1127.501) [-1129.252] (-1130.773) -- 0:00:18
712000 -- [-1129.187] (-1127.878) (-1127.294) (-1129.707) * (-1129.949) (-1127.633) (-1128.246) [-1128.229] -- 0:00:18
712500 -- [-1129.248] (-1127.885) (-1128.253) (-1133.629) * [-1131.661] (-1129.149) (-1130.748) (-1127.632) -- 0:00:18
713000 -- [-1130.401] (-1130.160) (-1129.856) (-1128.926) * (-1133.557) (-1129.767) [-1128.396] (-1127.221) -- 0:00:18
713500 -- (-1128.163) (-1129.296) [-1129.286] (-1130.778) * (-1128.576) (-1128.975) [-1127.694] (-1130.893) -- 0:00:18
714000 -- [-1127.958] (-1127.463) (-1129.735) (-1132.555) * (-1127.740) [-1128.789] (-1128.638) (-1132.184) -- 0:00:18
714500 -- (-1128.410) (-1129.671) [-1129.840] (-1133.763) * [-1128.003] (-1129.720) (-1128.879) (-1132.532) -- 0:00:17
715000 -- [-1129.582] (-1128.373) (-1129.854) (-1130.864) * (-1131.526) (-1131.367) (-1132.195) [-1128.529] -- 0:00:17
Average standard deviation of split frequencies: 0.007654
715500 -- (-1131.832) (-1127.848) [-1128.771] (-1128.262) * (-1130.425) [-1132.097] (-1130.480) (-1130.022) -- 0:00:17
716000 -- (-1129.351) (-1127.951) (-1127.141) [-1132.707] * (-1132.014) (-1132.509) [-1129.348] (-1129.295) -- 0:00:17
716500 -- (-1131.144) [-1129.574] (-1127.233) (-1129.558) * (-1128.534) (-1129.238) (-1133.422) [-1127.376] -- 0:00:17
717000 -- [-1128.780] (-1134.909) (-1130.086) (-1127.400) * (-1130.064) (-1128.750) [-1133.457] (-1127.581) -- 0:00:17
717500 -- (-1131.120) (-1127.190) (-1131.776) [-1131.528] * (-1128.984) (-1127.440) [-1127.309] (-1130.401) -- 0:00:17
718000 -- (-1126.999) (-1132.350) (-1128.138) [-1127.483] * (-1129.062) [-1130.683] (-1129.444) (-1129.015) -- 0:00:17
718500 -- [-1126.903] (-1128.124) (-1132.595) (-1128.411) * (-1131.432) (-1131.205) [-1127.347] (-1131.651) -- 0:00:17
719000 -- (-1126.914) (-1129.441) [-1128.226] (-1130.509) * (-1130.661) (-1130.693) [-1128.852] (-1129.514) -- 0:00:17
719500 -- (-1129.871) (-1128.511) (-1130.951) [-1128.713] * (-1128.085) (-1130.590) (-1130.586) [-1130.711] -- 0:00:17
720000 -- (-1128.222) (-1129.203) (-1127.777) [-1127.336] * (-1128.145) (-1131.440) [-1129.149] (-1135.807) -- 0:00:17
Average standard deviation of split frequencies: 0.007768
720500 -- (-1134.101) (-1131.634) (-1128.461) [-1127.347] * (-1129.441) (-1127.339) (-1128.346) [-1127.275] -- 0:00:17
721000 -- (-1132.569) (-1131.344) (-1129.739) [-1127.576] * (-1128.880) (-1128.435) (-1129.812) [-1127.211] -- 0:00:17
721500 -- (-1128.597) [-1129.347] (-1135.069) (-1127.271) * [-1129.435] (-1129.099) (-1127.846) (-1130.433) -- 0:00:17
722000 -- (-1127.318) (-1132.663) [-1131.088] (-1128.958) * (-1129.840) [-1127.899] (-1128.151) (-1133.265) -- 0:00:17
722500 -- (-1127.146) (-1128.458) (-1131.993) [-1128.445] * (-1129.545) [-1129.036] (-1128.201) (-1130.848) -- 0:00:17
723000 -- (-1129.946) (-1128.373) [-1130.566] (-1132.663) * (-1131.227) (-1127.334) (-1127.966) [-1128.784] -- 0:00:17
723500 -- [-1129.165] (-1131.796) (-1130.295) (-1130.043) * [-1127.676] (-1127.855) (-1133.600) (-1129.361) -- 0:00:17
724000 -- (-1128.886) [-1133.059] (-1129.614) (-1130.010) * (-1129.131) (-1130.341) [-1133.152] (-1128.204) -- 0:00:17
724500 -- (-1129.278) [-1128.649] (-1128.544) (-1128.204) * (-1130.548) (-1130.186) (-1128.651) [-1127.803] -- 0:00:17
725000 -- (-1129.270) (-1128.459) [-1130.753] (-1128.446) * [-1128.582] (-1130.037) (-1128.066) (-1129.400) -- 0:00:17
Average standard deviation of split frequencies: 0.007754
725500 -- (-1133.734) (-1128.522) (-1128.607) [-1128.041] * (-1128.761) (-1128.620) (-1131.833) [-1128.595] -- 0:00:17
726000 -- (-1129.420) (-1130.147) [-1128.835] (-1128.382) * (-1128.705) (-1130.327) [-1130.523] (-1127.326) -- 0:00:17
726500 -- (-1129.882) (-1129.614) (-1129.778) [-1128.438] * (-1129.851) (-1128.654) [-1129.777] (-1130.967) -- 0:00:17
727000 -- (-1129.224) (-1132.057) [-1129.778] (-1130.064) * (-1129.296) (-1130.657) [-1129.000] (-1131.529) -- 0:00:17
727500 -- (-1127.085) [-1127.808] (-1128.019) (-1131.168) * [-1128.010] (-1133.634) (-1130.462) (-1133.907) -- 0:00:17
728000 -- (-1127.454) (-1130.266) [-1128.666] (-1134.915) * (-1130.608) (-1127.744) (-1128.540) [-1127.383] -- 0:00:17
728500 -- (-1128.730) [-1130.027] (-1128.587) (-1128.724) * (-1129.386) (-1127.734) [-1126.867] (-1128.621) -- 0:00:17
729000 -- (-1130.447) (-1130.472) (-1127.864) [-1127.905] * (-1130.370) (-1128.991) [-1128.348] (-1127.325) -- 0:00:17
729500 -- (-1133.721) [-1128.320] (-1130.549) (-1129.389) * (-1129.233) [-1127.338] (-1128.387) (-1129.266) -- 0:00:17
730000 -- (-1132.390) (-1127.087) [-1129.356] (-1127.787) * (-1127.886) [-1130.289] (-1131.726) (-1129.500) -- 0:00:17
Average standard deviation of split frequencies: 0.007856
730500 -- (-1128.870) (-1127.817) (-1131.853) [-1127.754] * (-1131.849) (-1130.958) (-1128.980) [-1127.733] -- 0:00:16
731000 -- (-1127.233) (-1130.684) [-1129.004] (-1128.131) * (-1128.883) [-1130.665] (-1130.278) (-1128.254) -- 0:00:16
731500 -- [-1128.995] (-1132.640) (-1128.025) (-1126.976) * [-1129.239] (-1129.299) (-1132.234) (-1127.962) -- 0:00:16
732000 -- (-1128.826) (-1129.152) [-1129.780] (-1131.764) * (-1129.981) (-1128.165) [-1130.585] (-1128.660) -- 0:00:16
732500 -- (-1130.361) [-1129.119] (-1129.213) (-1131.743) * (-1128.782) (-1127.195) [-1130.174] (-1130.093) -- 0:00:16
733000 -- [-1131.010] (-1130.839) (-1128.461) (-1131.193) * [-1131.519] (-1127.628) (-1129.373) (-1127.806) -- 0:00:16
733500 -- (-1132.324) [-1129.181] (-1128.363) (-1128.031) * (-1128.885) [-1128.913] (-1129.803) (-1131.046) -- 0:00:16
734000 -- [-1129.972] (-1127.657) (-1129.421) (-1128.555) * (-1128.886) [-1127.711] (-1128.165) (-1128.600) -- 0:00:16
734500 -- [-1129.011] (-1126.980) (-1127.928) (-1129.523) * [-1128.716] (-1128.573) (-1129.009) (-1131.205) -- 0:00:16
735000 -- (-1129.190) [-1130.652] (-1130.632) (-1128.647) * [-1128.264] (-1132.756) (-1127.856) (-1132.390) -- 0:00:16
Average standard deviation of split frequencies: 0.008100
735500 -- [-1127.183] (-1129.819) (-1131.414) (-1128.741) * (-1128.021) [-1129.795] (-1129.429) (-1132.472) -- 0:00:16
736000 -- [-1129.606] (-1128.534) (-1130.431) (-1130.699) * [-1130.427] (-1131.297) (-1128.672) (-1133.431) -- 0:00:16
736500 -- [-1128.002] (-1130.570) (-1128.418) (-1130.339) * (-1130.459) (-1128.398) (-1129.870) [-1130.489] -- 0:00:16
737000 -- [-1129.402] (-1127.507) (-1128.664) (-1129.088) * [-1130.853] (-1128.369) (-1130.012) (-1129.552) -- 0:00:16
737500 -- (-1130.828) (-1129.152) [-1127.971] (-1129.337) * (-1129.612) [-1129.232] (-1128.027) (-1130.129) -- 0:00:16
738000 -- (-1129.756) [-1130.549] (-1127.535) (-1131.237) * [-1129.924] (-1128.730) (-1131.435) (-1129.359) -- 0:00:16
738500 -- (-1128.971) [-1133.424] (-1127.862) (-1131.637) * [-1127.869] (-1129.949) (-1128.794) (-1129.800) -- 0:00:16
739000 -- (-1128.043) (-1134.119) [-1130.378] (-1128.120) * [-1130.759] (-1129.407) (-1128.893) (-1128.786) -- 0:00:16
739500 -- (-1127.528) (-1129.780) (-1131.143) [-1128.754] * [-1128.238] (-1129.558) (-1130.044) (-1127.643) -- 0:00:16
740000 -- [-1127.502] (-1130.592) (-1128.710) (-1135.512) * [-1128.321] (-1128.563) (-1129.563) (-1128.718) -- 0:00:16
Average standard deviation of split frequencies: 0.008087
740500 -- (-1129.127) (-1127.887) [-1129.201] (-1132.433) * (-1133.147) (-1129.300) [-1129.673] (-1128.379) -- 0:00:16
741000 -- (-1127.897) (-1129.794) [-1129.398] (-1130.360) * (-1128.961) (-1130.177) (-1129.313) [-1128.715] -- 0:00:16
741500 -- (-1127.765) (-1130.703) (-1130.193) [-1130.177] * (-1127.382) [-1128.991] (-1130.830) (-1130.654) -- 0:00:16
742000 -- (-1133.434) (-1130.833) [-1127.272] (-1128.665) * (-1127.947) (-1128.237) [-1128.000] (-1131.081) -- 0:00:16
742500 -- (-1128.700) (-1133.591) (-1128.156) [-1129.567] * (-1128.152) (-1129.674) (-1128.002) [-1128.725] -- 0:00:16
743000 -- (-1128.382) (-1133.594) (-1127.750) [-1127.831] * [-1130.411] (-1128.277) (-1129.794) (-1129.207) -- 0:00:16
743500 -- (-1130.591) (-1128.078) [-1127.024] (-1128.374) * (-1128.130) [-1129.311] (-1128.883) (-1129.840) -- 0:00:16
744000 -- [-1131.247] (-1127.973) (-1129.130) (-1127.223) * (-1128.491) (-1131.321) [-1129.369] (-1130.395) -- 0:00:16
744500 -- (-1128.537) (-1127.546) [-1129.243] (-1130.162) * (-1128.962) (-1131.089) [-1129.260] (-1128.252) -- 0:00:16
745000 -- (-1128.711) (-1129.489) (-1129.646) [-1129.037] * (-1129.133) [-1131.226] (-1128.420) (-1129.583) -- 0:00:16
Average standard deviation of split frequencies: 0.008326
745500 -- (-1131.528) [-1130.566] (-1130.134) (-1127.524) * (-1128.277) (-1133.606) [-1132.648] (-1129.801) -- 0:00:16
746000 -- [-1129.445] (-1130.064) (-1129.519) (-1130.121) * (-1129.371) (-1131.851) (-1128.050) [-1127.560] -- 0:00:16
746500 -- (-1128.716) (-1129.970) (-1129.948) [-1130.009] * (-1132.119) [-1128.255] (-1129.773) (-1128.010) -- 0:00:15
747000 -- [-1132.514] (-1129.052) (-1127.837) (-1128.720) * (-1132.458) (-1128.025) [-1128.864] (-1129.220) -- 0:00:15
747500 -- (-1128.702) (-1128.786) [-1128.045] (-1128.144) * (-1131.923) (-1128.499) (-1128.115) [-1128.490] -- 0:00:15
748000 -- [-1130.280] (-1132.705) (-1128.300) (-1127.235) * (-1127.896) (-1131.295) [-1127.079] (-1130.954) -- 0:00:15
748500 -- [-1131.604] (-1129.318) (-1131.924) (-1129.202) * (-1130.945) [-1130.172] (-1128.502) (-1127.958) -- 0:00:15
749000 -- (-1133.359) [-1128.423] (-1128.719) (-1129.628) * (-1131.140) [-1128.894] (-1134.555) (-1128.983) -- 0:00:15
749500 -- (-1132.038) (-1130.272) (-1128.744) [-1129.221] * (-1128.522) (-1132.320) (-1130.771) [-1128.719] -- 0:00:15
750000 -- (-1133.631) (-1129.764) (-1129.156) [-1128.406] * (-1131.279) [-1130.758] (-1129.156) (-1130.966) -- 0:00:15
Average standard deviation of split frequencies: 0.008312
750500 -- [-1127.995] (-1130.228) (-1129.393) (-1127.491) * [-1129.783] (-1129.439) (-1128.646) (-1128.277) -- 0:00:15
751000 -- (-1128.725) (-1131.975) [-1127.961] (-1127.274) * (-1131.991) (-1128.714) (-1131.739) [-1130.577] -- 0:00:15
751500 -- (-1127.619) (-1130.157) [-1126.933] (-1127.378) * (-1130.843) (-1134.117) (-1128.863) [-1129.022] -- 0:00:15
752000 -- (-1127.980) (-1127.516) (-1128.672) [-1127.494] * (-1127.713) (-1131.396) (-1130.509) [-1130.612] -- 0:00:15
752500 -- [-1127.941] (-1128.179) (-1130.037) (-1129.115) * [-1131.250] (-1130.911) (-1130.865) (-1133.028) -- 0:00:15
753000 -- (-1127.672) (-1128.412) [-1128.357] (-1127.445) * [-1129.771] (-1129.537) (-1128.527) (-1129.370) -- 0:00:15
753500 -- (-1130.024) [-1128.990] (-1128.463) (-1128.876) * (-1129.816) (-1129.498) (-1131.937) [-1127.541] -- 0:00:15
754000 -- (-1127.689) [-1129.327] (-1128.088) (-1133.911) * (-1129.133) [-1130.995] (-1130.089) (-1128.546) -- 0:00:15
754500 -- (-1127.568) [-1128.147] (-1129.181) (-1134.515) * (-1128.687) (-1130.017) (-1129.893) [-1129.209] -- 0:00:15
755000 -- [-1127.778] (-1128.783) (-1129.090) (-1130.424) * (-1129.451) (-1128.936) [-1128.907] (-1131.186) -- 0:00:15
Average standard deviation of split frequencies: 0.008033
755500 -- (-1127.403) (-1127.738) [-1128.781] (-1128.506) * [-1128.911] (-1128.873) (-1128.993) (-1130.836) -- 0:00:15
756000 -- (-1129.253) [-1130.109] (-1128.184) (-1128.222) * (-1127.969) [-1127.590] (-1128.286) (-1129.123) -- 0:00:15
756500 -- (-1129.983) (-1130.080) [-1129.483] (-1127.854) * (-1127.192) (-1129.469) (-1131.760) [-1127.231] -- 0:00:15
757000 -- (-1130.804) [-1127.831] (-1132.684) (-1128.787) * (-1128.564) (-1134.054) (-1130.130) [-1129.247] -- 0:00:15
757500 -- (-1130.626) [-1128.018] (-1129.152) (-1128.164) * (-1135.280) [-1128.309] (-1129.415) (-1128.604) -- 0:00:15
758000 -- [-1129.773] (-1128.715) (-1130.204) (-1129.004) * (-1131.487) [-1128.896] (-1129.374) (-1127.889) -- 0:00:15
758500 -- (-1129.126) (-1129.060) [-1128.936] (-1128.089) * (-1128.511) (-1129.698) (-1129.777) [-1128.959] -- 0:00:15
759000 -- (-1130.911) [-1132.695] (-1128.005) (-1128.783) * (-1127.840) [-1130.089] (-1129.038) (-1133.050) -- 0:00:15
759500 -- [-1130.416] (-1134.882) (-1133.767) (-1129.800) * (-1129.622) [-1128.231] (-1129.737) (-1128.848) -- 0:00:15
760000 -- (-1129.419) (-1131.329) (-1129.595) [-1128.852] * [-1130.810] (-1128.116) (-1129.722) (-1134.843) -- 0:00:15
Average standard deviation of split frequencies: 0.008202
760500 -- (-1132.743) (-1131.242) (-1131.190) [-1129.450] * (-1130.132) (-1128.079) [-1128.213] (-1132.069) -- 0:00:15
761000 -- (-1129.817) (-1129.755) (-1132.319) [-1128.481] * [-1130.059] (-1129.352) (-1130.513) (-1129.673) -- 0:00:15
761500 -- [-1129.455] (-1130.070) (-1128.378) (-1128.904) * (-1133.235) (-1128.351) [-1129.318] (-1130.199) -- 0:00:15
762000 -- [-1129.568] (-1128.426) (-1127.215) (-1129.203) * (-1130.679) (-1128.944) [-1128.867] (-1128.944) -- 0:00:14
762500 -- (-1128.503) [-1132.114] (-1129.307) (-1128.233) * (-1134.048) (-1130.600) [-1128.444] (-1127.109) -- 0:00:14
763000 -- [-1127.810] (-1128.511) (-1130.195) (-1128.724) * (-1130.360) (-1131.467) (-1128.110) [-1127.057] -- 0:00:14
763500 -- (-1129.446) (-1129.392) (-1130.038) [-1130.880] * (-1129.102) (-1131.714) [-1129.389] (-1128.811) -- 0:00:14
764000 -- [-1128.869] (-1128.260) (-1130.824) (-1129.830) * (-1128.100) (-1129.130) (-1129.369) [-1128.004] -- 0:00:14
764500 -- (-1130.275) [-1128.237] (-1129.240) (-1131.655) * (-1129.770) (-1134.116) (-1128.024) [-1127.955] -- 0:00:14
765000 -- (-1129.313) (-1128.913) (-1129.427) [-1127.769] * (-1132.617) (-1130.475) [-1128.034] (-1128.687) -- 0:00:14
