--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:47:22 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/ubiE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -936.25 -941.56
2 -936.29 -939.34
--------------------------------------
TOTAL -936.27 -940.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894337 0.093994 0.343823 1.502132 0.856627 1265.47 1383.24 1.000
r(A<->C){all} 0.167668 0.017802 0.000172 0.432698 0.136693 330.68 333.98 1.000
r(A<->G){all} 0.169997 0.019383 0.000070 0.448636 0.138848 208.42 254.67 1.001
r(A<->T){all} 0.166832 0.020117 0.000001 0.465003 0.129799 224.14 224.78 1.000
r(C<->G){all} 0.163194 0.018826 0.000121 0.441638 0.125641 93.55 149.21 1.000
r(C<->T){all} 0.168178 0.019607 0.000029 0.438373 0.132504 125.17 160.62 1.000
r(G<->T){all} 0.164131 0.018985 0.000019 0.445684 0.131380 86.96 163.90 1.001
pi(A){all} 0.180243 0.000212 0.154225 0.211525 0.180145 1218.66 1302.70 1.000
pi(C){all} 0.295315 0.000297 0.260919 0.328154 0.295094 1061.57 1161.00 1.000
pi(G){all} 0.327406 0.000309 0.293183 0.361009 0.327255 1190.46 1209.40 1.000
pi(T){all} 0.197036 0.000226 0.168622 0.227569 0.196895 1312.31 1406.65 1.000
alpha{1,2} 0.436647 0.253948 0.000108 1.435460 0.249488 936.43 1092.44 1.000
alpha{3} 0.466784 0.242837 0.000185 1.439263 0.306308 1199.55 1350.28 1.000
pinvar{all} 0.997874 0.000006 0.993046 0.999999 0.998708 1309.33 1310.54 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -913.633805
Model 2: PositiveSelection -913.633804
Model 0: one-ratio -913.633803
Model 7: beta -913.633812
Model 8: beta&w>1 -913.633806
Model 0 vs 1 4.000000217274646E-6
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 1.1999999969702912E-5
>C1
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C2
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C3
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C4
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C5
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C6
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=230
C1 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C2 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C3 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C4 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C5 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C6 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
**************************************************
C1 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C2 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C3 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C4 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C5 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C6 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
**************************************************
C1 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C2 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C3 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C4 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C5 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C6 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
**************************************************
C1 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C2 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C3 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C4 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C5 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C6 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
**************************************************
C1 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C2 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C3 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C4 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C5 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C6 QLSRTGWASPRWRNLTGGIVALHAADKPVR
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6900]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6900]--->[6900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.779 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C2 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C3 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C4 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C5 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