Average standard deviation of split frequencies: 0.008652
765500 -- (-1129.313) (-1127.196) [-1127.220] (-1128.940) * (-1128.005) [-1127.454] (-1127.148) (-1127.290) -- 0:00:14
766000 -- (-1127.587) (-1127.166) [-1127.220] (-1129.408) * (-1131.735) (-1129.388) [-1127.330] (-1131.299) -- 0:00:14
766500 -- [-1128.545] (-1128.453) (-1127.450) (-1129.485) * (-1129.997) (-1131.239) (-1129.620) [-1132.420] -- 0:00:14
767000 -- (-1132.737) [-1128.812] (-1130.824) (-1133.759) * (-1128.421) (-1129.316) [-1131.456] (-1128.151) -- 0:00:14
767500 -- (-1128.295) (-1127.579) (-1128.193) [-1133.768] * (-1130.622) (-1129.775) (-1127.855) [-1130.220] -- 0:00:14
768000 -- (-1131.034) [-1130.232] (-1128.310) (-1128.912) * (-1130.317) (-1131.384) (-1127.152) [-1128.167] -- 0:00:14
768500 -- [-1132.520] (-1129.528) (-1127.539) (-1132.950) * (-1129.387) [-1128.496] (-1127.632) (-1129.295) -- 0:00:14
769000 -- (-1128.775) (-1128.263) (-1128.123) [-1129.139] * [-1128.116] (-1128.064) (-1127.897) (-1127.546) -- 0:00:14
769500 -- (-1128.661) (-1128.742) [-1128.343] (-1134.734) * [-1129.737] (-1132.647) (-1133.234) (-1127.389) -- 0:00:14
770000 -- (-1138.230) (-1128.448) [-1128.508] (-1131.121) * (-1129.148) [-1128.670] (-1128.052) (-1131.828) -- 0:00:14
Average standard deviation of split frequencies: 0.009175
770500 -- (-1128.660) (-1127.386) (-1128.855) [-1128.227] * (-1128.723) [-1127.712] (-1129.809) (-1139.478) -- 0:00:14
771000 -- [-1127.514] (-1127.660) (-1128.261) (-1129.164) * (-1131.668) (-1130.001) [-1128.569] (-1132.125) -- 0:00:14
771500 -- [-1127.837] (-1127.828) (-1127.495) (-1128.275) * (-1127.961) [-1128.646] (-1128.834) (-1130.034) -- 0:00:14
772000 -- (-1129.034) (-1127.836) (-1131.744) [-1127.071] * (-1128.084) (-1133.269) (-1127.712) [-1130.865] -- 0:00:14
772500 -- (-1130.070) (-1129.956) [-1135.458] (-1128.004) * [-1129.830] (-1128.958) (-1127.998) (-1129.600) -- 0:00:14
773000 -- (-1127.232) (-1130.492) [-1128.181] (-1131.306) * (-1127.705) [-1128.422] (-1128.575) (-1127.665) -- 0:00:14
773500 -- (-1134.128) (-1137.286) [-1128.452] (-1134.450) * (-1132.525) (-1128.528) (-1130.315) [-1130.515] -- 0:00:14
774000 -- (-1127.766) [-1133.497] (-1131.067) (-1134.645) * (-1128.787) (-1129.369) [-1130.134] (-1128.606) -- 0:00:14
774500 -- [-1128.550] (-1127.815) (-1128.454) (-1130.117) * (-1127.578) (-1129.405) [-1131.037] (-1128.751) -- 0:00:14
775000 -- (-1128.597) [-1128.855] (-1131.622) (-1128.994) * [-1127.422] (-1130.771) (-1130.065) (-1132.299) -- 0:00:14
Average standard deviation of split frequencies: 0.009398
775500 -- (-1129.988) (-1129.066) (-1132.794) [-1129.798] * (-1127.155) (-1129.852) (-1129.117) [-1129.274] -- 0:00:14
776000 -- [-1133.368] (-1133.681) (-1130.711) (-1129.517) * (-1127.880) (-1128.830) (-1129.254) [-1131.918] -- 0:00:14
776500 -- (-1129.212) (-1128.870) (-1128.875) [-1130.575] * (-1128.749) (-1130.152) (-1130.707) [-1129.048] -- 0:00:14
777000 -- (-1129.192) (-1128.315) [-1129.396] (-1129.793) * [-1128.844] (-1128.393) (-1132.338) (-1132.044) -- 0:00:14
777500 -- (-1131.115) (-1129.141) (-1127.803) [-1127.490] * (-1127.136) [-1127.610] (-1128.515) (-1133.494) -- 0:00:14
778000 -- (-1128.370) (-1129.121) (-1129.015) [-1128.069] * [-1129.730] (-1128.539) (-1129.123) (-1133.925) -- 0:00:13
778500 -- (-1129.302) (-1130.209) [-1129.569] (-1129.306) * [-1132.940] (-1131.438) (-1131.398) (-1132.633) -- 0:00:13
779000 -- [-1130.384] (-1128.605) (-1129.446) (-1128.054) * (-1129.828) (-1131.096) [-1132.710] (-1129.596) -- 0:00:13
779500 -- (-1127.300) (-1129.119) [-1129.011] (-1128.592) * (-1128.211) (-1128.545) [-1129.540] (-1131.959) -- 0:00:13
780000 -- [-1130.817] (-1127.715) (-1127.976) (-1129.001) * [-1128.728] (-1127.715) (-1129.078) (-1132.543) -- 0:00:13
Average standard deviation of split frequencies: 0.008951
780500 -- (-1132.192) [-1127.654] (-1136.235) (-1129.171) * (-1129.472) [-1129.189] (-1130.833) (-1127.820) -- 0:00:13
781000 -- (-1132.880) [-1128.865] (-1127.653) (-1129.409) * [-1130.249] (-1131.815) (-1129.680) (-1127.288) -- 0:00:13
781500 -- (-1130.298) (-1132.089) [-1129.002] (-1130.148) * (-1128.016) (-1129.328) [-1130.083] (-1128.917) -- 0:00:13
782000 -- (-1129.415) (-1128.142) [-1127.880] (-1131.438) * (-1128.351) [-1128.374] (-1129.239) (-1131.290) -- 0:00:13
782500 -- (-1129.844) [-1129.147] (-1128.797) (-1131.828) * (-1128.686) [-1127.093] (-1128.445) (-1127.971) -- 0:00:13
783000 -- (-1129.211) (-1127.507) (-1127.542) [-1130.713] * (-1132.552) (-1127.549) [-1134.441] (-1129.683) -- 0:00:13
783500 -- (-1128.659) [-1127.405] (-1128.821) (-1129.025) * [-1130.189] (-1128.155) (-1129.888) (-1129.219) -- 0:00:13
784000 -- [-1129.299] (-1128.590) (-1126.999) (-1130.950) * (-1127.733) (-1129.327) (-1132.368) [-1129.174] -- 0:00:13
784500 -- (-1131.077) [-1128.527] (-1131.200) (-1129.262) * (-1128.477) (-1131.574) [-1128.590] (-1129.989) -- 0:00:13
785000 -- (-1130.107) [-1132.045] (-1128.386) (-1130.897) * [-1128.478] (-1129.090) (-1128.909) (-1129.563) -- 0:00:13
Average standard deviation of split frequencies: 0.009455
785500 -- [-1130.956] (-1129.434) (-1127.448) (-1128.859) * (-1128.564) [-1131.815] (-1128.517) (-1128.693) -- 0:00:13
786000 -- [-1128.325] (-1130.058) (-1127.541) (-1134.117) * [-1127.908] (-1128.141) (-1127.833) (-1128.397) -- 0:00:13
786500 -- (-1128.259) (-1128.476) (-1130.226) [-1131.033] * (-1127.158) [-1127.290] (-1129.033) (-1132.728) -- 0:00:13
787000 -- (-1127.554) (-1129.121) [-1128.889] (-1128.661) * (-1127.686) (-1128.153) [-1130.622] (-1135.232) -- 0:00:13
787500 -- (-1128.532) [-1129.569] (-1128.303) (-1128.640) * (-1129.358) (-1128.061) [-1128.795] (-1130.877) -- 0:00:13
788000 -- (-1129.053) (-1127.722) [-1128.288] (-1130.101) * (-1129.511) [-1129.847] (-1128.885) (-1129.178) -- 0:00:13
788500 -- (-1129.925) [-1132.549] (-1130.271) (-1133.684) * (-1128.598) (-1129.066) [-1128.896] (-1130.479) -- 0:00:13
789000 -- (-1133.174) (-1132.065) (-1128.750) [-1129.416] * [-1129.056] (-1130.522) (-1127.781) (-1128.871) -- 0:00:13
789500 -- (-1129.523) (-1131.790) [-1128.976] (-1130.390) * [-1128.545] (-1129.432) (-1128.494) (-1128.209) -- 0:00:13
790000 -- [-1128.782] (-1133.689) (-1133.607) (-1128.950) * (-1127.863) (-1130.172) (-1130.460) [-1128.703] -- 0:00:13
Average standard deviation of split frequencies: 0.009995
790500 -- (-1130.985) (-1130.031) (-1129.610) [-1129.334] * (-1127.333) (-1130.859) (-1130.976) [-1129.888] -- 0:00:13
791000 -- [-1130.110] (-1130.378) (-1130.480) (-1130.751) * (-1130.992) (-1128.219) (-1133.118) [-1128.635] -- 0:00:13
791500 -- (-1131.766) [-1129.782] (-1128.713) (-1130.906) * (-1134.788) [-1128.442] (-1130.697) (-1128.297) -- 0:00:13
792000 -- [-1131.839] (-1130.212) (-1129.899) (-1131.269) * [-1129.434] (-1130.650) (-1127.645) (-1128.335) -- 0:00:13
792500 -- (-1130.474) [-1130.245] (-1130.289) (-1127.816) * [-1127.327] (-1129.431) (-1131.516) (-1134.228) -- 0:00:13
793000 -- (-1128.125) [-1130.637] (-1127.978) (-1131.560) * (-1131.101) (-1129.329) [-1128.758] (-1132.509) -- 0:00:13
793500 -- [-1129.331] (-1128.624) (-1127.827) (-1129.727) * [-1128.268] (-1129.598) (-1129.993) (-1131.213) -- 0:00:13
794000 -- (-1129.613) (-1134.443) (-1127.330) [-1127.996] * (-1128.665) [-1128.310] (-1127.389) (-1129.759) -- 0:00:12
794500 -- (-1132.079) (-1127.486) [-1128.284] (-1129.550) * (-1128.825) [-1133.147] (-1129.309) (-1128.107) -- 0:00:12
795000 -- (-1131.327) (-1129.993) (-1128.860) [-1128.302] * (-1130.695) (-1129.301) (-1130.595) [-1128.022] -- 0:00:12
Average standard deviation of split frequencies: 0.009336
795500 -- (-1127.277) (-1130.201) (-1128.902) [-1128.185] * (-1128.048) (-1128.478) [-1127.970] (-1128.085) -- 0:00:12
796000 -- (-1127.210) [-1127.863] (-1130.826) (-1129.101) * [-1127.954] (-1129.391) (-1127.496) (-1128.738) -- 0:00:12
796500 -- [-1128.682] (-1129.426) (-1127.852) (-1128.591) * (-1127.685) (-1129.853) (-1129.025) [-1128.052] -- 0:00:12
797000 -- [-1127.974] (-1133.565) (-1133.340) (-1130.265) * (-1129.929) (-1127.876) [-1129.101] (-1130.367) -- 0:00:12
797500 -- (-1128.363) (-1128.980) [-1131.207] (-1128.709) * (-1128.337) (-1131.028) [-1129.138] (-1131.155) -- 0:00:12
798000 -- (-1131.358) (-1128.790) [-1127.789] (-1127.679) * [-1129.574] (-1128.223) (-1129.932) (-1130.128) -- 0:00:12
798500 -- (-1136.022) (-1129.617) (-1131.105) [-1129.167] * (-1132.499) [-1129.285] (-1128.130) (-1133.120) -- 0:00:12
799000 -- (-1132.241) [-1128.486] (-1129.324) (-1128.369) * [-1128.988] (-1132.476) (-1130.460) (-1129.999) -- 0:00:12
799500 -- (-1128.925) (-1132.737) (-1128.724) [-1129.634] * (-1128.870) [-1129.272] (-1127.974) (-1129.040) -- 0:00:12
800000 -- (-1131.151) (-1130.825) (-1130.299) [-1130.567] * (-1128.369) [-1128.437] (-1131.617) (-1130.904) -- 0:00:12
Average standard deviation of split frequencies: 0.009074
800500 -- [-1128.971] (-1129.333) (-1136.458) (-1129.477) * [-1133.907] (-1128.003) (-1129.055) (-1128.272) -- 0:00:12
801000 -- (-1131.961) [-1129.219] (-1128.379) (-1132.487) * (-1131.763) (-1128.823) [-1132.000] (-1134.681) -- 0:00:12
801500 -- (-1132.092) [-1128.275] (-1130.106) (-1129.843) * (-1127.886) (-1130.558) [-1127.514] (-1131.150) -- 0:00:12
802000 -- (-1130.831) (-1129.018) [-1129.191] (-1128.959) * [-1128.071] (-1127.319) (-1128.355) (-1134.639) -- 0:00:12
802500 -- (-1132.496) (-1128.826) (-1127.035) [-1132.699] * (-1132.835) (-1131.002) (-1129.706) [-1132.193] -- 0:00:12
803000 -- (-1127.541) (-1129.306) [-1127.438] (-1128.878) * (-1128.595) [-1129.318] (-1132.444) (-1134.180) -- 0:00:12
803500 -- [-1127.453] (-1128.650) (-1127.946) (-1131.730) * (-1128.228) [-1129.018] (-1130.104) (-1129.874) -- 0:00:12
804000 -- (-1127.451) (-1128.683) [-1128.769] (-1132.913) * (-1130.383) (-1128.448) [-1130.115] (-1131.426) -- 0:00:12
804500 -- [-1128.694] (-1128.872) (-1130.832) (-1130.302) * [-1129.964] (-1129.605) (-1131.081) (-1128.929) -- 0:00:12
805000 -- (-1130.010) (-1130.270) [-1130.548] (-1128.948) * (-1128.187) [-1128.131] (-1128.800) (-1131.923) -- 0:00:12
Average standard deviation of split frequencies: 0.009220
805500 -- [-1131.609] (-1131.778) (-1130.073) (-1127.811) * (-1132.028) (-1129.552) (-1131.067) [-1127.906] -- 0:00:12
806000 -- (-1130.167) (-1131.454) (-1129.776) [-1128.237] * (-1129.509) [-1128.090] (-1131.907) (-1130.397) -- 0:00:12
806500 -- [-1128.205] (-1132.012) (-1128.541) (-1128.282) * (-1128.338) [-1128.626] (-1129.729) (-1131.043) -- 0:00:12
807000 -- (-1128.349) [-1127.094] (-1128.205) (-1128.000) * [-1128.120] (-1129.684) (-1129.926) (-1128.544) -- 0:00:12
807500 -- (-1132.643) (-1132.790) [-1127.938] (-1128.894) * (-1128.480) [-1129.758] (-1128.921) (-1130.880) -- 0:00:12
808000 -- (-1127.994) (-1131.009) (-1130.427) [-1128.460] * [-1130.125] (-1127.445) (-1135.853) (-1134.039) -- 0:00:12
808500 -- (-1128.249) [-1130.102] (-1128.731) (-1129.541) * (-1128.447) (-1129.257) (-1135.829) [-1132.398] -- 0:00:12
809000 -- (-1128.812) (-1128.194) (-1129.842) [-1129.212] * (-1128.646) (-1130.166) [-1130.722] (-1129.806) -- 0:00:12
809500 -- (-1131.286) (-1128.173) (-1127.739) [-1130.837] * (-1129.676) [-1128.657] (-1130.701) (-1133.260) -- 0:00:12
810000 -- (-1130.868) [-1128.194] (-1131.579) (-1130.956) * (-1130.385) [-1128.554] (-1127.842) (-1129.122) -- 0:00:11
Average standard deviation of split frequencies: 0.009372
810500 -- (-1132.850) (-1128.508) (-1127.182) [-1127.894] * (-1128.338) (-1128.141) [-1128.115] (-1128.804) -- 0:00:11
811000 -- (-1132.005) (-1129.064) [-1129.708] (-1131.714) * (-1129.587) (-1128.501) [-1129.804] (-1130.095) -- 0:00:11
811500 -- (-1130.278) [-1132.515] (-1129.751) (-1129.700) * (-1129.098) [-1128.187] (-1132.506) (-1127.661) -- 0:00:11
812000 -- (-1128.788) (-1133.146) (-1129.583) [-1129.495] * [-1129.032] (-1137.385) (-1129.569) (-1129.297) -- 0:00:11
812500 -- (-1137.271) [-1131.390] (-1131.492) (-1128.948) * (-1127.916) (-1128.445) [-1130.352] (-1129.588) -- 0:00:11
813000 -- (-1137.640) (-1129.526) (-1131.793) [-1130.449] * (-1131.407) (-1128.199) [-1127.768] (-1129.734) -- 0:00:11
813500 -- [-1132.515] (-1129.709) (-1129.261) (-1131.487) * [-1128.177] (-1128.359) (-1129.907) (-1129.650) -- 0:00:11
814000 -- [-1128.400] (-1129.698) (-1128.672) (-1128.053) * (-1133.193) [-1129.258] (-1128.376) (-1129.564) -- 0:00:11
814500 -- (-1127.981) (-1129.833) (-1127.721) [-1126.981] * (-1129.782) (-1129.397) (-1128.347) [-1129.337] -- 0:00:11
815000 -- (-1127.646) [-1127.504] (-1129.352) (-1127.219) * (-1129.539) (-1127.678) [-1129.565] (-1128.293) -- 0:00:11
Average standard deviation of split frequencies: 0.008954
815500 -- (-1128.112) (-1130.391) [-1131.732] (-1128.570) * (-1129.310) (-1129.384) [-1129.078] (-1129.508) -- 0:00:11
816000 -- (-1127.619) (-1128.096) (-1135.423) [-1127.945] * (-1129.137) (-1129.595) [-1128.552] (-1128.060) -- 0:00:11
816500 -- [-1127.490] (-1132.855) (-1132.134) (-1131.558) * (-1127.897) [-1129.518] (-1130.216) (-1128.919) -- 0:00:11
817000 -- [-1128.031] (-1131.399) (-1130.130) (-1131.942) * [-1127.983] (-1132.862) (-1128.832) (-1127.759) -- 0:00:11
817500 -- (-1128.533) (-1130.270) (-1132.485) [-1131.794] * (-1128.182) (-1128.754) [-1131.156] (-1129.730) -- 0:00:11
818000 -- [-1128.069] (-1128.609) (-1135.453) (-1128.024) * (-1129.851) (-1130.386) (-1128.389) [-1129.320] -- 0:00:11
818500 -- (-1128.716) (-1131.532) (-1136.497) [-1129.599] * (-1128.820) [-1128.202] (-1129.810) (-1130.924) -- 0:00:11
819000 -- (-1128.462) (-1128.370) (-1129.465) [-1129.139] * (-1129.484) (-1131.131) [-1129.626] (-1130.361) -- 0:00:11
819500 -- (-1127.673) (-1127.728) [-1130.541] (-1128.579) * (-1130.463) (-1129.471) (-1128.229) [-1127.716] -- 0:00:11
820000 -- (-1128.576) (-1127.965) (-1129.256) [-1131.670] * [-1129.888] (-1129.521) (-1129.617) (-1127.910) -- 0:00:11
Average standard deviation of split frequencies: 0.009119
820500 -- (-1128.244) [-1128.496] (-1129.316) (-1130.610) * (-1127.647) [-1132.386] (-1130.139) (-1129.518) -- 0:00:11
821000 -- (-1128.761) (-1131.173) (-1132.584) [-1128.355] * (-1129.154) (-1129.931) [-1127.596] (-1131.090) -- 0:00:11
821500 -- (-1130.341) (-1130.204) (-1127.645) [-1128.538] * (-1128.995) [-1127.413] (-1128.855) (-1128.924) -- 0:00:11
822000 -- [-1129.486] (-1130.206) (-1127.223) (-1128.971) * [-1129.605] (-1127.904) (-1128.798) (-1129.043) -- 0:00:11
822500 -- [-1127.735] (-1131.588) (-1127.543) (-1129.836) * [-1130.009] (-1128.701) (-1129.068) (-1129.759) -- 0:00:11
823000 -- (-1128.713) (-1132.141) [-1130.385] (-1129.684) * (-1133.426) (-1130.619) (-1128.988) [-1129.543] -- 0:00:11
823500 -- (-1129.104) (-1129.997) [-1128.347] (-1129.052) * [-1131.907] (-1130.250) (-1128.274) (-1133.647) -- 0:00:11
824000 -- (-1129.589) [-1128.119] (-1128.463) (-1128.990) * (-1130.831) [-1127.645] (-1127.763) (-1129.654) -- 0:00:11
824500 -- (-1128.856) [-1128.923] (-1129.096) (-1128.014) * [-1129.994] (-1127.335) (-1138.897) (-1130.706) -- 0:00:11
825000 -- (-1128.395) (-1134.264) [-1129.102] (-1127.624) * [-1129.548] (-1129.005) (-1132.138) (-1131.533) -- 0:00:11
Average standard deviation of split frequencies: 0.008882
825500 -- (-1128.786) [-1131.546] (-1128.858) (-1128.069) * (-1131.197) (-1129.806) (-1130.716) [-1127.744] -- 0:00:10
826000 -- (-1128.288) [-1130.081] (-1128.549) (-1129.769) * [-1128.243] (-1129.314) (-1128.483) (-1129.349) -- 0:00:10
826500 -- (-1128.556) [-1129.556] (-1127.496) (-1128.217) * (-1128.636) (-1129.020) (-1128.673) [-1127.398] -- 0:00:10
827000 -- (-1127.622) (-1129.219) (-1129.072) [-1129.833] * (-1129.572) (-1130.224) [-1128.544] (-1127.530) -- 0:00:10
827500 -- (-1127.339) (-1131.850) (-1128.626) [-1129.142] * (-1128.489) (-1132.086) (-1127.969) [-1127.909] -- 0:00:10
828000 -- [-1129.859] (-1131.608) (-1129.686) (-1128.343) * (-1128.519) (-1131.891) (-1127.968) [-1129.904] -- 0:00:10
828500 -- (-1129.292) [-1130.784] (-1128.477) (-1128.382) * (-1127.732) (-1131.972) (-1129.353) [-1129.991] -- 0:00:10
829000 -- (-1128.268) (-1127.524) [-1129.428] (-1129.867) * (-1127.615) (-1132.434) (-1127.904) [-1130.835] -- 0:00:10
829500 -- (-1128.527) (-1128.006) (-1128.191) [-1129.070] * (-1128.073) (-1127.540) [-1128.059] (-1133.494) -- 0:00:10
830000 -- (-1132.841) (-1128.229) (-1128.372) [-1129.168] * (-1133.160) [-1128.202] (-1132.997) (-1134.253) -- 0:00:10
Average standard deviation of split frequencies: 0.008619
830500 -- [-1132.721] (-1128.762) (-1131.367) (-1130.838) * (-1131.725) [-1129.175] (-1128.609) (-1128.557) -- 0:00:10
831000 -- (-1133.099) (-1131.106) [-1129.673] (-1130.289) * (-1128.011) (-1130.016) [-1128.818] (-1129.014) -- 0:00:10
831500 -- (-1130.458) [-1131.834] (-1129.281) (-1129.885) * (-1127.960) (-1131.580) [-1127.031] (-1130.328) -- 0:00:10
832000 -- (-1127.819) (-1132.232) (-1129.336) [-1129.623] * (-1129.385) (-1128.272) [-1128.060] (-1129.131) -- 0:00:10
832500 -- (-1128.272) (-1131.563) [-1127.928] (-1127.798) * (-1130.080) [-1131.922] (-1130.088) (-1129.502) -- 0:00:10
833000 -- (-1129.789) (-1134.293) (-1130.679) [-1127.264] * (-1130.736) (-1131.593) [-1130.614] (-1127.815) -- 0:00:10
833500 -- (-1128.797) (-1130.304) (-1130.377) [-1128.127] * (-1133.366) [-1128.217] (-1130.919) (-1127.885) -- 0:00:10
834000 -- (-1128.730) (-1128.162) [-1127.604] (-1128.643) * (-1130.443) (-1128.273) (-1128.761) [-1128.401] -- 0:00:10
834500 -- (-1128.638) (-1128.983) [-1130.241] (-1131.984) * (-1129.599) [-1127.240] (-1127.735) (-1131.630) -- 0:00:10
835000 -- [-1129.242] (-1128.125) (-1128.797) (-1130.738) * (-1127.699) (-1128.008) [-1127.160] (-1128.200) -- 0:00:10
Average standard deviation of split frequencies: 0.008775
835500 -- [-1130.128] (-1129.969) (-1131.730) (-1131.721) * (-1130.086) (-1129.251) (-1131.015) [-1129.656] -- 0:00:10
836000 -- [-1129.045] (-1127.825) (-1131.834) (-1129.226) * (-1129.092) (-1129.565) (-1129.898) [-1130.578] -- 0:00:10
836500 -- (-1129.631) (-1132.333) (-1127.623) [-1128.891] * [-1130.221] (-1130.327) (-1129.098) (-1130.867) -- 0:00:10
837000 -- (-1133.076) [-1128.132] (-1128.499) (-1129.151) * (-1128.610) (-1130.333) [-1133.563] (-1128.068) -- 0:00:10
837500 -- [-1127.565] (-1129.570) (-1127.680) (-1129.587) * (-1127.745) (-1127.749) (-1129.180) [-1127.646] -- 0:00:10
838000 -- (-1127.858) [-1129.986] (-1127.362) (-1129.225) * (-1128.716) (-1127.340) (-1133.393) [-1128.725] -- 0:00:10
838500 -- (-1128.343) (-1128.469) (-1128.252) [-1130.684] * (-1130.506) (-1127.528) (-1134.065) [-1129.696] -- 0:00:10
839000 -- (-1127.628) (-1128.177) [-1127.443] (-1127.976) * (-1135.516) [-1128.797] (-1129.304) (-1129.707) -- 0:00:10
839500 -- [-1130.003] (-1130.998) (-1129.101) (-1130.806) * [-1128.973] (-1129.707) (-1128.054) (-1128.520) -- 0:00:10
840000 -- (-1127.269) (-1132.562) (-1128.030) [-1128.841] * (-1130.566) (-1130.518) [-1128.766] (-1127.423) -- 0:00:10
Average standard deviation of split frequencies: 0.008341
840500 -- (-1129.647) (-1133.689) (-1127.606) [-1130.396] * (-1129.287) [-1128.281] (-1127.390) (-1130.177) -- 0:00:10
841000 -- (-1129.327) (-1134.674) (-1128.583) [-1129.577] * (-1130.397) [-1128.434] (-1127.117) (-1131.627) -- 0:00:10
841500 -- (-1128.384) (-1129.020) (-1132.176) [-1127.893] * (-1130.935) (-1129.113) [-1127.340] (-1130.647) -- 0:00:09
842000 -- (-1128.287) (-1128.456) [-1130.096] (-1130.038) * (-1129.297) (-1131.352) (-1128.898) [-1129.487] -- 0:00:09
842500 -- [-1127.410] (-1133.898) (-1128.629) (-1127.757) * (-1129.284) [-1129.828] (-1129.907) (-1130.600) -- 0:00:09
843000 -- (-1127.348) (-1127.134) [-1133.441] (-1130.255) * [-1128.918] (-1133.302) (-1128.946) (-1129.544) -- 0:00:09
843500 -- [-1128.073] (-1127.217) (-1128.730) (-1132.282) * [-1129.104] (-1134.746) (-1128.812) (-1127.878) -- 0:00:09
844000 -- [-1130.974] (-1131.800) (-1129.087) (-1130.311) * (-1131.366) (-1131.658) (-1130.834) [-1131.260] -- 0:00:09
844500 -- (-1129.382) (-1130.897) [-1128.274] (-1131.120) * (-1129.828) (-1131.446) (-1129.140) [-1129.624] -- 0:00:09
845000 -- (-1127.798) (-1130.965) (-1130.833) [-1130.900] * (-1129.256) (-1129.135) [-1128.895] (-1128.353) -- 0:00:09
Average standard deviation of split frequencies: 0.008323
845500 -- [-1129.029] (-1133.433) (-1130.434) (-1132.404) * [-1132.229] (-1128.197) (-1128.316) (-1127.769) -- 0:00:09
846000 -- (-1131.523) (-1132.795) (-1129.775) [-1128.227] * [-1127.421] (-1131.008) (-1127.183) (-1129.328) -- 0:00:09
846500 -- [-1127.887] (-1129.254) (-1130.489) (-1128.311) * [-1129.070] (-1131.075) (-1129.324) (-1129.512) -- 0:00:09
847000 -- [-1127.177] (-1128.350) (-1129.119) (-1129.222) * (-1129.060) (-1129.043) [-1133.258] (-1134.659) -- 0:00:09
847500 -- (-1127.402) [-1128.738] (-1128.314) (-1128.873) * [-1132.979] (-1130.433) (-1129.173) (-1127.838) -- 0:00:09
848000 -- [-1127.883] (-1128.418) (-1128.719) (-1132.205) * (-1128.523) [-1128.810] (-1131.890) (-1128.013) -- 0:00:09
848500 -- (-1129.429) (-1130.226) (-1131.475) [-1130.348] * (-1129.642) (-1128.586) (-1127.674) [-1128.245] -- 0:00:09
849000 -- (-1132.822) [-1127.906] (-1128.406) (-1138.810) * (-1130.954) (-1132.598) [-1130.149] (-1136.038) -- 0:00:09
849500 -- (-1130.301) [-1136.074] (-1127.340) (-1139.887) * [-1128.558] (-1129.559) (-1129.970) (-1131.684) -- 0:00:09
850000 -- [-1128.981] (-1129.622) (-1128.481) (-1133.488) * (-1128.124) (-1129.792) (-1132.674) [-1129.743] -- 0:00:09
Average standard deviation of split frequencies: 0.008149
850500 -- (-1130.675) (-1127.982) (-1130.520) [-1128.730] * [-1128.602] (-1130.047) (-1130.932) (-1128.002) -- 0:00:09
851000 -- (-1128.976) (-1129.551) [-1128.487] (-1130.121) * (-1132.393) [-1129.302] (-1130.015) (-1129.086) -- 0:00:09
851500 -- (-1128.955) [-1129.376] (-1129.275) (-1129.030) * (-1129.947) (-1129.164) [-1130.828] (-1132.225) -- 0:00:09
852000 -- (-1131.698) (-1133.878) [-1127.327] (-1132.025) * [-1128.111] (-1128.127) (-1128.619) (-1132.353) -- 0:00:09
852500 -- (-1130.993) (-1131.914) [-1128.406] (-1130.531) * [-1129.709] (-1127.983) (-1129.158) (-1130.355) -- 0:00:09
853000 -- [-1131.258] (-1130.945) (-1128.119) (-1131.187) * (-1129.513) [-1128.418] (-1127.907) (-1129.232) -- 0:00:09
853500 -- (-1130.190) (-1129.785) [-1127.805] (-1128.349) * (-1131.651) [-1130.429] (-1127.391) (-1128.429) -- 0:00:09
854000 -- [-1129.124] (-1128.186) (-1129.590) (-1129.538) * (-1129.086) (-1127.556) [-1128.111] (-1129.029) -- 0:00:09
854500 -- (-1127.357) [-1130.601] (-1130.979) (-1132.020) * [-1128.194] (-1127.360) (-1134.917) (-1132.397) -- 0:00:09
855000 -- (-1127.983) (-1128.013) [-1129.774] (-1129.224) * (-1128.271) (-1131.263) [-1129.175] (-1127.325) -- 0:00:09
Average standard deviation of split frequencies: 0.007645
855500 -- (-1131.628) [-1127.654] (-1128.923) (-1128.006) * (-1128.113) (-1131.521) [-1129.234] (-1130.710) -- 0:00:09
856000 -- (-1127.625) [-1128.995] (-1127.553) (-1129.771) * (-1129.127) (-1127.794) [-1131.924] (-1127.837) -- 0:00:09
856500 -- (-1129.094) (-1130.993) (-1133.339) [-1135.076] * (-1131.095) (-1128.091) (-1130.846) [-1127.667] -- 0:00:09
857000 -- (-1129.537) (-1129.108) [-1129.099] (-1133.138) * [-1130.394] (-1130.544) (-1131.154) (-1132.262) -- 0:00:09
857500 -- (-1128.408) (-1128.840) (-1128.451) [-1132.365] * (-1127.734) (-1131.345) [-1129.552] (-1131.582) -- 0:00:08
858000 -- [-1128.241] (-1133.221) (-1132.739) (-1128.144) * (-1132.719) (-1128.884) [-1127.393] (-1133.792) -- 0:00:08
858500 -- (-1131.726) (-1128.714) [-1128.724] (-1128.442) * (-1133.413) (-1127.635) (-1127.712) [-1129.073] -- 0:00:08
859000 -- (-1129.737) (-1129.493) [-1129.348] (-1133.898) * [-1128.102] (-1127.306) (-1128.791) (-1127.780) -- 0:00:08
859500 -- (-1130.172) (-1127.006) (-1128.966) [-1127.765] * (-1131.351) (-1127.934) [-1128.595] (-1130.617) -- 0:00:08
860000 -- (-1131.552) (-1127.723) (-1130.184) [-1128.383] * (-1128.346) (-1132.126) [-1127.583] (-1129.781) -- 0:00:08
Average standard deviation of split frequencies: 0.007926
860500 -- (-1130.975) (-1132.184) (-1130.162) [-1129.580] * (-1129.396) (-1130.643) [-1128.105] (-1127.786) -- 0:00:08
861000 -- (-1130.034) [-1129.550] (-1129.580) (-1131.454) * (-1129.776) (-1127.790) (-1131.777) [-1127.439] -- 0:00:08
861500 -- (-1131.020) (-1136.459) (-1127.035) [-1133.111] * [-1127.609] (-1130.781) (-1129.987) (-1130.535) -- 0:00:08
862000 -- (-1127.414) (-1137.459) [-1129.096] (-1131.141) * (-1128.114) [-1129.251] (-1130.103) (-1130.045) -- 0:00:08
862500 -- (-1130.442) (-1130.921) (-1130.581) [-1136.658] * (-1130.952) (-1130.827) [-1129.931] (-1129.145) -- 0:00:08
863000 -- (-1129.997) [-1127.282] (-1131.819) (-1133.823) * (-1132.290) [-1130.375] (-1127.865) (-1131.793) -- 0:00:08
863500 -- [-1128.762] (-1129.223) (-1131.469) (-1130.141) * (-1131.030) (-1131.437) [-1127.917] (-1128.727) -- 0:00:08
864000 -- (-1132.801) (-1130.092) [-1129.932] (-1129.586) * (-1132.210) [-1128.673] (-1127.423) (-1127.279) -- 0:00:08
864500 -- (-1127.402) (-1128.787) (-1130.571) [-1128.380] * (-1131.876) (-1130.752) (-1131.036) [-1128.592] -- 0:00:08
865000 -- (-1127.298) (-1128.457) (-1129.287) [-1127.639] * [-1128.445] (-1129.539) (-1132.436) (-1136.258) -- 0:00:08
Average standard deviation of split frequencies: 0.007589
865500 -- (-1129.337) (-1128.277) (-1129.072) [-1130.256] * (-1127.409) (-1130.888) [-1129.379] (-1131.337) -- 0:00:08
866000 -- (-1131.385) (-1128.936) (-1136.362) [-1131.766] * (-1128.294) (-1129.359) (-1132.664) [-1128.604] -- 0:00:08
866500 -- (-1128.069) (-1132.090) (-1128.773) [-1128.178] * (-1128.317) (-1130.088) [-1128.372] (-1129.793) -- 0:00:08
867000 -- (-1128.341) [-1129.960] (-1128.546) (-1127.779) * (-1127.831) (-1132.372) (-1130.363) [-1129.886] -- 0:00:08
867500 -- (-1129.644) (-1128.629) [-1130.265] (-1130.114) * (-1127.389) (-1127.583) [-1128.079] (-1127.122) -- 0:00:08
868000 -- (-1129.158) [-1132.745] (-1129.450) (-1129.287) * [-1127.882] (-1127.272) (-1131.474) (-1128.599) -- 0:00:08
868500 -- [-1129.754] (-1130.474) (-1132.025) (-1127.579) * (-1127.355) [-1129.166] (-1130.072) (-1129.873) -- 0:00:08
869000 -- (-1129.198) [-1129.285] (-1127.418) (-1127.177) * (-1127.309) (-1127.741) (-1129.802) [-1128.173] -- 0:00:08
869500 -- (-1131.102) (-1129.297) [-1128.223] (-1128.131) * (-1127.559) (-1129.799) [-1129.178] (-1128.993) -- 0:00:08
870000 -- (-1131.586) (-1132.122) [-1130.867] (-1129.003) * (-1128.736) (-1131.581) [-1129.952] (-1129.934) -- 0:00:08
Average standard deviation of split frequencies: 0.008217
870500 -- [-1130.635] (-1129.938) (-1129.399) (-1127.416) * (-1129.021) (-1130.811) (-1132.737) [-1128.108] -- 0:00:08
871000 -- (-1130.997) (-1128.186) [-1127.661] (-1128.159) * (-1128.454) (-1129.777) [-1130.597] (-1127.707) -- 0:00:08
871500 -- [-1127.941] (-1128.239) (-1128.469) (-1128.476) * (-1128.377) (-1129.058) (-1132.095) [-1130.680] -- 0:00:08