C6 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
**************************************************
C1 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C2 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C3 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C4 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C5 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
C6 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
**************************************************
C1 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C2 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C3 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C4 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C5 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
C6 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
**************************************************
C1 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C2 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C3 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C4 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C5 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
C6 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
**************************************************
C1 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C2 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C3 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C4 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C5 QLSRTGWASPRWRNLTGGIVALHAADKPVR
C6 QLSRTGWASPRWRNLTGGIVALHAADKPVR
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
C2 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
C3 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
C4 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
C5 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
C6 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
**************************************************
C1 CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
C2 CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
C3 CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
C4 CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
C5 CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
C6 CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
**************************************************
C1 GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
C2 GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
C3 GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
C4 GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
C5 GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
C6 GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
**************************************************
C1 CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
C2 CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
C3 CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
C4 CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
C5 CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
C6 CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
**************************************************
C1 GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
C2 GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
C3 GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
C4 GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
C5 GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
C6 GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
**************************************************
C1 GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
C2 GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
C3 GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
C4 GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
C5 GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
C6 GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
**************************************************
C1 GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
C2 GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
C3 GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
C4 GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
C5 GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
C6 GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
**************************************************
C1 TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
C2 TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
C3 TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
C4 TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
C5 TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
C6 TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
**************************************************
C1 CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
C2 CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
C3 CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
C4 CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
C5 CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
C6 CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
**************************************************
C1 CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
C2 CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
C3 CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
C4 CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
C5 CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
C6 CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
**************************************************
C1 ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
C2 ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
C3 ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
C4 ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
C5 ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
C6 ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
**************************************************
C1 ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
C2 ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
C3 ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
C4 ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
C5 ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
C6 ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
**************************************************
C1 CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
C2 CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
C3 CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
C4 CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
C5 CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
C6 CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
**************************************************
C1 CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
C2 CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
C3 CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
C4 CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
C5 CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
C6 CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
****************************************
>C1
GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>C2
GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>C3
GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>C4
GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>C5
GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>C6
GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT
CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG
GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG
CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC
GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA
GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT
GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG
TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG
CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA
CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC
ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT
ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC
CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG
CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>C1
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C2
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C3