872000 -- (-1129.177) [-1133.973] (-1128.730) (-1129.967) * (-1128.337) (-1130.780) [-1132.183] (-1127.761) -- 0:00:08
872500 -- (-1129.731) (-1133.308) [-1127.320] (-1130.099) * (-1131.344) (-1128.184) [-1133.918] (-1129.510) -- 0:00:08
873000 -- (-1129.925) (-1128.709) [-1127.873] (-1129.194) * (-1128.124) [-1128.112] (-1128.766) (-1130.246) -- 0:00:08
873500 -- (-1129.651) (-1129.086) (-1129.331) [-1129.677] * (-1128.940) (-1127.856) [-1126.868] (-1129.637) -- 0:00:07
874000 -- (-1129.851) [-1129.035] (-1129.531) (-1130.049) * (-1129.616) (-1130.308) [-1129.063] (-1132.104) -- 0:00:07
874500 -- (-1130.316) [-1129.421] (-1129.258) (-1130.776) * (-1130.333) [-1129.386] (-1131.340) (-1129.505) -- 0:00:07
875000 -- [-1129.142] (-1127.786) (-1131.399) (-1131.616) * [-1129.922] (-1127.436) (-1128.377) (-1130.390) -- 0:00:07
Average standard deviation of split frequencies: 0.007755
875500 -- [-1128.747] (-1128.871) (-1128.006) (-1129.556) * (-1128.405) (-1129.189) (-1131.223) [-1128.875] -- 0:00:07
876000 -- (-1130.674) [-1127.475] (-1128.177) (-1129.961) * (-1130.115) (-1128.766) (-1127.478) [-1127.946] -- 0:00:07
876500 -- (-1127.958) (-1128.526) [-1130.912] (-1129.441) * (-1129.320) (-1128.800) (-1130.938) [-1128.900] -- 0:00:07
877000 -- (-1127.562) [-1128.595] (-1127.677) (-1133.650) * (-1129.721) [-1130.032] (-1133.016) (-1132.157) -- 0:00:07
877500 -- [-1128.256] (-1130.351) (-1130.693) (-1129.278) * [-1131.069] (-1128.503) (-1129.821) (-1128.669) -- 0:00:07
878000 -- (-1128.789) (-1132.384) (-1131.013) [-1127.799] * (-1134.176) (-1127.785) (-1128.295) [-1129.093] -- 0:00:07
878500 -- (-1128.875) (-1127.258) [-1128.760] (-1129.023) * (-1130.250) (-1129.259) [-1127.886] (-1128.359) -- 0:00:07
879000 -- [-1128.929] (-1130.726) (-1127.212) (-1129.473) * (-1130.337) (-1129.375) [-1127.715] (-1132.752) -- 0:00:07
879500 -- (-1128.506) (-1132.364) [-1127.276] (-1133.003) * (-1131.444) (-1129.878) [-1128.902] (-1130.540) -- 0:00:07
880000 -- (-1130.339) (-1132.497) (-1128.825) [-1129.301] * (-1133.952) [-1128.283] (-1129.284) (-1127.914) -- 0:00:07
Average standard deviation of split frequencies: 0.007588
880500 -- (-1128.713) (-1129.253) [-1128.936] (-1132.888) * (-1127.969) (-1128.598) (-1129.662) [-1128.000] -- 0:00:07
881000 -- (-1127.644) (-1133.152) (-1128.954) [-1130.107] * (-1130.269) [-1132.994] (-1129.384) (-1128.949) -- 0:00:07
881500 -- (-1128.512) (-1129.307) (-1129.632) [-1127.250] * [-1128.509] (-1137.168) (-1128.462) (-1130.570) -- 0:00:07
882000 -- [-1129.504] (-1128.443) (-1130.860) (-1129.101) * (-1130.007) [-1132.797] (-1130.749) (-1130.862) -- 0:00:07
882500 -- (-1130.778) (-1130.216) [-1128.725] (-1134.879) * (-1128.223) [-1128.862] (-1128.799) (-1129.938) -- 0:00:07
883000 -- (-1130.411) [-1130.835] (-1131.183) (-1130.731) * (-1130.618) [-1127.412] (-1128.458) (-1129.508) -- 0:00:07
883500 -- (-1127.582) (-1131.799) (-1132.457) [-1128.784] * (-1127.923) (-1129.930) [-1128.985] (-1127.837) -- 0:00:07
884000 -- (-1128.530) (-1130.253) [-1129.333] (-1132.131) * (-1129.103) (-1129.021) [-1128.822] (-1130.596) -- 0:00:07
884500 -- (-1135.371) (-1129.130) (-1130.869) [-1130.138] * (-1129.961) (-1128.843) [-1130.782] (-1128.759) -- 0:00:07
885000 -- (-1127.825) (-1128.641) [-1131.032] (-1131.033) * (-1130.712) (-1128.245) (-1130.078) [-1127.826] -- 0:00:07
Average standard deviation of split frequencies: 0.007449
885500 -- (-1128.771) (-1130.554) [-1129.304] (-1129.467) * (-1129.982) (-1128.560) (-1127.770) [-1127.226] -- 0:00:07
886000 -- (-1127.999) (-1129.137) [-1129.034] (-1130.180) * (-1130.438) (-1128.834) (-1128.334) [-1127.882] -- 0:00:07
886500 -- (-1130.048) (-1129.010) (-1129.842) [-1129.255] * (-1129.718) (-1128.503) [-1131.421] (-1127.661) -- 0:00:07
887000 -- (-1131.274) (-1128.367) (-1132.845) [-1129.838] * (-1131.332) [-1131.877] (-1128.593) (-1127.733) -- 0:00:07
887500 -- [-1130.143] (-1134.812) (-1131.018) (-1128.798) * (-1128.530) [-1128.183] (-1129.384) (-1127.659) -- 0:00:07
888000 -- (-1129.456) [-1128.638] (-1127.833) (-1128.958) * (-1131.387) [-1128.443] (-1129.475) (-1130.233) -- 0:00:07
888500 -- (-1129.771) [-1128.537] (-1128.408) (-1132.501) * (-1128.590) (-1133.204) (-1127.165) [-1131.603] -- 0:00:07
889000 -- (-1130.939) [-1127.333] (-1129.938) (-1127.920) * (-1128.140) [-1130.187] (-1127.269) (-1128.660) -- 0:00:06
889500 -- [-1128.050] (-1128.143) (-1131.152) (-1130.005) * (-1131.748) (-1130.544) (-1135.755) [-1128.524] -- 0:00:06
890000 -- (-1130.340) (-1128.842) [-1129.780] (-1129.375) * [-1132.190] (-1135.172) (-1130.403) (-1132.488) -- 0:00:06
Average standard deviation of split frequencies: 0.007377
890500 -- (-1129.697) (-1132.833) [-1129.748] (-1128.821) * [-1133.256] (-1133.072) (-1130.902) (-1130.587) -- 0:00:06
891000 -- (-1130.473) [-1129.418] (-1128.664) (-1129.065) * [-1128.705] (-1132.854) (-1130.998) (-1130.284) -- 0:00:06
891500 -- [-1130.153] (-1127.802) (-1130.691) (-1130.742) * [-1128.628] (-1129.954) (-1127.716) (-1128.219) -- 0:00:06
892000 -- (-1128.639) (-1130.379) [-1130.540] (-1129.304) * (-1128.494) [-1128.718] (-1128.561) (-1128.925) -- 0:00:06
892500 -- (-1129.635) [-1129.428] (-1127.677) (-1130.491) * (-1129.106) (-1130.906) (-1136.624) [-1129.966] -- 0:00:06
893000 -- (-1129.863) [-1129.293] (-1127.800) (-1130.854) * (-1127.894) [-1129.930] (-1132.096) (-1128.614) -- 0:00:06
893500 -- (-1128.272) [-1130.208] (-1128.644) (-1129.646) * (-1129.354) [-1129.626] (-1132.588) (-1131.670) -- 0:00:06
894000 -- (-1128.599) (-1133.110) [-1129.353] (-1129.179) * (-1127.718) (-1129.876) (-1131.138) [-1130.975] -- 0:00:06
894500 -- (-1131.566) (-1133.995) [-1128.111] (-1130.172) * (-1128.373) (-1127.702) (-1129.670) [-1129.601] -- 0:00:06
895000 -- (-1128.966) (-1129.104) (-1131.021) [-1130.318] * (-1130.665) (-1128.254) [-1128.963] (-1129.170) -- 0:00:06
Average standard deviation of split frequencies: 0.007644
895500 -- [-1129.489] (-1129.169) (-1129.507) (-1129.224) * (-1128.468) (-1128.228) [-1128.826] (-1127.541) -- 0:00:06
896000 -- (-1128.413) (-1131.232) [-1128.043] (-1131.076) * (-1128.660) (-1127.741) (-1128.180) [-1127.423] -- 0:00:06
896500 -- (-1127.827) (-1129.077) [-1130.074] (-1129.077) * (-1130.172) [-1127.335] (-1130.479) (-1127.418) -- 0:00:06
897000 -- (-1128.004) [-1129.729] (-1129.267) (-1129.805) * (-1130.989) (-1128.780) [-1130.417] (-1127.719) -- 0:00:06
897500 -- (-1127.526) [-1130.133] (-1129.211) (-1133.307) * (-1135.251) (-1128.227) (-1134.197) [-1129.500] -- 0:00:06
898000 -- (-1127.232) [-1127.827] (-1128.901) (-1129.645) * (-1129.393) (-1133.809) [-1131.814] (-1129.614) -- 0:00:06
898500 -- (-1127.333) (-1129.506) [-1128.022] (-1131.745) * [-1129.637] (-1135.437) (-1131.582) (-1130.128) -- 0:00:06
899000 -- (-1132.551) [-1131.443] (-1127.766) (-1131.644) * [-1130.396] (-1130.825) (-1132.452) (-1130.823) -- 0:00:06
899500 -- [-1130.676] (-1128.834) (-1127.502) (-1128.636) * (-1131.727) [-1129.891] (-1132.496) (-1130.490) -- 0:00:06
900000 -- (-1130.569) (-1133.629) (-1130.468) [-1129.100] * (-1129.158) (-1129.371) (-1129.059) [-1128.698] -- 0:00:06
Average standard deviation of split frequencies: 0.007974
900500 -- (-1129.253) (-1133.124) [-1127.511] (-1129.359) * (-1128.282) (-1129.925) [-1129.757] (-1131.481) -- 0:00:06
901000 -- [-1128.007] (-1132.119) (-1128.376) (-1129.181) * (-1128.476) (-1134.823) (-1128.593) [-1128.953] -- 0:00:06
901500 -- [-1130.011] (-1129.534) (-1129.516) (-1130.003) * [-1128.735] (-1135.758) (-1127.993) (-1129.209) -- 0:00:06
902000 -- (-1128.036) (-1128.771) [-1128.404] (-1131.730) * (-1128.175) (-1129.330) [-1132.553] (-1129.945) -- 0:00:06
902500 -- (-1130.560) (-1127.669) (-1127.246) [-1129.637] * (-1132.179) (-1131.058) (-1127.870) [-1128.548] -- 0:00:06
903000 -- (-1132.090) (-1128.843) [-1127.832] (-1128.704) * (-1129.906) (-1128.462) [-1127.305] (-1131.774) -- 0:00:06
903500 -- [-1128.666] (-1130.102) (-1129.233) (-1130.889) * (-1129.448) [-1128.217] (-1128.118) (-1132.597) -- 0:00:06
904000 -- [-1130.609] (-1130.924) (-1132.198) (-1130.717) * (-1129.316) (-1128.907) [-1130.051] (-1132.301) -- 0:00:06
904500 -- (-1127.739) (-1128.267) [-1128.123] (-1127.945) * (-1130.195) [-1128.997] (-1130.060) (-1128.721) -- 0:00:06
905000 -- (-1128.698) [-1134.552] (-1130.579) (-1131.538) * (-1127.890) (-1128.000) [-1129.222] (-1127.635) -- 0:00:05
Average standard deviation of split frequencies: 0.008111
905500 -- (-1127.550) [-1128.207] (-1131.448) (-1128.096) * (-1127.213) (-1131.640) (-1128.309) [-1127.972] -- 0:00:05
906000 -- (-1128.272) (-1128.683) (-1127.350) [-1128.505] * (-1127.918) (-1127.519) [-1128.503] (-1127.950) -- 0:00:05
906500 -- (-1128.193) (-1129.373) (-1127.889) [-1129.183] * [-1129.284] (-1129.282) (-1129.276) (-1129.940) -- 0:00:05
907000 -- [-1127.883] (-1127.895) (-1128.049) (-1128.578) * (-1127.263) (-1130.316) [-1129.579] (-1134.355) -- 0:00:05
907500 -- (-1128.362) (-1131.245) (-1127.893) [-1127.785] * [-1127.275] (-1134.667) (-1130.023) (-1130.311) -- 0:00:05
908000 -- (-1130.706) (-1128.909) [-1128.780] (-1128.442) * (-1127.109) (-1132.942) (-1129.949) [-1129.768] -- 0:00:05
908500 -- (-1127.909) (-1130.774) (-1128.684) [-1129.196] * (-1128.672) (-1130.840) [-1128.269] (-1130.440) -- 0:00:05
909000 -- [-1129.757] (-1130.059) (-1129.628) (-1129.381) * [-1130.462] (-1129.524) (-1128.590) (-1130.454) -- 0:00:05
909500 -- (-1130.038) (-1129.435) [-1127.229] (-1129.026) * (-1129.249) (-1130.752) [-1127.395] (-1128.953) -- 0:00:05
910000 -- (-1129.394) (-1128.217) (-1131.481) [-1129.488] * (-1127.777) (-1131.120) [-1128.914] (-1132.669) -- 0:00:05
Average standard deviation of split frequencies: 0.008024
910500 -- (-1129.226) [-1128.277] (-1129.072) (-1133.994) * (-1127.182) (-1132.870) (-1130.625) [-1128.871] -- 0:00:05
911000 -- (-1128.965) (-1129.501) [-1129.533] (-1131.000) * [-1130.547] (-1130.602) (-1128.672) (-1128.545) -- 0:00:05
911500 -- (-1132.946) (-1130.547) [-1127.963] (-1130.127) * (-1131.077) (-1128.836) [-1129.699] (-1130.921) -- 0:00:05
912000 -- (-1128.937) (-1131.120) (-1130.215) [-1129.144] * (-1131.026) (-1127.494) [-1129.881] (-1131.856) -- 0:00:05
912500 -- (-1132.810) (-1130.947) [-1129.129] (-1129.874) * [-1128.738] (-1127.225) (-1130.284) (-1130.078) -- 0:00:05
913000 -- (-1132.931) (-1131.191) [-1130.047] (-1128.722) * [-1131.199] (-1127.257) (-1128.398) (-1132.958) -- 0:00:05
913500 -- (-1128.552) (-1131.268) (-1134.488) [-1128.426] * (-1130.713) (-1128.588) [-1128.200] (-1129.604) -- 0:00:05
914000 -- (-1128.547) (-1131.894) (-1129.581) [-1127.551] * [-1131.084] (-1131.520) (-1129.573) (-1129.340) -- 0:00:05
914500 -- [-1127.052] (-1132.468) (-1130.487) (-1128.039) * (-1129.031) (-1129.668) (-1132.132) [-1127.595] -- 0:00:05
915000 -- (-1129.297) (-1129.319) [-1127.919] (-1133.226) * (-1128.475) (-1129.271) (-1129.020) [-1127.571] -- 0:00:05
Average standard deviation of split frequencies: 0.008113
915500 -- (-1129.398) (-1128.969) (-1131.112) [-1132.337] * (-1133.129) (-1132.127) [-1129.091] (-1128.737) -- 0:00:05
916000 -- (-1128.050) (-1127.753) (-1132.189) [-1127.867] * (-1130.066) [-1128.641] (-1127.941) (-1131.745) -- 0:00:05
916500 -- [-1127.328] (-1128.037) (-1128.805) (-1128.383) * (-1131.550) [-1127.740] (-1128.447) (-1129.382) -- 0:00:05
917000 -- [-1127.733] (-1130.472) (-1130.871) (-1128.336) * (-1130.783) (-1131.446) (-1129.187) [-1133.743] -- 0:00:05
917500 -- (-1129.980) (-1128.699) (-1128.650) [-1127.479] * (-1130.857) (-1128.671) (-1132.878) [-1128.166] -- 0:00:05
918000 -- (-1129.199) (-1130.261) [-1127.859] (-1130.446) * (-1130.833) (-1127.188) [-1129.424] (-1127.844) -- 0:00:05
918500 -- (-1128.219) [-1128.998] (-1131.441) (-1134.344) * [-1129.598] (-1133.835) (-1128.042) (-1128.239) -- 0:00:05
919000 -- (-1131.532) (-1129.489) (-1128.716) [-1129.846] * [-1127.752] (-1130.573) (-1129.481) (-1127.916) -- 0:00:05
919500 -- (-1132.556) [-1130.011] (-1129.458) (-1129.552) * [-1127.752] (-1128.252) (-1131.942) (-1128.947) -- 0:00:05
920000 -- [-1130.266] (-1131.460) (-1127.697) (-1134.760) * (-1127.626) (-1131.084) [-1129.570] (-1131.163) -- 0:00:05
Average standard deviation of split frequencies: 0.008384
920500 -- [-1131.168] (-1127.514) (-1127.763) (-1132.997) * [-1128.905] (-1128.141) (-1129.477) (-1129.593) -- 0:00:05
921000 -- (-1136.140) [-1129.020] (-1129.732) (-1130.252) * (-1130.606) (-1129.260) (-1130.660) [-1127.569] -- 0:00:04
921500 -- (-1138.309) (-1129.506) [-1128.144] (-1131.339) * [-1129.855] (-1130.474) (-1129.665) (-1129.737) -- 0:00:04
922000 -- (-1132.974) (-1128.286) [-1128.033] (-1128.445) * (-1128.447) (-1129.295) [-1129.143] (-1129.030) -- 0:00:04
922500 -- (-1128.286) (-1127.645) [-1129.881] (-1128.109) * (-1128.299) (-1128.722) [-1128.097] (-1128.803) -- 0:00:04
923000 -- (-1129.163) (-1129.266) (-1128.065) [-1128.159] * [-1129.139] (-1129.976) (-1128.088) (-1129.244) -- 0:00:04
923500 -- (-1127.698) (-1131.143) [-1130.918] (-1127.898) * (-1127.796) (-1130.979) (-1129.065) [-1129.531] -- 0:00:04
924000 -- (-1128.071) [-1129.510] (-1128.916) (-1127.872) * (-1131.500) (-1131.336) [-1129.654] (-1129.998) -- 0:00:04
924500 -- (-1127.083) [-1129.451] (-1130.227) (-1128.720) * [-1132.391] (-1129.012) (-1131.550) (-1127.670) -- 0:00:04
925000 -- (-1127.037) [-1127.156] (-1129.331) (-1135.154) * (-1130.618) (-1129.293) (-1130.063) [-1127.851] -- 0:00:04
Average standard deviation of split frequencies: 0.007816