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C4
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C5
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
>C6
VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
QLSRTGWASPRWRNLTGGIVALHAADKPVR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 690 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790757
Setting output file names to "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 744087671
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0991278926
Seed = 546288159
Swapseed = 1579790757
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1544.252843 -- -24.965149
Chain 2 -- -1544.253078 -- -24.965149
Chain 3 -- -1544.252843 -- -24.965149
Chain 4 -- -1544.252843 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1544.253078 -- -24.965149
Chain 2 -- -1544.252989 -- -24.965149
Chain 3 -- -1544.253078 -- -24.965149
Chain 4 -- -1544.252989 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1544.253] (-1544.253) (-1544.253) (-1544.253) * [-1544.253] (-1544.253) (-1544.253) (-1544.253)
500 -- [-946.686] (-942.706) (-956.890) (-957.861) * (-955.374) [-957.886] (-959.429) (-959.624) -- 0:00:00
1000 -- [-948.161] (-943.694) (-943.014) (-957.761) * (-946.079) (-947.746) (-958.352) [-942.457] -- 0:00:00
1500 -- (-944.431) (-943.371) (-946.702) [-954.944] * (-944.191) (-949.439) (-948.634) [-944.500] -- 0:00:00
2000 -- (-949.635) (-944.971) [-942.225] (-954.139) * (-948.295) (-941.895) (-946.126) [-940.324] -- 0:00:00
2500 -- [-945.710] (-946.670) (-955.792) (-958.617) * (-942.434) (-941.510) [-944.431] (-942.178) -- 0:00:00
3000 -- (-947.000) (-946.410) [-944.175] (-948.851) * (-943.300) [-941.188] (-952.680) (-950.184) -- 0:00:00
3500 -- (-951.193) (-949.755) [-942.338] (-945.813) * [-949.191] (-942.165) (-947.392) (-958.241) -- 0:00:00
4000 -- (-943.428) (-944.867) [-941.194] (-941.006) * [-946.214] (-947.460) (-947.325) (-946.963) -- 0:04:09
4500 -- (-952.529) (-943.038) [-942.041] (-947.138) * (-945.091) (-945.485) (-949.252) [-942.717] -- 0:03:41
5000 -- (-942.492) [-939.799] (-948.711) (-949.527) * (-945.474) [-949.683] (-953.062) (-949.791) -- 0:03:19
Average standard deviation of split frequencies: 0.061488
5500 -- (-948.359) (-943.074) (-949.429) [-949.477] * (-950.380) (-948.675) [-941.912] (-943.917) -- 0:03:00
6000 -- (-946.852) (-946.498) (-941.448) [-942.848] * [-942.408] (-950.301) (-951.470) (-945.879) -- 0:02:45
6500 -- (-946.994) (-942.704) [-947.158] (-946.781) * (-944.439) (-950.796) (-945.604) [-943.261] -- 0:02:32
7000 -- [-949.577] (-946.300) (-952.601) (-951.848) * (-948.720) (-951.432) (-951.891) [-943.930] -- 0:02:21
7500 -- [-942.842] (-949.851) (-944.803) (-944.230) * [-943.138] (-943.760) (-947.562) (-949.158) -- 0:02:12
8000 -- (-946.459) (-946.422) [-943.774] (-943.991) * (-938.538) (-951.647) (-946.027) [-941.029] -- 0:02:04
8500 -- (-948.930) (-939.436) [-945.294] (-945.520) * (-947.386) (-940.800) [-944.959] (-943.879) -- 0:01:56
9000 -- (-941.849) [-940.749] (-944.499) (-949.435) * [-942.995] (-945.092) (-949.301) (-941.961) -- 0:01:50
9500 -- (-950.543) (-954.151) (-950.652) [-943.404] * (-945.724) (-949.437) [-946.213] (-941.214) -- 0:01:44
10000 -- [-944.141] (-944.259) (-942.676) (-941.511) * (-945.598) (-946.720) (-949.872) [-940.670] -- 0:01:39
Average standard deviation of split frequencies: 0.046520
10500 -- (-944.774) (-945.569) [-942.659] (-941.953) * [-944.089] (-945.604) (-951.870) (-941.402) -- 0:01:34
11000 -- (-954.734) (-947.163) (-943.711) [-940.264] * (-943.405) [-946.302] (-951.922) (-946.646) -- 0:01:29
11500 -- (-943.997) (-942.543) [-943.012] (-947.618) * (-944.299) (-946.567) (-942.891) [-942.128] -- 0:01:25
12000 -- [-941.781] (-943.179) (-946.513) (-945.809) * (-946.775) [-944.810] (-945.557) (-958.611) -- 0:01:22
12500 -- (-946.192) (-950.650) (-944.713) [-953.697] * [-951.135] (-947.727) (-941.275) (-942.002) -- 0:01:19
13000 -- (-947.135) (-952.758) (-950.500) [-945.308] * (-957.008) [-944.586] (-942.292) (-949.176) -- 0:01:15
13500 -- (-948.347) [-949.690] (-948.844) (-944.405) * (-945.550) [-939.364] (-945.232) (-951.675) -- 0:01:13
14000 -- (-946.318) (-953.652) [-943.604] (-944.641) * (-945.319) (-950.026) (-944.750) [-944.272] -- 0:01:10
14500 -- (-957.664) (-947.659) (-945.063) [-949.238] * (-945.799) (-942.758) (-946.631) [-946.342] -- 0:01:07
15000 -- [-945.583] (-948.667) (-947.714) (-946.372) * (-948.260) [-944.489] (-944.309) (-944.334) -- 0:01:05
Average standard deviation of split frequencies: 0.052723
15500 -- (-941.769) [-941.746] (-946.838) (-948.641) * (-944.900) (-946.769) [-952.809] (-949.232) -- 0:01:03
16000 -- [-939.043] (-937.999) (-947.686) (-942.208) * (-946.837) (-948.068) (-947.893) [-944.742] -- 0:01:01
16500 -- [-947.911] (-940.182) (-945.774) (-945.645) * (-949.398) (-944.485) (-946.450) [-941.863] -- 0:00:59
17000 -- (-947.281) (-941.230) [-946.543] (-940.595) * (-941.952) (-945.861) [-948.045] (-950.585) -- 0:00:57
17500 -- (-942.823) (-939.742) [-947.624] (-947.972) * (-949.252) (-946.605) [-943.907] (-954.231) -- 0:00:56
18000 -- (-942.978) (-939.041) [-943.289] (-952.421) * (-942.706) (-950.124) (-949.457) [-944.964] -- 0:01:49
18500 -- (-943.569) [-939.798] (-943.437) (-952.887) * (-959.420) (-948.856) [-942.757] (-947.434) -- 0:01:46
19000 -- [-943.750] (-939.805) (-952.982) (-942.786) * [-942.224] (-948.030) (-952.002) (-949.886) -- 0:01:43
19500 -- [-944.927] (-940.734) (-946.205) (-943.301) * (-945.973) (-953.200) [-940.328] (-944.747) -- 0:01:40
20000 -- (-959.267) (-939.614) [-951.348] (-946.544) * (-949.017) (-946.769) [-948.589] (-942.388) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- (-944.964) [-939.801] (-946.364) (-948.869) * (-949.067) (-942.820) [-944.084] (-952.520) -- 0:01:35
21000 -- (-944.975) [-937.121] (-946.324) (-947.368) * [-949.937] (-950.866) (-951.650) (-942.281) -- 0:01:33
21500 -- (-942.995) (-941.774) (-943.512) [-940.637] * (-946.900) [-942.800] (-941.804) (-948.503) -- 0:01:31
22000 -- (-948.019) (-935.293) [-944.168] (-944.717) * (-947.554) (-947.109) (-947.098) [-947.832] -- 0:01:28
22500 -- [-954.296] (-936.457) (-949.115) (-955.362) * (-943.641) [-945.345] (-943.976) (-956.293) -- 0:01:26
23000 -- (-945.814) (-936.928) (-944.322) [-939.861] * (-943.787) [-942.191] (-944.875) (-947.498) -- 0:01:24
23500 -- (-949.568) (-935.213) (-942.256) [-937.143] * (-940.877) (-952.366) [-946.283] (-949.019) -- 0:01:23
24000 -- (-941.846) [-935.548] (-943.985) (-936.964) * [-940.727] (-947.538) (-948.513) (-948.174) -- 0:01:21
24500 -- (-948.088) [-935.037] (-951.430) (-938.508) * (-948.054) (-945.066) [-942.234] (-956.256) -- 0:01:19
25000 -- (-941.625) [-936.415] (-946.070) (-941.048) * (-946.334) (-945.803) (-943.965) [-947.087] -- 0:01:18
Average standard deviation of split frequencies: 0.039888
25500 -- [-948.128] (-938.291) (-956.688) (-939.325) * (-950.783) [-948.640] (-954.493) (-948.506) -- 0:01:16
26000 -- [-935.692] (-939.885) (-944.757) (-935.424) * [-943.725] (-950.167) (-949.296) (-944.805) -- 0:01:14
26500 -- (-937.000) [-935.536] (-942.678) (-936.373) * (-945.729) [-950.979] (-956.545) (-948.400) -- 0:01:13
27000 -- (-936.123) [-937.551] (-947.099) (-935.780) * (-955.753) (-940.613) (-944.209) [-942.823] -- 0:01:12
27500 -- [-935.478] (-941.072) (-948.814) (-935.131) * (-944.921) [-944.210] (-948.315) (-953.630) -- 0:01:10
28000 -- [-935.681] (-937.240) (-940.008) (-938.380) * (-946.540) (-947.546) (-950.610) [-946.142] -- 0:01:09
28500 -- [-936.221] (-937.818) (-946.994) (-938.658) * (-951.306) (-946.199) [-943.204] (-948.233) -- 0:01:08
29000 -- (-936.754) (-939.661) [-943.094] (-938.900) * (-950.223) [-944.210] (-942.586) (-943.872) -- 0:01:06
29500 -- (-936.795) (-939.031) [-943.604] (-937.716) * (-946.346) (-946.132) [-957.335] (-945.642) -- 0:01:05
30000 -- [-938.500] (-939.023) (-946.772) (-936.759) * (-948.968) (-953.110) [-943.523] (-947.249) -- 0:01:04
Average standard deviation of split frequencies: 0.046925
30500 -- (-938.576) (-938.064) [-944.340] (-940.461) * (-949.572) (-948.032) (-949.729) [-943.257] -- 0:01:35
31000 -- [-938.817] (-941.375) (-942.215) (-938.901) * (-951.871) (-944.861) [-940.698] (-952.105) -- 0:01:33
31500 -- (-937.662) [-935.188] (-946.959) (-941.627) * (-944.587) [-941.574] (-951.005) (-947.807) -- 0:01:32
32000 -- (-936.819) (-935.147) [-943.865] (-941.506) * [-942.846] (-939.691) (-950.117) (-946.853) -- 0:01:30