925500 -- (-1129.471) (-1128.261) (-1130.015) [-1127.390] * [-1129.347] (-1128.938) (-1129.635) (-1129.752) -- 0:00:04
926000 -- (-1130.455) (-1128.934) (-1128.268) [-1130.406] * (-1130.086) [-1128.663] (-1128.744) (-1133.747) -- 0:00:04
926500 -- [-1129.790] (-1136.346) (-1130.263) (-1129.993) * (-1127.309) (-1128.325) [-1128.309] (-1130.568) -- 0:00:04
927000 -- (-1126.939) (-1131.350) (-1129.366) [-1130.359] * [-1128.268] (-1129.474) (-1131.984) (-1130.783) -- 0:00:04
927500 -- (-1129.716) (-1127.577) (-1127.825) [-1127.013] * (-1130.569) (-1129.277) [-1131.483] (-1129.576) -- 0:00:04
928000 -- (-1128.764) (-1129.538) (-1130.121) [-1127.919] * [-1129.976] (-1129.671) (-1128.427) (-1129.953) -- 0:00:04
928500 -- [-1129.272] (-1129.984) (-1127.833) (-1127.678) * [-1127.928] (-1129.217) (-1129.786) (-1127.300) -- 0:00:04
929000 -- [-1128.911] (-1127.992) (-1127.458) (-1132.515) * (-1127.693) (-1131.496) (-1127.469) [-1128.137] -- 0:00:04
929500 -- [-1129.876] (-1130.841) (-1132.953) (-1132.587) * (-1127.614) (-1128.606) [-1128.760] (-1128.783) -- 0:00:04
930000 -- (-1131.639) (-1128.238) [-1128.584] (-1131.357) * (-1131.108) (-1127.569) (-1128.043) [-1129.009] -- 0:00:04
Average standard deviation of split frequencies: 0.007300
930500 -- (-1130.210) [-1127.318] (-1132.021) (-1131.509) * (-1129.074) [-1128.024] (-1129.348) (-1131.069) -- 0:00:04
931000 -- (-1130.687) (-1128.154) (-1128.887) [-1128.616] * [-1132.421] (-1128.410) (-1129.389) (-1133.066) -- 0:00:04
931500 -- (-1128.084) [-1128.376] (-1129.702) (-1131.166) * (-1134.666) (-1127.779) (-1129.464) [-1132.522] -- 0:00:04
932000 -- (-1129.838) (-1133.025) (-1129.415) [-1128.744] * (-1128.015) (-1128.571) [-1127.561] (-1128.536) -- 0:00:04
932500 -- [-1130.579] (-1129.771) (-1128.646) (-1133.275) * (-1130.388) (-1127.738) (-1128.285) [-1128.794] -- 0:00:04
933000 -- (-1129.311) (-1129.082) [-1129.296] (-1134.691) * (-1131.317) [-1127.921] (-1131.973) (-1128.169) -- 0:00:04
933500 -- [-1129.588] (-1134.208) (-1133.615) (-1130.907) * (-1136.666) (-1128.198) [-1128.848] (-1130.655) -- 0:00:04
934000 -- (-1128.085) [-1131.368] (-1129.547) (-1129.533) * [-1127.980] (-1130.387) (-1129.417) (-1129.163) -- 0:00:04
934500 -- (-1127.186) (-1137.100) (-1129.294) [-1128.027] * [-1128.601] (-1130.477) (-1134.032) (-1134.310) -- 0:00:04
935000 -- [-1128.408] (-1129.784) (-1132.447) (-1127.968) * (-1128.487) [-1127.428] (-1133.325) (-1127.730) -- 0:00:04
Average standard deviation of split frequencies: 0.007199
935500 -- (-1129.801) (-1129.357) (-1130.034) [-1129.516] * (-1130.100) [-1128.187] (-1129.360) (-1128.692) -- 0:00:04
936000 -- (-1128.909) (-1130.079) (-1130.801) [-1128.348] * [-1130.140] (-1128.611) (-1129.763) (-1130.650) -- 0:00:04
936500 -- (-1128.249) (-1128.799) [-1132.616] (-1128.235) * (-1131.155) [-1129.368] (-1128.175) (-1128.948) -- 0:00:04
937000 -- (-1127.707) (-1129.552) (-1130.235) [-1127.629] * [-1127.888] (-1127.894) (-1132.924) (-1130.775) -- 0:00:03
937500 -- (-1127.783) (-1128.619) (-1132.031) [-1129.761] * (-1127.063) (-1128.376) [-1128.224] (-1130.557) -- 0:00:03
938000 -- [-1127.874] (-1127.076) (-1128.760) (-1127.705) * (-1130.372) (-1128.735) (-1128.723) [-1131.317] -- 0:00:03
938500 -- (-1129.734) [-1129.191] (-1128.610) (-1128.120) * (-1128.187) [-1129.093] (-1128.686) (-1127.927) -- 0:00:03
939000 -- [-1133.286] (-1128.650) (-1128.691) (-1128.399) * (-1128.491) (-1129.404) (-1128.929) [-1127.246] -- 0:00:03
939500 -- (-1128.043) (-1129.205) (-1129.509) [-1131.336] * [-1128.367] (-1129.525) (-1129.751) (-1131.432) -- 0:00:03
940000 -- (-1127.459) (-1131.812) [-1128.649] (-1129.311) * (-1129.796) (-1129.996) [-1129.620] (-1131.250) -- 0:00:03
Average standard deviation of split frequencies: 0.007311
940500 -- (-1130.406) [-1131.514] (-1131.560) (-1129.015) * [-1130.641] (-1128.407) (-1131.686) (-1132.086) -- 0:00:03
941000 -- (-1131.579) (-1129.566) [-1128.851] (-1129.684) * (-1128.358) (-1129.918) (-1131.062) [-1128.670] -- 0:00:03
941500 -- (-1129.562) (-1129.491) (-1130.660) [-1139.503] * (-1130.112) (-1127.995) (-1130.708) [-1127.042] -- 0:00:03
942000 -- [-1130.546] (-1130.900) (-1131.115) (-1131.866) * (-1128.175) (-1130.066) (-1130.525) [-1128.602] -- 0:00:03
942500 -- [-1130.670] (-1129.021) (-1136.442) (-1136.550) * [-1131.222] (-1130.120) (-1129.204) (-1127.882) -- 0:00:03
943000 -- [-1133.100] (-1130.778) (-1130.819) (-1130.300) * (-1128.454) (-1129.882) [-1128.390] (-1129.782) -- 0:00:03
943500 -- [-1129.208] (-1127.814) (-1128.360) (-1135.179) * (-1127.935) (-1129.034) (-1127.993) [-1132.649] -- 0:00:03
944000 -- (-1130.054) [-1127.336] (-1129.639) (-1128.259) * [-1130.931] (-1132.526) (-1128.265) (-1128.107) -- 0:00:03
944500 -- [-1130.345] (-1127.218) (-1132.042) (-1128.396) * (-1130.169) [-1128.749] (-1134.991) (-1131.082) -- 0:00:03
945000 -- [-1132.224] (-1127.898) (-1131.956) (-1129.084) * (-1130.080) [-1129.544] (-1128.743) (-1130.080) -- 0:00:03
Average standard deviation of split frequencies: 0.007357
945500 -- (-1132.786) [-1127.641] (-1129.052) (-1128.806) * (-1129.455) (-1127.391) (-1128.159) [-1130.751] -- 0:00:03
946000 -- (-1128.699) [-1128.050] (-1130.033) (-1128.281) * (-1130.554) (-1129.515) (-1130.346) [-1128.840] -- 0:00:03
946500 -- (-1129.521) (-1127.569) (-1132.467) [-1129.965] * (-1129.078) (-1128.723) (-1129.895) [-1128.612] -- 0:00:03
947000 -- (-1130.508) (-1131.940) [-1128.264] (-1130.551) * [-1129.509] (-1128.676) (-1133.002) (-1129.502) -- 0:00:03
947500 -- (-1128.135) [-1130.078] (-1129.057) (-1131.000) * (-1129.677) (-1132.104) [-1128.752] (-1128.454) -- 0:00:03
948000 -- (-1128.988) [-1131.925] (-1127.392) (-1127.036) * (-1129.297) (-1129.543) (-1129.776) [-1131.282] -- 0:00:03
948500 -- (-1127.632) (-1129.348) [-1128.063] (-1128.335) * (-1128.611) (-1131.646) (-1128.725) [-1128.714] -- 0:00:03
949000 -- (-1128.145) (-1128.840) [-1127.719] (-1128.990) * (-1128.146) [-1130.713] (-1132.211) (-1128.176) -- 0:00:03
949500 -- (-1129.330) (-1128.685) (-1127.724) [-1128.616] * (-1131.676) (-1128.629) [-1129.272] (-1132.736) -- 0:00:03
950000 -- (-1128.683) (-1127.404) [-1128.314] (-1129.819) * (-1127.482) [-1128.188] (-1132.845) (-1130.050) -- 0:00:03
Average standard deviation of split frequencies: 0.007526
950500 -- (-1130.175) (-1128.598) [-1129.616] (-1130.552) * (-1129.417) [-1128.538] (-1134.029) (-1133.982) -- 0:00:03
951000 -- (-1130.523) [-1130.189] (-1130.407) (-1132.978) * [-1129.021] (-1130.843) (-1131.126) (-1131.392) -- 0:00:03
951500 -- (-1128.930) (-1129.045) [-1127.642] (-1131.169) * (-1127.420) (-1130.015) [-1129.934] (-1128.820) -- 0:00:03
952000 -- (-1134.478) (-1129.707) (-1129.263) [-1130.063] * (-1127.525) [-1128.392] (-1130.962) (-1128.298) -- 0:00:03
952500 -- [-1128.396] (-1128.926) (-1130.526) (-1128.632) * [-1130.503] (-1132.536) (-1128.761) (-1130.295) -- 0:00:02
953000 -- [-1127.752] (-1135.803) (-1132.515) (-1128.489) * (-1127.176) [-1129.415] (-1129.903) (-1131.955) -- 0:00:02
953500 -- [-1128.156] (-1130.127) (-1127.734) (-1131.106) * [-1128.789] (-1130.237) (-1127.915) (-1129.090) -- 0:00:02
954000 -- (-1133.825) (-1129.792) [-1127.486] (-1128.381) * (-1128.676) (-1127.424) (-1129.298) [-1129.143] -- 0:00:02
954500 -- (-1131.619) (-1127.633) [-1128.422] (-1129.259) * (-1127.058) (-1131.705) [-1127.766] (-1129.258) -- 0:00:02
955000 -- (-1132.804) (-1127.512) (-1129.448) [-1128.707] * (-1131.978) (-1130.358) (-1128.473) [-1128.411] -- 0:00:02
Average standard deviation of split frequencies: 0.007705
955500 -- (-1135.839) (-1130.485) [-1128.693] (-1128.401) * (-1128.384) [-1129.640] (-1130.069) (-1128.592) -- 0:00:02
956000 -- (-1131.584) (-1127.991) (-1131.390) [-1130.886] * (-1131.226) (-1137.064) (-1129.542) [-1129.388] -- 0:00:02
956500 -- (-1134.938) (-1127.305) [-1129.554] (-1133.303) * (-1128.636) (-1132.494) (-1134.756) [-1127.470] -- 0:00:02
957000 -- (-1130.221) (-1129.226) (-1128.001) [-1130.113] * [-1130.126] (-1128.921) (-1133.474) (-1131.803) -- 0:00:02
957500 -- (-1130.302) [-1133.252] (-1128.552) (-1129.003) * (-1132.716) (-1128.820) (-1130.038) [-1130.251] -- 0:00:02
958000 -- (-1130.834) (-1127.012) [-1129.421] (-1130.053) * [-1130.019] (-1127.507) (-1137.682) (-1128.340) -- 0:00:02
958500 -- (-1128.655) (-1127.689) (-1130.997) [-1132.438] * (-1128.654) (-1128.000) [-1131.747] (-1128.477) -- 0:00:02
959000 -- (-1127.892) [-1127.182] (-1129.358) (-1131.224) * (-1131.244) (-1128.989) [-1128.865] (-1128.690) -- 0:00:02
959500 -- (-1128.002) [-1127.698] (-1128.856) (-1130.190) * [-1128.375] (-1130.258) (-1128.864) (-1132.024) -- 0:00:02
960000 -- (-1129.915) (-1129.888) [-1127.379] (-1130.367) * (-1129.520) (-1129.167) (-1135.371) [-1130.984] -- 0:00:02
Average standard deviation of split frequencies: 0.007759
960500 -- [-1130.632] (-1128.966) (-1127.554) (-1132.940) * (-1130.060) (-1128.561) (-1130.333) [-1128.554] -- 0:00:02
961000 -- (-1127.492) (-1127.471) [-1127.833] (-1131.915) * (-1127.958) (-1130.836) [-1131.336] (-1127.498) -- 0:00:02
961500 -- (-1130.671) (-1128.779) [-1133.068] (-1131.304) * (-1128.431) (-1129.095) [-1130.457] (-1127.492) -- 0:00:02
962000 -- (-1128.351) (-1128.951) (-1130.417) [-1131.145] * (-1129.582) (-1128.018) (-1135.380) [-1130.423] -- 0:00:02
962500 -- (-1127.508) (-1129.933) [-1130.797] (-1129.352) * (-1129.251) (-1128.919) [-1127.930] (-1129.276) -- 0:00:02
963000 -- (-1128.918) (-1127.801) (-1130.629) [-1127.950] * (-1128.993) (-1128.790) (-1131.456) [-1129.102] -- 0:00:02
963500 -- [-1127.358] (-1131.100) (-1130.196) (-1130.913) * (-1128.457) (-1128.959) (-1130.957) [-1130.787] -- 0:00:02
964000 -- (-1129.326) [-1132.493] (-1128.723) (-1129.940) * (-1131.432) [-1128.079] (-1127.870) (-1131.285) -- 0:00:02
964500 -- (-1127.095) [-1129.564] (-1130.893) (-1128.340) * (-1132.139) (-1128.651) [-1127.724] (-1128.639) -- 0:00:02
965000 -- (-1131.421) [-1131.207] (-1130.985) (-1128.483) * (-1132.920) (-1131.197) (-1133.184) [-1128.050] -- 0:00:02
Average standard deviation of split frequencies: 0.007960
965500 -- (-1129.452) [-1128.286] (-1135.054) (-1128.294) * [-1128.874] (-1137.440) (-1130.392) (-1128.920) -- 0:00:02
966000 -- [-1129.608] (-1128.825) (-1128.043) (-1128.277) * [-1128.425] (-1129.948) (-1129.763) (-1132.116) -- 0:00:02
966500 -- [-1127.805] (-1132.554) (-1130.752) (-1128.586) * [-1129.535] (-1131.393) (-1132.448) (-1131.157) -- 0:00:02
967000 -- [-1129.288] (-1133.400) (-1131.985) (-1130.053) * (-1128.852) (-1128.858) [-1130.379] (-1130.524) -- 0:00:02
967500 -- (-1128.492) (-1127.393) [-1131.206] (-1131.348) * (-1129.760) (-1127.682) (-1127.814) [-1127.411] -- 0:00:02
968000 -- (-1130.676) (-1126.916) [-1129.366] (-1130.604) * (-1127.726) (-1127.495) (-1128.120) [-1127.926] -- 0:00:02
968500 -- (-1134.737) (-1127.506) (-1129.670) [-1127.699] * (-1127.756) [-1128.887] (-1127.432) (-1130.368) -- 0:00:01
969000 -- [-1131.894] (-1131.675) (-1128.808) (-1128.209) * (-1128.086) [-1130.588] (-1131.825) (-1129.706) -- 0:00:01
969500 -- (-1129.041) (-1131.906) (-1127.876) [-1130.039] * [-1127.992] (-1129.740) (-1129.024) (-1129.625) -- 0:00:01
970000 -- (-1131.012) (-1130.665) (-1128.952) [-1130.198] * (-1127.615) [-1129.106] (-1127.391) (-1131.383) -- 0:00:01
Average standard deviation of split frequencies: 0.007570
970500 -- (-1129.633) (-1130.140) (-1127.517) [-1130.399] * (-1127.706) (-1128.803) (-1128.461) [-1128.687] -- 0:00:01
971000 -- [-1128.480] (-1129.275) (-1129.477) (-1129.044) * [-1128.704] (-1129.244) (-1128.547) (-1128.360) -- 0:00:01
971500 -- (-1128.854) (-1128.321) (-1130.197) [-1128.610] * (-1128.651) [-1128.841] (-1128.350) (-1132.474) -- 0:00:01
972000 -- [-1128.673] (-1129.861) (-1130.792) (-1129.447) * (-1132.861) (-1131.680) [-1128.426] (-1128.319) -- 0:00:01
972500 -- (-1129.542) (-1127.371) (-1130.797) [-1129.466] * (-1129.111) [-1130.870] (-1128.197) (-1129.063) -- 0:00:01
973000 -- (-1128.757) [-1128.136] (-1130.326) (-1130.436) * (-1127.363) [-1128.427] (-1135.025) (-1128.575) -- 0:00:01
973500 -- (-1129.757) (-1127.987) [-1131.751] (-1128.609) * (-1129.053) (-1128.759) [-1129.584] (-1128.489) -- 0:00:01
974000 -- (-1129.381) [-1130.848] (-1131.617) (-1128.718) * (-1130.116) (-1128.718) (-1129.354) [-1128.502] -- 0:00:01
974500 -- (-1129.550) (-1128.554) [-1127.374] (-1128.497) * (-1130.210) (-1129.896) [-1131.698] (-1129.662) -- 0:00:01
975000 -- [-1129.777] (-1128.008) (-1129.740) (-1128.776) * (-1128.315) (-1129.933) [-1129.425] (-1128.253) -- 0:00:01
Average standard deviation of split frequencies: 0.008000
975500 -- (-1129.913) [-1128.660] (-1130.397) (-1129.230) * [-1135.253] (-1127.234) (-1129.901) (-1129.588) -- 0:00:01
976000 -- (-1130.578) [-1132.109] (-1129.296) (-1128.288) * (-1128.624) [-1127.064] (-1127.560) (-1130.303) -- 0:00:01
976500 -- [-1129.012] (-1129.091) (-1128.137) (-1131.054) * (-1132.770) (-1127.024) [-1128.893] (-1129.694) -- 0:00:01
977000 -- (-1129.456) (-1133.454) (-1129.364) [-1128.812] * (-1129.586) (-1127.390) (-1132.653) [-1128.282] -- 0:00:01
977500 -- (-1127.233) (-1129.869) (-1130.920) [-1127.530] * (-1131.324) (-1127.114) (-1131.162) [-1128.749] -- 0:00:01
978000 -- (-1130.302) (-1132.808) (-1128.451) [-1128.769] * (-1127.907) (-1127.863) [-1129.366] (-1129.725) -- 0:00:01
978500 -- (-1132.647) (-1131.072) (-1131.100) [-1128.728] * (-1131.552) (-1128.378) [-1130.307] (-1128.652) -- 0:00:01