32500 -- (-937.307) (-936.459) [-944.965] (-941.110) * (-948.501) [-940.558] (-945.061) (-942.732) -- 0:01:29
33000 -- (-937.086) [-936.488] (-953.194) (-938.070) * (-942.900) [-941.642] (-943.035) (-948.795) -- 0:01:27
33500 -- (-937.128) (-936.384) [-949.238] (-938.299) * [-945.048] (-950.349) (-950.877) (-951.226) -- 0:01:26
34000 -- (-937.176) (-935.518) (-945.824) [-937.150] * [-942.205] (-944.051) (-954.272) (-945.661) -- 0:01:25
34500 -- (-937.415) (-935.711) [-942.316] (-938.933) * (-950.686) [-940.252] (-940.843) (-948.339) -- 0:01:23
35000 -- (-940.407) [-938.484] (-941.618) (-935.726) * (-947.059) [-943.041] (-950.456) (-937.509) -- 0:01:22
Average standard deviation of split frequencies: 0.039938
35500 -- (-943.359) (-938.815) (-942.950) [-935.401] * (-945.010) [-946.698] (-951.094) (-938.032) -- 0:01:21
36000 -- (-936.994) (-940.047) (-951.425) [-935.249] * [-947.655] (-946.927) (-943.702) (-935.755) -- 0:01:20
36500 -- (-939.823) (-937.270) [-942.200] (-934.993) * [-940.433] (-946.586) (-946.001) (-935.681) -- 0:01:19
37000 -- (-940.445) (-938.004) (-948.697) [-937.836] * (-952.195) [-945.462] (-943.985) (-935.961) -- 0:01:18
37500 -- (-937.485) (-939.635) [-945.268] (-938.003) * (-951.654) [-939.824] (-945.574) (-937.862) -- 0:01:17
38000 -- (-939.214) (-938.794) [-945.523] (-935.306) * (-946.438) (-954.107) [-945.150] (-935.857) -- 0:01:15
38500 -- (-936.965) (-939.497) [-945.069] (-935.097) * (-943.292) (-953.734) [-943.721] (-936.414) -- 0:01:14
39000 -- (-936.564) [-938.008] (-947.713) (-936.302) * (-947.672) (-946.248) [-947.707] (-936.417) -- 0:01:13
39500 -- (-935.639) [-936.273] (-943.543) (-936.026) * [-938.914] (-947.458) (-946.152) (-936.215) -- 0:01:12
40000 -- (-935.891) (-936.912) [-945.945] (-936.430) * (-943.987) (-958.542) [-947.936] (-935.697) -- 0:01:12
Average standard deviation of split frequencies: 0.036606
40500 -- (-936.882) (-935.275) [-949.415] (-938.913) * (-945.219) (-941.121) (-945.419) [-935.416] -- 0:01:11
41000 -- (-934.964) (-935.749) [-944.961] (-936.526) * (-945.691) (-948.949) (-946.883) [-935.523] -- 0:01:10
41500 -- [-934.889] (-935.084) (-948.580) (-935.953) * (-945.212) (-941.332) [-944.020] (-937.954) -- 0:01:09
42000 -- (-935.206) [-937.421] (-950.961) (-944.257) * (-945.852) (-945.810) (-936.918) [-936.108] -- 0:01:08
42500 -- [-935.567] (-934.825) (-951.821) (-937.892) * (-946.422) (-952.921) (-942.362) [-939.605] -- 0:01:07
43000 -- (-936.342) [-937.078] (-946.471) (-937.834) * (-947.767) (-944.826) (-936.298) [-939.234] -- 0:01:06
43500 -- [-937.919] (-938.836) (-946.651) (-937.010) * (-960.699) (-945.974) [-938.064] (-939.216) -- 0:01:05
44000 -- (-935.737) (-936.399) [-951.541] (-938.780) * [-941.494] (-944.007) (-937.555) (-938.955) -- 0:01:05
44500 -- (-936.235) [-936.260] (-943.572) (-939.178) * (-936.810) [-937.126] (-937.015) (-937.055) -- 0:01:04
45000 -- (-935.758) (-937.590) [-942.498] (-936.313) * [-935.261] (-938.010) (-935.857) (-937.348) -- 0:01:24
Average standard deviation of split frequencies: 0.034160
45500 -- (-937.511) [-937.713] (-947.747) (-936.774) * (-936.876) [-938.123] (-935.033) (-937.081) -- 0:01:23
46000 -- (-938.724) [-937.654] (-948.490) (-937.292) * (-935.416) [-936.243] (-935.033) (-935.080) -- 0:01:22
46500 -- [-935.134] (-935.465) (-945.734) (-936.375) * (-935.413) [-938.521] (-938.772) (-936.440) -- 0:01:22
47000 -- [-937.674] (-935.682) (-954.271) (-938.780) * [-936.856] (-939.127) (-936.395) (-936.656) -- 0:01:21
47500 -- (-937.565) (-935.451) [-943.187] (-937.519) * (-936.778) [-939.633] (-935.720) (-937.086) -- 0:01:20
48000 -- [-935.006] (-937.329) (-953.830) (-935.935) * (-935.930) (-938.936) [-939.561] (-937.584) -- 0:01:19
48500 -- [-939.207] (-938.403) (-944.439) (-939.028) * (-937.228) (-937.924) [-937.343] (-936.854) -- 0:01:18
49000 -- (-937.862) (-939.437) [-948.690] (-937.034) * (-936.543) (-939.094) [-936.159] (-937.261) -- 0:01:17
49500 -- (-936.632) [-938.301] (-943.525) (-936.505) * (-938.734) (-940.466) [-935.490] (-938.514) -- 0:01:16
50000 -- (-937.245) (-938.643) (-942.374) [-935.146] * (-936.181) (-938.470) (-936.412) [-937.281] -- 0:01:16
Average standard deviation of split frequencies: 0.028891