979000 -- (-1127.322) (-1128.237) (-1132.718) [-1131.383] * (-1128.769) (-1127.909) (-1129.292) [-1129.662] -- 0:00:01
979500 -- (-1130.631) (-1131.171) (-1128.427) [-1127.522] * (-1128.177) [-1127.221] (-1127.523) (-1129.645) -- 0:00:01
980000 -- (-1130.099) [-1128.363] (-1133.686) (-1127.872) * (-1130.900) (-1130.457) (-1130.187) [-1127.438] -- 0:00:01
Average standard deviation of split frequencies: 0.007901
980500 -- (-1132.448) (-1127.616) [-1128.806] (-1127.754) * (-1128.349) (-1129.922) (-1128.134) [-1127.734] -- 0:00:01
981000 -- (-1128.451) (-1129.217) [-1126.854] (-1128.208) * (-1128.983) [-1128.462] (-1128.535) (-1128.789) -- 0:00:01
981500 -- [-1128.908] (-1127.823) (-1127.328) (-1128.138) * (-1127.693) (-1127.458) (-1137.319) [-1129.143] -- 0:00:01
982000 -- (-1132.443) (-1132.185) [-1131.088] (-1132.733) * (-1130.842) (-1135.575) (-1128.547) [-1127.788] -- 0:00:01
982500 -- (-1130.286) [-1130.930] (-1129.734) (-1131.931) * (-1130.277) (-1131.088) (-1129.547) [-1129.197] -- 0:00:01
983000 -- (-1131.231) (-1127.379) (-1132.580) [-1135.086] * [-1128.551] (-1127.595) (-1130.271) (-1129.103) -- 0:00:01
983500 -- [-1127.794] (-1128.467) (-1132.144) (-1134.097) * (-1128.759) (-1131.332) [-1130.752] (-1136.128) -- 0:00:01
984000 -- [-1133.745] (-1129.792) (-1130.334) (-1129.844) * [-1129.391] (-1129.406) (-1127.676) (-1129.744) -- 0:00:01
984500 -- [-1129.881] (-1129.399) (-1129.709) (-1128.575) * [-1129.160] (-1128.691) (-1131.846) (-1131.381) -- 0:00:00
985000 -- (-1127.632) (-1129.839) [-1128.719] (-1127.812) * [-1129.290] (-1131.731) (-1128.746) (-1131.482) -- 0:00:00
Average standard deviation of split frequencies: 0.008038
985500 -- [-1128.997] (-1128.698) (-1128.268) (-1128.785) * [-1129.725] (-1127.544) (-1131.367) (-1133.017) -- 0:00:00
986000 -- (-1129.247) [-1129.877] (-1130.516) (-1137.975) * (-1129.565) (-1127.568) [-1129.163] (-1132.691) -- 0:00:00
986500 -- [-1131.805] (-1127.643) (-1128.918) (-1133.387) * (-1128.792) [-1128.548] (-1129.329) (-1130.803) -- 0:00:00
987000 -- (-1127.752) (-1129.640) (-1128.974) [-1134.363] * (-1132.242) (-1130.456) [-1129.345] (-1130.465) -- 0:00:00
987500 -- (-1127.195) [-1130.940] (-1128.095) (-1129.250) * [-1127.722] (-1128.644) (-1128.805) (-1129.746) -- 0:00:00
988000 -- [-1127.675] (-1132.379) (-1131.185) (-1127.498) * (-1128.519) (-1129.347) [-1129.080] (-1131.853) -- 0:00:00
988500 -- (-1132.777) [-1133.323] (-1127.918) (-1128.505) * (-1131.333) (-1128.365) [-1127.759] (-1128.460) -- 0:00:00
989000 -- [-1129.132] (-1130.851) (-1134.793) (-1131.516) * [-1131.571] (-1129.544) (-1132.669) (-1127.700) -- 0:00:00
989500 -- [-1130.509] (-1132.321) (-1140.542) (-1128.833) * [-1129.045] (-1129.074) (-1128.229) (-1131.836) -- 0:00:00
990000 -- [-1130.501] (-1131.302) (-1130.135) (-1128.549) * (-1129.014) [-1128.625] (-1128.629) (-1130.698) -- 0:00:00
Average standard deviation of split frequencies: 0.007941
990500 -- (-1130.225) (-1129.457) (-1130.080) [-1127.987] * [-1130.453] (-1127.419) (-1127.661) (-1142.700) -- 0:00:00
991000 -- (-1126.936) (-1129.792) [-1131.656] (-1130.991) * (-1128.548) (-1129.162) (-1130.032) [-1134.166] -- 0:00:00
991500 -- (-1128.405) [-1127.596] (-1132.099) (-1128.055) * (-1131.200) (-1128.519) (-1130.619) [-1130.045] -- 0:00:00
992000 -- (-1127.974) (-1129.500) [-1130.756] (-1130.361) * [-1128.389] (-1130.889) (-1128.921) (-1133.421) -- 0:00:00
992500 -- [-1127.297] (-1129.965) (-1130.340) (-1128.882) * [-1128.246] (-1130.043) (-1128.713) (-1134.407) -- 0:00:00
993000 -- (-1128.977) [-1131.671] (-1128.414) (-1128.401) * [-1128.960] (-1135.071) (-1130.003) (-1132.273) -- 0:00:00
993500 -- [-1129.573] (-1132.219) (-1131.445) (-1130.089) * [-1130.427] (-1134.377) (-1132.735) (-1129.107) -- 0:00:00
994000 -- [-1128.758] (-1130.580) (-1129.975) (-1131.298) * [-1130.778] (-1130.160) (-1130.541) (-1129.653) -- 0:00:00
994500 -- (-1128.738) [-1131.125] (-1130.713) (-1128.996) * (-1130.228) (-1131.684) [-1130.413] (-1129.672) -- 0:00:00
995000 -- [-1129.653] (-1129.633) (-1128.158) (-1129.033) * [-1127.945] (-1130.752) (-1132.280) (-1128.425) -- 0:00:00
Average standard deviation of split frequencies: 0.007478
995500 -- (-1130.494) (-1128.810) (-1127.268) [-1129.324] * (-1128.658) (-1128.092) [-1130.548] (-1129.590) -- 0:00:00
996000 -- (-1133.528) [-1127.430] (-1127.441) (-1129.515) * (-1128.558) (-1128.568) (-1132.350) [-1129.278] -- 0:00:00
996500 -- (-1129.499) (-1130.231) [-1127.309] (-1128.102) * (-1127.189) (-1127.957) (-1127.224) [-1127.981] -- 0:00:00
997000 -- [-1129.179] (-1129.055) (-1128.938) (-1127.920) * (-1129.431) (-1128.093) (-1127.262) [-1128.331] -- 0:00:00
997500 -- (-1130.267) (-1130.387) (-1128.374) [-1133.261] * (-1128.118) (-1129.072) (-1128.368) [-1129.977] -- 0:00:00
998000 -- [-1127.628] (-1129.336) (-1128.605) (-1128.277) * [-1128.132] (-1128.398) (-1128.382) (-1130.237) -- 0:00:00
998500 -- (-1131.046) (-1128.645) (-1128.843) [-1129.009] * (-1128.865) (-1129.286) [-1128.454] (-1127.497) -- 0:00:00
999000 -- (-1130.369) (-1128.923) [-1127.341] (-1129.419) * (-1130.645) (-1129.637) [-1128.689] (-1127.550) -- 0:00:00
999500 -- (-1130.972) [-1127.810] (-1130.354) (-1129.495) * (-1127.312) (-1129.307) [-1130.321] (-1127.753) -- 0:00:00
1000000 -- (-1131.615) (-1129.081) (-1128.875) [-1132.638] * [-1127.477] (-1132.410) (-1130.636) (-1128.861) -- 0:00:00
Average standard deviation of split frequencies: 0.008126
Analysis completed in 1 mins 3 seconds
Analysis used 60.90 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1126.85
Likelihood of best state for "cold" chain of run 2 was -1126.85
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.7 % ( 22 %) Dirichlet(Pi{all})
29.1 % ( 24 %) Slider(Pi{all})
78.3 % ( 58 %) Multiplier(Alpha{1,2})
77.9 % ( 50 %) Multiplier(Alpha{3})
21.1 % ( 38 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.0 % ( 17 %) Dirichlet(Pi{all})
28.2 % ( 22 %) Slider(Pi{all})
78.7 % ( 47 %) Multiplier(Alpha{1,2})
78.1 % ( 50 %) Multiplier(Alpha{3})
20.4 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 15 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.51
2 | 166590 0.82 0.67
3 | 167202 166644 0.84
4 | 166830 166244 166490
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166293 0.82 0.67
3 | 166361 166839 0.83
4 | 166881 166598 167028
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1128.77
| 2 2 22 1 |
| 1 2 2 1 2 |
| 1 2 1 2 11 2 |
| 1 2 2 *2 2 21 2 2 1 2 2 |
| 1 1 * 2 1 2 12 22 2 |
| 2 2 1 1 1 * 2 1 1 1 1 11* 22 |
| * 211 1 1 21 2 21 * 1 1 2|
|1 2 1 2 2 1 1 11 1 1 2 1 22 |
|2 2 1 1 1 1 1|
| 22 2 2 2 |
| * 2 1 2 |
| 2 |
| 1 1 1 |
| 1 2 2 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1130.15
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1128.57 -1134.40
2 -1128.55 -1133.28
--------------------------------------
TOTAL -1128.56 -1133.99
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899583 0.092207 0.383720 1.518548 0.855725 1449.94 1475.47 1.000
r(A<->C){all} 0.169499 0.021337 0.000001 0.462392 0.131912 230.62 259.79 1.001
r(A<->G){all} 0.149009 0.015366 0.000145 0.398898 0.119741 217.41 223.07 1.000
r(A<->T){all} 0.172846 0.021093 0.000075 0.460197 0.130092 115.28 187.49 1.003
r(C<->G){all} 0.175175 0.020564 0.000292 0.469295 0.138065 169.04 192.09 1.000
r(C<->T){all} 0.167918 0.020434 0.000089 0.466817 0.131144 229.30 251.70 1.001
r(G<->T){all} 0.165553 0.018606 0.000119 0.437529 0.128847 187.79 201.84 1.001
pi(A){all} 0.212833 0.000199 0.186594 0.240972 0.212438 1180.40 1261.01 1.000
pi(C){all} 0.277609 0.000238 0.246426 0.306544 0.277292 1245.79 1353.39 1.000
pi(G){all} 0.327000 0.000272 0.296205 0.360679 0.326681 1249.31 1289.82 1.000
pi(T){all} 0.182558 0.000177 0.156646 0.208003 0.181937 1302.86 1334.20 1.000
alpha{1,2} 0.435200 0.243246 0.000102 1.395722 0.257004 1300.60 1304.70 1.000
alpha{3} 0.459596 0.241624 0.000465 1.434397 0.293093 1334.32 1344.79 1.000
pinvar{all} 0.998114 0.000005 0.994027 0.999999 0.998825 968.95 1221.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ...*.*
9 -- ..**..
10 -- ..****
11 -- .*.***
12 -- ....**
13 -- .*.*..
14 -- .*...*
15 -- .*..*.
16 -- ..*..*
17 -- ..*.*.
18 -- .**.**
19 -- ...**.
20 -- .**...
21 -- .****.
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.004240 0.151899 0.157895 2
8 458 0.152565 0.011306 0.144570 0.160560 2
9 446 0.148568 0.002827 0.146569 0.150566 2
10 442 0.147235 0.005653 0.143238 0.151233 2
11 435 0.144903 0.008009 0.139241 0.150566 2
12 432 0.143904 0.007537 0.138574 0.149234 2
13 431 0.143571 0.007066 0.138574 0.148568 2
14 431 0.143571 0.002355 0.141905 0.145237 2
15 427 0.142239 0.010835 0.134577 0.149900 2
16 421 0.140240 0.028737 0.119920 0.160560 2
17 415 0.138241 0.000471 0.137908 0.138574 2
18 412 0.137242 0.000000 0.137242 0.137242 2
19 410 0.136576 0.002827 0.134577 0.138574 2
20 405 0.134910 0.009893 0.127915 0.141905 2
21 405 0.134910 0.015546 0.123917 0.145903 2
22 277 0.092272 0.012719 0.083278 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098723 0.010455 0.000006 0.308623 0.066927 1.000 2
length{all}[2] 0.100244 0.010200 0.000014 0.299036 0.069007 1.000 2
length{all}[3] 0.100103 0.009921 0.000029 0.289278 0.071245 1.000 2
length{all}[4] 0.101387 0.010425 0.000024 0.302954 0.069496 1.000 2
length{all}[5] 0.097578 0.009457 0.000006 0.293090 0.068748 1.001 2
length{all}[6] 0.099515 0.009882 0.000001 0.306584 0.069138 1.000 2
length{all}[7] 0.102400 0.010862 0.000593 0.294978 0.068932 0.998 2
length{all}[8] 0.092516 0.009284 0.000160 0.273686 0.062309 1.001 2
length{all}[9] 0.099094 0.008328 0.000071 0.283582 0.071663 0.999 2
length{all}[10] 0.107197 0.010916 0.001100 0.322993 0.075590 1.014 2
length{all}[11] 0.098991 0.010792 0.000171 0.303806 0.064772 0.998 2
length{all}[12] 0.101867 0.010880 0.000417 0.317504 0.066151 1.000 2
length{all}[13] 0.099439 0.007978 0.000235 0.279159 0.075209 0.998 2
length{all}[14] 0.091969 0.009301 0.000401 0.282159 0.064321 0.999 2
length{all}[15] 0.097724 0.008523 0.000228 0.260614 0.069919 1.001 2
length{all}[16] 0.095197 0.008324 0.000425 0.271941 0.068619 0.998 2
length{all}[17] 0.102892 0.010095 0.000346 0.308946 0.069231 0.998 2
length{all}[18] 0.097559 0.011549 0.000016 0.297368 0.066751 1.001 2
length{all}[19] 0.106941 0.010583 0.000730 0.337610 0.073576 1.006 2
length{all}[20] 0.097168 0.008682 0.000117 0.282234 0.070063 0.998 2
length{all}[21] 0.102724 0.010804 0.000127 0.307562 0.069363 0.999 2
length{all}[22] 0.112054 0.012818 0.000888 0.353472 0.069204 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008126
Maximum standard deviation of split frequencies = 0.028737
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.014
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 828
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 276 / 276 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 276 / 276 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098478 0.078076 0.084463 0.068889 0.038006 0.087675 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1182.505346
Iterating by ming2
Initial: fx= 1182.505346
x= 0.09848 0.07808 0.08446 0.06889 0.03801 0.08767 0.30000 1.30000
1 h-m-p 0.0000 0.0001 657.8037 ++ 1121.511406 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0029 106.0501 ++ 1108.355394 m 0.0029 24 | 2/8
3 h-m-p 0.0000 0.0001 362.9175 ++ 1102.569398 m 0.0001 35 | 3/8
4 h-m-p 0.0002 0.0012 115.1766 ++ 1078.002541 m 0.0012 46 | 4/8
5 h-m-p 0.0003 0.0013 56.1790 ----------.. | 4/8
6 h-m-p 0.0000 0.0000 468.5993 ++ 1068.148980 m 0.0000 76 | 5/8
7 h-m-p 0.0160 8.0000 6.2835 -------------.. | 5/8
8 h-m-p 0.0000 0.0000 383.2607 ++ 1064.839947 m 0.0000 109 | 6/8
9 h-m-p 0.0160 8.0000 4.3586 -------------.. | 6/8
10 h-m-p 0.0000 0.0001 270.7182 ++ 1059.269872 m 0.0001 142 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 Y 1059.269872 0 1.6000 153 | 7/8
12 h-m-p 0.1235 8.0000 0.0000 ---Y 1059.269872 0 0.0005 168
Out..
lnL = -1059.269872
169 lfun, 169 eigenQcodon, 1014 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025673 0.106067 0.083382 0.053156 0.056451 0.054927 0.000100 0.817065 0.280285
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.471444
np = 9
lnL0 = -1158.233906
Iterating by ming2
Initial: fx= 1158.233906
x= 0.02567 0.10607 0.08338 0.05316 0.05645 0.05493 0.00011 0.81706 0.28028
1 h-m-p 0.0000 0.0000 615.2412 ++ 1157.659012 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 659.2971 ++ 1118.301800 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0002 390.7122 ++ 1085.463628 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0001 216.0994 ++ 1082.036371 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 31919.3855 ++ 1079.680272 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 16704.7052 ++ 1063.560673 m 0.0000 74 | 6/9
7 h-m-p 0.0009 0.0045 6.8972 -----------.. | 6/9
8 h-m-p 0.0000 0.0000 379.1230 ++ 1063.216638 m 0.0000 107 | 7/9
9 h-m-p 0.0004 0.1772 4.9749 ----------.. | 7/9
10 h-m-p 0.0000 0.0001 266.8274 ++ 1059.269893 m 0.0001 139 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 +Y 1059.269893 0 6.4000 152 | 7/9
12 h-m-p 0.0160 8.0000 0.0041 +++++ 1059.269891 m 8.0000 168 | 7/9
13 h-m-p 0.1993 5.1788 0.1651 +++ 1059.269873 m 5.1788 183 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 +Y 1059.269873 0 6.4000 198 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 Y 1059.269873 0 1.6000 211
Out..
lnL = -1059.269873
212 lfun, 636 eigenQcodon, 2544 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025914 0.083191 0.066970 0.060631 0.016998 0.022202 0.000100 1.409001 0.154119 0.435165 1.430116
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.243388
np = 11
lnL0 = -1132.007450
Iterating by ming2
Initial: fx= 1132.007450
x= 0.02591 0.08319 0.06697 0.06063 0.01700 0.02220 0.00011 1.40900 0.15412 0.43517 1.43012
1 h-m-p 0.0000 0.0000 628.6291 ++ 1130.880650 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 253.4313 +++ 1103.901590 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 335.1101 ++ 1098.160664 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 163.8324 ++ 1093.080597 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0001 931.0868 ++ 1065.222201 m 0.0001 73 | 5/11
6 h-m-p 0.0000 0.0002 228.9665 ++ 1062.515345 m 0.0002 87 | 6/11
7 h-m-p 0.0000 0.0001 1810.7502 ++ 1060.856539 m 0.0001 101 | 7/11
8 h-m-p 0.0160 8.0000 4.6896 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 270.2956 ++ 1059.269881 m 0.0000 140 | 8/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1059.269881 m 8.0000 157 | 8/11
11 h-m-p 0.0197 8.0000 0.0033 ------C 1059.269881 0 0.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 --N 1059.269881 0 0.0003 199 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1059.269881 m 8.0000 219 | 8/11
14 h-m-p 0.0160 8.0000 0.5149 +++++ 1059.269870 m 8.0000 239 | 8/11
15 h-m-p 1.6000 8.0000 0.3558 ++ 1059.269869 m 8.0000 256 | 8/11
16 h-m-p 0.9929 8.0000 2.8669 ++ 1059.269866 m 8.0000 273 | 8/11
17 h-m-p 1.6000 8.0000 3.2609 ++ 1059.269865 m 8.0000 287 | 8/11
18 h-m-p 0.1443 0.7216 79.8350 --------C 1059.269865 0 0.0000 309 | 8/11
19 h-m-p 1.6000 8.0000 0.0000 N 1059.269865 0 1.6000 323 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 ----C 1059.269865 0 0.0000 344
Out..
lnL = -1059.269865
345 lfun, 1380 eigenQcodon, 6210 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1059.264778 S = -1059.263514 -0.000482
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:03
did 20 / 53 patterns 0:03
did 30 / 53 patterns 0:03
did 40 / 53 patterns 0:03
did 50 / 53 patterns 0:03
did 53 / 53 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067327 0.038717 0.074165 0.095909 0.090164 0.085370 0.000100 0.298719 1.400057
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 22.026181
np = 9
lnL0 = -1173.149136
Iterating by ming2
Initial: fx= 1173.149136
x= 0.06733 0.03872 0.07416 0.09591 0.09016 0.08537 0.00011 0.29872 1.40006
1 h-m-p 0.0000 0.0000 574.4626 ++ 1172.912187 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0171 40.4516 +++++ 1163.170336 m 0.0171 29 | 2/9
3 h-m-p 0.0000 0.0001 3404.5046 ++ 1158.210278 m 0.0001 41 | 3/9
4 h-m-p 0.0001 0.0021 3088.5671 +
QuantileBeta(0.15, 0.00500, 4.05303) = 5.777419e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+ 1101.496579 m 0.0021 54
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 4/9
5 h-m-p 0.0010 0.0051 555.3494
QuantileBeta(0.15, 0.00500, 7.45444) = 2.959783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.03095) = 3.151270e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.92508) = 3.203072e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.89861) = 3.216290e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.89200) = 3.219611e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.89034) = 3.220443e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88993) = 3.220651e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88983) = 3.220703e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220716e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220719e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 4/9
6 h-m-p 0.0000 0.0001 521.0104
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+ 1086.731269 m 0.0001 87
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 5/9
7 h-m-p 0.0160 8.0000 1.6828
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 5/9
8 h-m-p 0.0000 0.0001 454.2582
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+ 1068.180959 m 0.0001 122
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 6/9
9 h-m-p 0.0269 8.0000 1.2149
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 6/9
10 h-m-p 0.0000 0.0000 379.1687
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+ 1062.642726 m 0.0000 158
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 7/9
11 h-m-p 0.0160 8.0000 0.8152
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.89001) = 3.220608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88957) = 3.220832e-161 2000 rounds
| 7/9
12 h-m-p 0.0000 0.0000 269.4440
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
+ 1059.269906 m 0.0000 195
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88980) = 3.220718e-161 2000 rounds
| 8/9
13 h-m-p 0.9284 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
Y 1059.269906 0 0.9284 207
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.333154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.89001) = 3.220608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88957) = 3.220832e-161 2000 rounds
| 7/9
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.88979) = 3.222646e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.221201e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.220961e-161 2000 rounds
N 1059.269906 0 0.0040 220
QuantileBeta(0.15, 0.00500, 6.88979) = 3.221201e-161 2000 rounds
Out..
lnL = -1059.269906
221 lfun, 2431 eigenQcodon, 13260 P(t)
QuantileBeta(0.15, 0.00500, 6.88979) = 3.221201e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88979) = 3.221201e-161 2000 rounds
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063448 0.010001 0.011327 0.075997 0.045203 0.018454 0.000100 0.900000 0.592338 1.408680 1.225309
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.998924
np = 11
lnL0 = -1117.482358
Iterating by ming2
Initial: fx= 1117.482358
x= 0.06345 0.01000 0.01133 0.07600 0.04520 0.01845 0.00011 0.90000 0.59234 1.40868 1.22531
1 h-m-p 0.0000 0.0000 609.9935 ++ 1116.551246 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 121.4376 ++++ 1100.526937 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0000 383.2512 ++ 1098.689459 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0008 144.2280 +++ 1092.387236 m 0.0008 61 | 4/11
5 h-m-p 0.0000 0.0002 592.4849 ++ 1075.008220 m 0.0002 75 | 5/11
6 h-m-p 0.0001 0.0007 491.3509 ++ 1064.079471 m 0.0007 89 | 6/11
7 h-m-p 0.0000 0.0000 131638.9216 ++ 1062.712948 m 0.0000 103 | 7/11
8 h-m-p 0.0056 0.0600 10.9312 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 267.2262 ++ 1059.269878 m 0.0000 141 | 8/11
10 h-m-p 0.2438 8.0000 0.0000 +++ 1059.269878 m 8.0000 156 | 8/11
11 h-m-p 0.0333 8.0000 0.0028 ++++ 1059.269877 m 8.0000 175 | 8/11
12 h-m-p 0.0232 3.1160 0.9601 ++++ 1059.269866 m 3.1160 194 | 9/11
13 h-m-p 1.6000 8.0000 0.2927 ++ 1059.269866 m 8.0000 211 | 9/11
14 h-m-p 1.2129 8.0000 1.9303 ++ 1059.269864 m 8.0000 227 | 9/11
15 h-m-p 1.6000 8.0000 2.4479 ------------C 1059.269864 0 0.0000 253 | 9/11
16 h-m-p 0.0160 8.0000 23.3652 +++++ 1059.269864 m 8.0000 270 | 9/11
17 h-m-p 1.6000 8.0000 37.3843 ++ 1059.269864 m 8.0000 284 | 9/11
18 h-m-p 0.4666 2.3332 210.2868 ++ 1059.269864 m 2.3332 298 | 9/11
19 h-m-p 1.6000 8.0000 0.0000 N 1059.269864 0 1.6000 312 | 10/11
20 h-m-p 0.0160 8.0000 0.0000 N 1059.269864 0 0.0160 328
Out..
lnL = -1059.269864
329 lfun, 3948 eigenQcodon, 21714 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1059.263364 S = -1059.263343 -0.000009
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:13
did 20 / 53 patterns 0:13
did 30 / 53 patterns 0:13
did 40 / 53 patterns 0:13
did 50 / 53 patterns 0:13
did 53 / 53 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=276
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
NC_002677_1_NP_302100_1_972_tsf MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG
**************************************************
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
NC_002677_1_NP_302100_1_972_tsf KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK
**************************************************
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
NC_002677_1_NP_302100_1_972_tsf IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK
**************************************************
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
NC_002677_1_NP_302100_1_972_tsf RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE
**************************************************
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
NC_002677_1_NP_302100_1_972_tsf DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN
**************************************************
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 KKTVKVLLDEAGVTVTRFVRFEVGQA
NC_002677_1_NP_302100_1_972_tsf KKTVKVLLDEAGVTVTRFVRFEVGQA
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 KKTVKVLLDEAGVTVTRFVRFEVGQA
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 KKTVKVLLDEAGVTVTRFVRFEVGQA
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 KKTVKVLLDEAGVTVTRFVRFEVGQA
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 KKTVKVLLDEAGVTVTRFVRFEVGQA
**************************
>NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG ATTCGTTCGGTTCGAGGTGGGCCAAGCC >NC_002677_1_NP_302100_1_972_tsf ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG ATTCGTTCGGTTCGAGGTGGGCCAAGCC >NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG ATTCGTTCGGTTCGAGGTGGGCCAAGCC >NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG ATTCGTTCGGTTCGAGGTGGGCCAAGCC >NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG ATTCGTTCGGTTCGAGGTGGGCCAAGCC >NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 ATGGCGAATTTTACTGTCGCTGATGTCAAGCGGCTTCGCGCGCTAACTGG TGCCGGCATGCTCGACTGCAAGAGTGTGCTGGTCGAAACCGACGGAAACT TCGACAAGGCTGTCGAGTCTCTCCGGATCAAGGGTGCCAAGGACGTTGGC AAGCGTGCCGAACGGGCCACTGCCGAGGGCCTGGTTGCGGCTAAAGATGG TGCGCTTATCGAGTTGAACTGCGAAACGGACTTCGTTGCTAAAAACGCCG AGTTCCAAAAGCTGGCCAACCAAATCGTTGGGGTGGTGGCGGCAGCCAAA ATCGTTGACGTCGACGCACTCAAGGGGGCTAGTGTCGGTGATAAGACGGT CGAGCAAGCGATCGCCGAGCTGGCGGCCAAGATTGGCGAGAAACTGAAAC TGCGCCGCGCCGCGATCTTCAACGGCACCGTGGCAACCTACCTACACAAG CGCGCGGCTGACTTGCCGCCAGCGGTGGGCGTGCTAGTTGAGTATGGTGC CGGCACCGACGCGGCTAACAGCACAGCGGCGGCACATGCGGCCGCGCTGC AGATCGCCGCGCTCAAGGCGCGTTTCCTGTCCCGCGACGATGTTCCCGAA GACGTCTTGGCTAGTGAACGTCGCATAGCCGAAGAGACCGCTAAAGCTGC GGGCAAGCCGGAGCAGTCGCTGCCCAAGATCGTCGAAGGCCGGCTAAATG GTTTCTTCAAGGATTCCGTGCTGCTCGAACAGCCGTCGGTTTTCGACAAC AAGAAGACCGTCAAGGTCCTGCTTGACGAGGCCGGCGTGACGGTGACGCG ATTCGTTCGGTTCGAGGTGGGCCAAGCC
>NC_011896_1_WP_010908421_1_1691_MLBR_RS08005 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN KKTVKVLLDEAGVTVTRFVRFEVGQA >NC_002677_1_NP_302100_1_972_tsf MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN KKTVKVLLDEAGVTVTRFVRFEVGQA >NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN KKTVKVLLDEAGVTVTRFVRFEVGQA >NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN KKTVKVLLDEAGVTVTRFVRFEVGQA >NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN KKTVKVLLDEAGVTVTRFVRFEVGQA >NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970 MANFTVADVKRLRALTGAGMLDCKSVLVETDGNFDKAVESLRIKGAKDVG KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQKLANQIVGVVAAAK IVDVDALKGASVGDKTVEQAIAELAAKIGEKLKLRRAAIFNGTVATYLHK RAADLPPAVGVLVEYGAGTDAANSTAAAHAAALQIAALKARFLSRDDVPE DVLASERRIAEETAKAAGKPEQSLPKIVEGRLNGFFKDSVLLEQPSVFDN KKTVKVLLDEAGVTVTRFVRFEVGQA
#NEXUS
[ID: 0240173799]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908421_1_1691_MLBR_RS08005
NC_002677_1_NP_302100_1_972_tsf
NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730
NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325
NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760
NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908421_1_1691_MLBR_RS08005,
2 NC_002677_1_NP_302100_1_972_tsf,
3 NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730,
4 NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325,
5 NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760,
6 NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06692673,2:0.0690073,3:0.07124512,4:0.06949551,5:0.06874782,6:0.06913801);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06692673,2:0.0690073,3:0.07124512,4:0.06949551,5:0.06874782,6:0.06913801);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1128.57 -1134.40
2 -1128.55 -1133.28
--------------------------------------
TOTAL -1128.56 -1133.99
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tsf/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899583 0.092207 0.383720 1.518548 0.855725 1449.94 1475.47 1.000
r(A<->C){all} 0.169499 0.021337 0.000001 0.462392 0.131912 230.62 259.79 1.001
r(A<->G){all} 0.149009 0.015366 0.000145 0.398898 0.119741 217.41 223.07 1.000
r(A<->T){all} 0.172846 0.021093 0.000075 0.460197 0.130092 115.28 187.49 1.003
r(C<->G){all} 0.175175 0.020564 0.000292 0.469295 0.138065 169.04 192.09 1.000
r(C<->T){all} 0.167918 0.020434 0.000089 0.466817 0.131144 229.30 251.70 1.001
r(G<->T){all} 0.165553 0.018606 0.000119 0.437529 0.128847 187.79 201.84 1.001
pi(A){all} 0.212833 0.000199 0.186594 0.240972 0.212438 1180.40 1261.01 1.000
pi(C){all} 0.277609 0.000238 0.246426 0.306544 0.277292 1245.79 1353.39 1.000
pi(G){all} 0.327000 0.000272 0.296205 0.360679 0.326681 1249.31 1289.82 1.000
pi(T){all} 0.182558 0.000177 0.156646 0.208003 0.181937 1302.86 1334.20 1.000
alpha{1,2} 0.435200 0.243246 0.000102 1.395722 0.257004 1300.60 1304.70 1.000
alpha{3} 0.459596 0.241624 0.000465 1.434397 0.293093 1334.32 1344.79 1.000
pinvar{all} 0.998114 0.000005 0.994027 0.999999 0.998825 968.95 1221.10 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/tsf/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 276
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 10 10 10 10 10 10 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 5 5 5 5 5 5 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 6 6 6 6 6 6
CTA 4 4 4 4 4 4 | CCA 1 1 1 1 1 1 | Gln CAA 4 4 4 4 4 4 | CGA 1 1 1 1 1 1
CTG 11 11 11 11 11 11 | CCG 3 3 3 3 3 3 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 3 3 3 3 3 3 | Asn AAT 2 2 2 2 2 2 | Ser AGT 3 3 3 3 3 3
ATC 8 8 8 8 8 8 | ACC 6 6 6 6 6 6 | AAC 7 7 7 7 7 7 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 4 4 4 4 4 4 | AAG 18 18 18 18 18 18 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 9 9 9 9 9 9 | Ala GCT 10 10 10 10 10 10 | Asp GAT 5 5 5 5 5 5 | Gly GGT 6 6 6 6 6 6
GTC 11 11 11 11 11 11 | GCC 17 17 17 17 17 17 | GAC 13 13 13 13 13 13 | GGC 11 11 11 11 11 11
GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 8 8 8 8 8 8 | GGA 1 1 1 1 1 1
GTG 10 10 10 10 10 10 | GCG 18 18 18 18 18 18 | GAG 12 12 12 12 12 12 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908421_1_1691_MLBR_RS08005
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
#2: NC_002677_1_NP_302100_1_972_tsf
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
#3: NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
#4: NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
#5: NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
#6: NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 60 | TCC 12 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 30 | CCC 12 | CAC 6 | CGC 36
CTA 24 | CCA 6 | Gln Q CAA 24 | CGA 6
CTG 66 | CCG 18 | CAG 18 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 18 | Asn N AAT 12 | Ser S AGT 18
ATC 48 | ACC 36 | AAC 42 | AGC 6
ATA 6 | ACA 6 | Lys K AAA 36 | Arg R AGA 0
Met M ATG 12 | ACG 24 | AAG 108 | AGG 0
------------------------------------------------------------------------------
Val V GTT 54 | Ala A GCT 60 | Asp D GAT 30 | Gly G GGT 36
GTC 66 | GCC 102 | GAC 78 | GGC 66
GTA 0 | GCA 24 | Glu E GAA 48 | GGA 6
GTG 60 | GCG 108 | GAG 72 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08333 C:0.19203 A:0.22826 G:0.49638
position 2: T:0.28623 C:0.26812 A:0.29710 G:0.14855
position 3: T:0.17754 C:0.37319 A:0.11232 G:0.33696
Average T:0.18237 C:0.27778 A:0.21256 G:0.32729
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1059.269872 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.225309