50500 -- (-935.249) (-936.860) [-944.429] (-936.016) * (-937.060) (-937.405) [-936.963] (-938.540) -- 0:01:15
51000 -- [-938.166] (-936.409) (-949.562) (-936.837) * (-937.427) (-938.147) (-937.838) [-939.581] -- 0:01:14
51500 -- (-939.175) [-936.219] (-948.673) (-936.641) * (-936.269) (-940.710) (-935.895) [-943.618] -- 0:01:13
52000 -- (-937.807) (-939.743) [-940.885] (-937.760) * (-938.958) (-940.404) [-937.439] (-944.403) -- 0:01:12
52500 -- (-937.486) (-937.558) (-940.420) [-938.293] * (-939.974) [-940.402] (-936.127) (-938.134) -- 0:01:12
53000 -- (-937.626) [-936.685] (-938.030) (-938.533) * (-940.925) [-936.577] (-936.042) (-937.748) -- 0:01:11
53500 -- (-936.085) (-937.533) (-939.176) [-937.750] * [-936.433] (-937.514) (-936.320) (-940.339) -- 0:01:10
54000 -- (-939.542) [-936.823] (-943.434) (-937.589) * (-937.478) [-938.671] (-937.080) (-938.511) -- 0:01:10
54500 -- (-937.197) (-936.061) (-938.756) [-937.548] * (-935.552) [-936.969] (-939.468) (-942.245) -- 0:01:09
55000 -- (-937.022) (-940.390) (-935.417) [-940.248] * (-937.195) [-939.156] (-939.962) (-937.526) -- 0:01:08
Average standard deviation of split frequencies: 0.028862
55500 -- (-935.669) (-936.394) (-936.310) [-936.369] * (-935.608) (-936.638) (-936.356) [-937.820] -- 0:01:08
56000 -- (-939.887) [-937.853] (-938.187) (-936.460) * [-935.517] (-936.638) (-935.678) (-937.797) -- 0:01:07
56500 -- (-937.635) (-940.595) [-936.558] (-938.416) * [-937.054] (-936.868) (-935.586) (-936.910) -- 0:01:06
57000 -- (-936.015) [-940.839] (-937.090) (-938.445) * (-937.965) (-937.446) (-936.308) [-939.238] -- 0:01:06
57500 -- (-936.568) (-943.710) [-936.406] (-936.214) * (-936.068) (-939.472) [-935.649] (-938.902) -- 0:01:05
58000 -- (-937.585) (-941.861) (-938.172) [-940.076] * [-935.746] (-939.952) (-935.117) (-936.116) -- 0:01:04
58500 -- (-935.897) (-940.275) [-936.519] (-936.161) * (-936.920) [-940.522] (-936.042) (-935.722) -- 0:01:04
59000 -- (-935.653) [-935.544] (-936.109) (-936.938) * (-937.908) [-936.822] (-935.257) (-936.489) -- 0:01:03
59500 -- (-942.648) (-937.047) (-936.354) [-936.566] * (-939.026) (-938.570) (-939.435) [-937.590] -- 0:01:03
60000 -- (-939.532) [-936.121] (-938.031) (-936.652) * [-939.038] (-935.414) (-942.237) (-936.899) -- 0:01:18
Average standard deviation of split frequencies: 0.032562
60500 -- (-936.097) (-935.896) (-936.169) [-934.997] * (-937.506) (-934.816) (-935.877) [-936.344] -- 0:01:17
61000 -- (-937.728) [-936.605] (-939.104) (-935.832) * (-937.507) [-934.982] (-937.730) (-936.126) -- 0:01:16
61500 -- (-937.761) (-942.953) [-936.591] (-935.597) * (-937.179) (-936.273) [-936.186] (-937.957) -- 0:01:16
62000 -- (-938.592) [-936.390] (-937.075) (-936.506) * [-938.510] (-937.369) (-937.455) (-936.086) -- 0:01:15
62500 -- (-937.890) (-936.137) [-937.124] (-937.279) * (-937.091) (-939.142) (-935.376) [-936.546] -- 0:01:15
63000 -- (-938.781) [-935.224] (-935.627) (-936.034) * (-939.749) (-936.192) (-935.897) [-936.895] -- 0:01:14
63500 -- [-937.352] (-939.372) (-936.922) (-937.398) * (-936.611) [-935.886] (-935.732) (-936.489) -- 0:01:13
64000 -- (-938.732) [-936.096] (-935.846) (-937.213) * (-937.037) [-935.442] (-938.392) (-937.081) -- 0:01:13
64500 -- (-936.383) [-936.482] (-936.382) (-937.736) * (-936.955) (-935.537) (-939.848) [-937.144] -- 0:01:12
65000 -- [-936.179] (-939.593) (-936.655) (-937.481) * [-936.758] (-937.528) (-941.381) (-938.075) -- 0:01:11
Average standard deviation of split frequencies: 0.032651
65500 -- (-937.172) (-937.882) [-935.659] (-940.520) * (-937.433) [-937.766] (-938.477) (-941.928) -- 0:01:11
66000 -- (-936.415) (-936.733) (-935.659) [-944.648] * (-938.146) [-938.003] (-939.411) (-935.431) -- 0:01:10
66500 -- (-936.352) (-938.302) (-936.343) [-941.076] * (-939.072) (-938.516) [-935.865] (-937.682) -- 0:01:10
67000 -- (-935.214) (-936.211) [-937.696] (-937.662) * (-937.998) (-935.849) (-935.901) [-935.747] -- 0:01:09
67500 -- [-935.899] (-943.415) (-937.851) (-940.445) * (-936.278) [-937.871] (-936.423) (-935.855) -- 0:01:09
68000 -- (-935.638) [-938.722] (-936.966) (-937.568) * (-935.416) [-937.827] (-935.673) (-935.295) -- 0:01:08
68500 -- [-935.942] (-941.555) (-935.213) (-939.736) * (-939.626) (-937.586) [-935.194] (-937.381) -- 0:01:07