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908421_1_1691_MLBR_RS08005: 0.000004, NC_002677_1_NP_302100_1_972_tsf: 0.000004, NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730: 0.000004, NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325: 0.000004, NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760: 0.000004, NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.22531
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 644.6 183.4 1.2253 0.0000 0.0000 0.0 0.0
7..2 0.000 644.6 183.4 1.2253 0.0000 0.0000 0.0 0.0
7..3 0.000 644.6 183.4 1.2253 0.0000 0.0000 0.0 0.0
7..4 0.000 644.6 183.4 1.2253 0.0000 0.0000 0.0 0.0
7..5 0.000 644.6 183.4 1.2253 0.0000 0.0000 0.0 0.0
7..6 0.000 644.6 183.4 1.2253 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1059.269873 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.124741
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908421_1_1691_MLBR_RS08005: 0.000004, NC_002677_1_NP_302100_1_972_tsf: 0.000004, NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730: 0.000004, NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325: 0.000004, NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760: 0.000004, NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.12474 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 644.6 183.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 644.6 183.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 644.6 183.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 644.6 183.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 644.6 183.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 644.6 183.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1059.269865 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.335043 0.000001 18.083278
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908421_1_1691_MLBR_RS08005: 0.000004, NC_002677_1_NP_302100_1_972_tsf: 0.000004, NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730: 0.000004, NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325: 0.000004, NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760: 0.000004, NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.33504 0.66496
w: 0.00000 1.00000 18.08328
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 644.6 183.4 12.3597 0.0000 0.0000 0.0 0.0
7..2 0.000 644.6 183.4 12.3597 0.0000 0.0000 0.0 0.0
7..3 0.000 644.6 183.4 12.3597 0.0000 0.0000 0.0 0.0
7..4 0.000 644.6 183.4 12.3597 0.0000 0.0000 0.0 0.0
7..5 0.000 644.6 183.4 12.3597 0.0000 0.0000 0.0 0.0
7..6 0.000 644.6 183.4 12.3597 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908421_1_1691_MLBR_RS08005)
Pr(w>1) post mean +- SE for w
1 M 0.665 12.360
2 A 0.665 12.360
3 N 0.665 12.360
4 F 0.665 12.360
5 T 0.665 12.360
6 V 0.665 12.360
7 A 0.665 12.360
8 D 0.665 12.359
9 V 0.665 12.360
10 K 0.665 12.360
11 R 0.665 12.360
12 L 0.665 12.360
13 R 0.665 12.360
14 A 0.665 12.360
15 L 0.665 12.360
16 T 0.665 12.360
17 G 0.665 12.360
18 A 0.665 12.360
19 G 0.665 12.360
20 M 0.665 12.360
21 L 0.665 12.360
22 D 0.665 12.359
23 C 0.665 12.360
24 K 0.665 12.360
25 S 0.665 12.360
26 V 0.665 12.360
27 L 0.665 12.360
28 V 0.665 12.360
29 E 0.665 12.360
30 T 0.665 12.360
31 D 0.665 12.359
32 G 0.665 12.360
33 N 0.665 12.360
34 F 0.665 12.360
35 D 0.665 12.359
36 K 0.665 12.360
37 A 0.665 12.360
38 V 0.665 12.360
39 E 0.665 12.359
40 S 0.665 12.360
41 L 0.665 12.360
42 R 0.665 12.360
43 I 0.665 12.360
44 K 0.665 12.360
45 G 0.665 12.360
46 A 0.665 12.360
47 K 0.665 12.360
48 D 0.665 12.359
49 V 0.665 12.360
50 G 0.665 12.360
51 K 0.665 12.360
52 R 0.665 12.360
53 A 0.665 12.360
54 E 0.665 12.360
55 R 0.665 12.360
56 A 0.665 12.360
57 T 0.665 12.360
58 A 0.665 12.360
59 E 0.665 12.359
60 G 0.665 12.360
61 L 0.665 12.360
62 V 0.665 12.360
63 A 0.665 12.360
64 A 0.665 12.360
65 K 0.665 12.360
66 D 0.665 12.359
67 G 0.665 12.360
68 A 0.665 12.360
69 L 0.665 12.360
70 I 0.665 12.360
71 E 0.665 12.359
72 L 0.665 12.360
73 N 0.665 12.360
74 C 0.665 12.360
75 E 0.665 12.360
76 T 0.665 12.360
77 D 0.665 12.359
78 F 0.665 12.360
79 V 0.665 12.360
80 A 0.665 12.360
81 K 0.665 12.360
82 N 0.665 12.360
83 A 0.665 12.360
84 E 0.665 12.359
85 F 0.665 12.360
86 Q 0.665 12.360
87 K 0.665 12.360
88 L 0.665 12.360
89 A 0.665 12.360
90 N 0.665 12.360
91 Q 0.665 12.360
92 I 0.665 12.360
93 V 0.665 12.360
94 G 0.665 12.360
95 V 0.665 12.360
96 V 0.665 12.360
97 A 0.665 12.360
98 A 0.665 12.360
99 A 0.665 12.360
100 K 0.665 12.360
101 I 0.665 12.360
102 V 0.665 12.360
103 D 0.665 12.359
104 V 0.665 12.360
105 D 0.665 12.359
106 A 0.665 12.360
107 L 0.665 12.360
108 K 0.665 12.360
109 G 0.665 12.360
110 A 0.665 12.360
111 S 0.665 12.360
112 V 0.665 12.360
113 G 0.665 12.360
114 D 0.665 12.359
115 K 0.665 12.360
116 T 0.665 12.360
117 V 0.665 12.360
118 E 0.665 12.359
119 Q 0.665 12.360
120 A 0.665 12.360
121 I 0.665 12.360
122 A 0.665 12.360
123 E 0.665 12.359
124 L 0.665 12.360
125 A 0.665 12.360
126 A 0.665 12.360
127 K 0.665 12.360
128 I 0.665 12.360
129 G 0.665 12.360
130 E 0.665 12.359
131 K 0.665 12.360
132 L 0.665 12.360
133 K 0.665 12.360
134 L 0.665 12.360
135 R 0.665 12.360
136 R 0.665 12.360
137 A 0.665 12.360
138 A 0.665 12.360
139 I 0.665 12.360
140 F 0.665 12.360
141 N 0.665 12.360
142 G 0.665 12.360
143 T 0.665 12.360
144 V 0.665 12.360
145 A 0.665 12.360
146 T 0.665 12.360
147 Y 0.665 12.360
148 L 0.665 12.360
149 H 0.665 12.359
150 K 0.665 12.360
151 R 0.665 12.360
152 A 0.665 12.360
153 A 0.665 12.360
154 D 0.665 12.359
155 L 0.665 12.360
156 P 0.665 12.360
157 P 0.665 12.360
158 A 0.665 12.360
159 V 0.665 12.360
160 G 0.665 12.360
161 V 0.665 12.360
162 L 0.665 12.360
163 V 0.665 12.360
164 E 0.665 12.359
165 Y 0.665 12.360
166 G 0.665 12.360
167 A 0.665 12.360
168 G 0.665 12.360
169 T 0.665 12.360
170 D 0.665 12.359
171 A 0.665 12.360
172 A 0.665 12.360
173 N 0.665 12.360
174 S 0.665 12.360
175 T 0.665 12.360
176 A 0.665 12.360
177 A 0.665 12.360
178 A 0.665 12.360
179 H 0.665 12.360
180 A 0.665 12.360
181 A 0.665 12.360
182 A 0.665 12.360
183 L 0.665 12.360
184 Q 0.665 12.359
185 I 0.665 12.360
186 A 0.665 12.360
187 A 0.665 12.360
188 L 0.665 12.360
189 K 0.665 12.360
190 A 0.665 12.360
191 R 0.665 12.360
192 F 0.665 12.360
193 L 0.665 12.360
194 S 0.665 12.360
195 R 0.665 12.360
196 D 0.665 12.359
197 D 0.665 12.359
198 V 0.665 12.360
199 P 0.665 12.360
200 E 0.665 12.360
201 D 0.665 12.359
202 V 0.665 12.360
203 L 0.665 12.360
204 A 0.665 12.360
205 S 0.665 12.360
206 E 0.665 12.360
207 R 0.665 12.360
208 R 0.665 12.360
209 I 0.665 12.360
210 A 0.665 12.360
211 E 0.665 12.360
212 E 0.665 12.359
213 T 0.665 12.360
214 A 0.665 12.360
215 K 0.665 12.360
216 A 0.665 12.360
217 A 0.665 12.360
218 G 0.665 12.360
219 K 0.665 12.360
220 P 0.665 12.360
221 E 0.665 12.359
222 Q 0.665 12.359
223 S 0.665 12.360
224 L 0.665 12.360
225 P 0.665 12.360
226 K 0.665 12.360
227 I 0.665 12.360
228 V 0.665 12.360
229 E 0.665 12.360
230 G 0.665 12.360
231 R 0.665 12.360
232 L 0.665 12.360
233 N 0.665 12.360
234 G 0.665 12.360
235 F 0.665 12.360
236 F 0.665 12.360
237 K 0.665 12.360
238 D 0.665 12.359
239 S 0.665 12.360
240 V 0.665 12.360
241 L 0.665 12.360
242 L 0.665 12.360
243 E 0.665 12.360
244 Q 0.665 12.359
245 P 0.665 12.360
246 S 0.665 12.360
247 V 0.665 12.360
248 F 0.665 12.360
249 D 0.665 12.359
250 N 0.665 12.360
251 K 0.665 12.360
252 K 0.665 12.360
253 T 0.665 12.360
254 V 0.665 12.360
255 K 0.665 12.360
256 V 0.665 12.360
257 L 0.665 12.360
258 L 0.665 12.360
259 D 0.665 12.359
260 E 0.665 12.359
261 A 0.665 12.360
262 G 0.665 12.360
263 V 0.665 12.360
264 T 0.665 12.360
265 V 0.665 12.360
266 T 0.665 12.360
267 R 0.665 12.360
268 F 0.665 12.360
269 V 0.665 12.360
270 R 0.665 12.360
271 F 0.665 12.360
272 E 0.665 12.359
273 V 0.665 12.360
274 G 0.665 12.360
275 Q 0.665 12.360
276 A 0.665 12.360
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908421_1_1691_MLBR_RS08005)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1059.269906 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 6.889792
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908421_1_1691_MLBR_RS08005: 0.000004, NC_002677_1_NP_302100_1_972_tsf: 0.000004, NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730: 0.000004, NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325: 0.000004, NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760: 0.000004, NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 6.88979
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 644.6 183.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 644.6 183.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 644.6 183.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 644.6 183.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 644.6 183.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 644.6 183.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1059.269864 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.529297 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908421_1_1691_MLBR_RS08005: 0.000004, NC_002677_1_NP_302100_1_972_tsf: 0.000004, NZ_LVXE01000006_1_WP_010908421_1_2315_A3216_RS03730: 0.000004, NZ_LYPH01000002_1_WP_010908421_1_284_A8144_RS01325: 0.000004, NZ_CP029543_1_WP_010908421_1_1722_DIJ64_RS08760: 0.000004, NZ_AP014567_1_WP_010908421_1_1764_JK2ML_RS08970: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.52930
(p1 = 0.99999) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 644.6 183.4 998.9900 0.0000 0.0000 0.0 0.0
7..2 0.000 644.6 183.4 998.9900 0.0000 0.0000 0.0 0.0
7..3 0.000 644.6 183.4 998.9900 0.0000 0.0000 0.0 0.0
7..4 0.000 644.6 183.4 998.9900 0.0000 0.0000 0.0 0.0
7..5 0.000 644.6 183.4 998.9900 0.0000 0.0000 0.0 0.0
7..6 0.000 644.6 183.4 998.9900 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908421_1_1691_MLBR_RS08005)
Pr(w>1) post mean +- SE for w
1 M 1.000** 998.990
2 A 1.000** 998.990
3 N 1.000** 998.990
4 F 1.000** 998.990
5 T 1.000** 998.990
6 V 1.000** 998.990
7 A 1.000** 998.990
8 D 1.000** 998.990
9 V 1.000** 998.990
10 K 1.000** 998.990
11 R 1.000** 998.990
12 L 1.000** 998.990
13 R 1.000** 998.990
14 A 1.000** 998.990
15 L 1.000** 998.990
16 T 1.000** 998.990
17 G 1.000** 998.990
18 A 1.000** 998.990
19 G 1.000** 998.990
20 M 1.000** 998.990
21 L 1.000** 998.990
22 D 1.000** 998.990
23 C 1.000** 998.990
24 K 1.000** 998.990
25 S 1.000** 998.990
26 V 1.000** 998.990
27 L 1.000** 998.990
28 V 1.000** 998.990
29 E 1.000** 998.990
30 T 1.000** 998.990
31 D 1.000** 998.990
32 G 1.000** 998.990
33 N 1.000** 998.990
34 F 1.000** 998.990
35 D 1.000** 998.990
36 K 1.000** 998.990
37 A 1.000** 998.990
38 V 1.000** 998.990
39 E 1.000** 998.990
40 S 1.000** 998.990
41 L 1.000** 998.990
42 R 1.000** 998.990
43 I 1.000** 998.990
44 K 1.000** 998.990
45 G 1.000** 998.990
46 A 1.000** 998.990
47 K 1.000** 998.990
48 D 1.000** 998.990
49 V 1.000** 998.990
50 G 1.000** 998.990
51 K 1.000** 998.990
52 R 1.000** 998.990
53 A 1.000** 998.990
54 E 1.000** 998.990
55 R 1.000** 998.990
56 A 1.000** 998.990
57 T 1.000** 998.990
58 A 1.000** 998.990
59 E 1.000** 998.990
60 G 1.000** 998.990
61 L 1.000** 998.990
62 V 1.000** 998.990
63 A 1.000** 998.990
64 A 1.000** 998.990
65 K 1.000** 998.990
66 D 1.000** 998.990
67 G 1.000** 998.990
68 A 1.000** 998.990
69 L 1.000** 998.990
70 I 1.000** 998.990
71 E 1.000** 998.990
72 L 1.000** 998.990
73 N 1.000** 998.990
74 C 1.000** 998.990
75 E 1.000** 998.990
76 T 1.000** 998.990
77 D 1.000** 998.990
78 F 1.000** 998.990
79 V 1.000** 998.990
80 A 1.000** 998.990
81 K 1.000** 998.990
82 N 1.000** 998.990
83 A 1.000** 998.990
84 E 1.000** 998.990
85 F 1.000** 998.990
86 Q 1.000** 998.990
87 K 1.000** 998.990
88 L 1.000** 998.990
89 A 1.000** 998.990
90 N 1.000** 998.990
91 Q 1.000** 998.990
92 I 1.000** 998.990
93 V 1.000** 998.990
94 G 1.000** 998.990
95 V 1.000** 998.990
96 V 1.000** 998.990
97 A 1.000** 998.990
98 A 1.000** 998.990
99 A 1.000** 998.990
100 K 1.000** 998.990
101 I 1.000** 998.990
102 V 1.000** 998.990
103 D 1.000** 998.990
104 V 1.000** 998.990
105 D 1.000** 998.990
106 A 1.000** 998.990
107 L 1.000** 998.990
108 K 1.000** 998.990
109 G 1.000** 998.990
110 A 1.000** 998.990
111 S 1.000** 998.990
112 V 1.000** 998.990
113 G 1.000** 998.990
114 D 1.000** 998.990
115 K 1.000** 998.990
116 T 1.000** 998.990
117 V 1.000** 998.990
118 E 1.000** 998.990
119 Q 1.000** 998.990
120 A 1.000** 998.990
121 I 1.000** 998.990
122 A 1.000** 998.990
123 E 1.000** 998.990
124 L 1.000** 998.990
125 A 1.000** 998.990
126 A 1.000** 998.990
127 K 1.000** 998.990
128 I 1.000** 998.990
129 G 1.000** 998.990
130 E 1.000** 998.990
131 K 1.000** 998.990
132 L 1.000** 998.990
133 K 1.000** 998.990
134 L 1.000** 998.990
135 R 1.000** 998.990
136 R 1.000** 998.990
137 A 1.000** 998.990
138 A 1.000** 998.990
139 I 1.000** 998.990
140 F 1.000** 998.990
141 N 1.000** 998.990
142 G 1.000** 998.990
143 T 1.000** 998.990
144 V 1.000** 998.990
145 A 1.000** 998.990
146 T 1.000** 998.990
147 Y 1.000** 998.990
148 L 1.000** 998.990
149 H 1.000** 998.990
150 K 1.000** 998.990
151 R 1.000** 998.990
152 A 1.000** 998.990
153 A 1.000** 998.990
154 D 1.000** 998.990
155 L 1.000** 998.990
156 P 1.000** 998.990
157 P 1.000** 998.990
158 A 1.000** 998.990
159 V 1.000** 998.990
160 G 1.000** 998.990
161 V 1.000** 998.990
162 L 1.000** 998.990
163 V 1.000** 998.990
164 E 1.000** 998.990
165 Y 1.000** 998.990
166 G 1.000** 998.990
167 A 1.000** 998.990
168 G 1.000** 998.990
169 T 1.000** 998.990
170 D 1.000** 998.990
171 A 1.000** 998.990
172 A 1.000** 998.990
173 N 1.000** 998.990
174 S 1.000** 998.990
175 T 1.000** 998.990
176 A 1.000** 998.990
177 A 1.000** 998.990
178 A 1.000** 998.990
179 H 1.000** 998.990
180 A 1.000** 998.990
181 A 1.000** 998.990
182 A 1.000** 998.990
183 L 1.000** 998.990
184 Q 1.000** 998.990
185 I 1.000** 998.990
186 A 1.000** 998.990
187 A 1.000** 998.990
188 L 1.000** 998.990
189 K 1.000** 998.990
190 A 1.000** 998.990
191 R 1.000** 998.990
192 F 1.000** 998.990
193 L 1.000** 998.990
194 S 1.000** 998.990
195 R 1.000** 998.990
196 D 1.000** 998.990
197 D 1.000** 998.990
198 V 1.000** 998.990
199 P 1.000** 998.990
200 E 1.000** 998.990
201 D 1.000** 998.990
202 V 1.000** 998.990
203 L 1.000** 998.990
204 A 1.000** 998.990
205 S 1.000** 998.990
206 E 1.000** 998.990
207 R 1.000** 998.990
208 R 1.000** 998.990
209 I 1.000** 998.990
210 A 1.000** 998.990
211 E 1.000** 998.990
212 E 1.000** 998.990
213 T 1.000** 998.990
214 A 1.000** 998.990
215 K 1.000** 998.990
216 A 1.000** 998.990
217 A 1.000** 998.990
218 G 1.000** 998.990
219 K 1.000** 998.990
220 P 1.000** 998.990
221 E 1.000** 998.990
222 Q 1.000** 998.990
223 S 1.000** 998.990
224 L 1.000** 998.990
225 P 1.000** 998.990
226 K 1.000** 998.990
227 I 1.000** 998.990
228 V 1.000** 998.990
229 E 1.000** 998.990
230 G 1.000** 998.990
231 R 1.000** 998.990
232 L 1.000** 998.990
233 N 1.000** 998.990
234 G 1.000** 998.990
235 F 1.000** 998.990
236 F 1.000** 998.990
237 K 1.000** 998.990
238 D 1.000** 998.990
239 S 1.000** 998.990
240 V 1.000** 998.990
241 L 1.000** 998.990
242 L 1.000** 998.990
243 E 1.000** 998.990
244 Q 1.000** 998.990
245 P 1.000** 998.990
246 S 1.000** 998.990
247 V 1.000** 998.990
248 F 1.000** 998.990
249 D 1.000** 998.990
250 N 1.000** 998.990
251 K 1.000** 998.990
252 K 1.000** 998.990
253 T 1.000** 998.990
254 V 1.000** 998.990
255 K 1.000** 998.990
256 V 1.000** 998.990
257 L 1.000** 998.990
258 L 1.000** 998.990
259 D 1.000** 998.990
260 E 1.000** 998.990
261 A 1.000** 998.990
262 G 1.000** 998.990
263 V 1.000** 998.990
264 T 1.000** 998.990
265 V 1.000** 998.990
266 T 1.000** 998.990
267 R 1.000** 998.990
268 F 1.000** 998.990
269 V 1.000** 998.990
270 R 1.000** 998.990
271 F 1.000** 998.990
272 E 1.000** 998.990
273 V 1.000** 998.990
274 G 1.000** 998.990
275 Q 1.000** 998.990
276 A 1.000** 998.990
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908421_1_1691_MLBR_RS08005)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -1059.269873 Model 2: PositiveSelection -1059.269865 Model 0: one-ratio -1059.269872 Model 7: beta -1059.269906 Model 8: beta&w>1 -1059.269864 Model 0 vs 1 1.99999976757681E-6 Model 2 vs 1 1.5999999959603883E-5 Model 8 vs 7 8.399999978792039E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