69000 -- (-935.971) [-937.211] (-935.504) (-938.563) * (-936.851) (-943.268) (-938.243) [-937.023] -- 0:01:07
69500 -- (-937.385) [-937.998] (-935.378) (-935.775) * [-936.606] (-937.323) (-938.889) (-941.450) -- 0:01:06
70000 -- (-941.016) [-935.747] (-939.026) (-935.819) * [-935.592] (-937.534) (-936.719) (-934.899) -- 0:01:06
Average standard deviation of split frequencies: 0.034688
70500 -- (-941.881) [-936.239] (-940.627) (-936.035) * (-937.670) (-937.158) (-938.731) [-938.384] -- 0:01:05
71000 -- (-937.096) (-937.026) (-942.236) [-936.335] * (-938.756) [-938.761] (-938.294) (-938.095) -- 0:01:05
71500 -- (-940.668) (-937.346) (-940.803) [-938.234] * (-937.938) (-938.903) [-936.210] (-938.239) -- 0:01:04
72000 -- [-940.992] (-935.364) (-937.251) (-938.271) * (-937.529) (-938.175) (-937.044) [-936.179] -- 0:01:04
72500 -- (-938.140) [-943.349] (-938.333) (-936.723) * [-937.286] (-938.042) (-935.821) (-936.930) -- 0:01:03
73000 -- (-941.824) [-937.936] (-936.256) (-937.110) * [-936.949] (-936.993) (-935.796) (-935.951) -- 0:01:03
73500 -- (-940.384) [-935.972] (-938.361) (-937.665) * [-937.519] (-936.367) (-935.464) (-936.704) -- 0:01:03
74000 -- (-942.548) (-937.818) (-937.694) [-938.235] * [-936.617] (-936.638) (-935.704) (-937.668) -- 0:01:15
74500 -- (-937.060) [-936.067] (-937.338) (-937.145) * (-936.655) (-937.010) [-936.205] (-938.015) -- 0:01:14
75000 -- (-937.116) (-935.579) (-937.497) [-938.061] * (-938.288) [-935.509] (-935.697) (-939.697) -- 0:01:14
Average standard deviation of split frequencies: 0.032874
75500 -- (-937.092) (-937.002) [-938.598] (-936.425) * (-935.580) (-936.390) (-936.308) [-935.253] -- 0:01:13
76000 -- (-937.906) (-937.506) (-936.877) [-937.918] * [-935.132] (-938.719) (-940.909) (-937.647) -- 0:01:12
76500 -- (-938.564) (-937.750) [-936.149] (-937.079) * (-935.895) (-937.766) (-938.176) [-940.230] -- 0:01:12
77000 -- (-937.087) (-940.790) [-934.837] (-935.415) * (-937.728) [-935.713] (-940.027) (-942.082) -- 0:01:11
77500 -- (-937.533) (-944.688) [-939.609] (-936.882) * (-937.501) (-936.758) (-939.168) [-938.155] -- 0:01:11
78000 -- (-943.718) [-936.469] (-936.111) (-940.218) * (-940.010) (-936.217) [-936.777] (-939.341) -- 0:01:10
78500 -- (-936.025) (-938.321) [-938.167] (-936.056) * (-938.836) (-938.365) [-944.474] (-940.204) -- 0:01:10
79000 -- (-937.132) (-941.801) (-939.343) [-936.377] * (-935.568) (-938.125) [-935.626] (-937.907) -- 0:01:09
79500 -- [-937.009] (-937.773) (-942.026) (-939.201) * (-934.933) (-936.118) [-935.568] (-935.824) -- 0:01:09
80000 -- [-935.683] (-936.562) (-941.924) (-938.140) * (-935.150) [-939.502] (-936.772) (-941.069) -- 0:01:09
Average standard deviation of split frequencies: 0.031849
80500 -- (-936.576) (-935.736) [-940.276] (-936.478) * [-935.526] (-937.502) (-936.529) (-938.716) -- 0:01:08
81000 -- (-936.164) [-935.682] (-942.278) (-936.809) * (-936.077) (-938.697) [-937.107] (-939.909) -- 0:01:08
81500 -- (-939.906) [-937.629] (-937.602) (-936.881) * (-936.628) (-939.494) (-937.183) [-936.541] -- 0:01:07
82000 -- (-937.233) (-937.689) (-935.443) [-935.418] * [-937.885] (-936.847) (-936.329) (-938.962) -- 0:01:07
82500 -- (-942.898) [-935.215] (-936.010) (-935.515) * (-936.439) (-938.308) (-938.784) [-937.671] -- 0:01:06
83000 -- (-944.242) (-937.716) [-935.164] (-935.588) * (-935.402) (-940.009) [-938.802] (-938.773) -- 0:01:06
83500 -- [-937.514] (-938.746) (-936.254) (-935.524) * (-935.758) (-938.742) [-936.697] (-936.955) -- 0:01:05
84000 -- (-935.937) [-938.004] (-938.408) (-936.212) * (-935.358) [-936.677] (-937.502) (-936.058) -- 0:01:05
84500 -- [-936.347] (-936.992) (-938.119) (-935.274) * (-936.202) (-938.084) [-938.537] (-935.653) -- 0:01:05
85000 -- [-937.135] (-942.718) (-938.059) (-935.702) * (-938.315) (-936.924) (-935.301) [-935.718] -- 0:01:04
Average standard deviation of split frequencies: 0.028902
85500 -- (-936.887) (-936.383) [-937.661] (-935.398) * (-937.276) (-936.891) (-935.538) [-935.924] -- 0:01:04
86000 -- [-937.548] (-939.327) (-936.704) (-935.557) * (-936.810) [-936.147] (-935.647) (-938.950) -- 0:01:03
86500 -- [-938.573] (-940.870) (-936.947) (-935.818) * [-936.624] (-936.362) (-935.660) (-940.568) -- 0:01:03
87000 -- (-935.804) (-936.849) (-938.194) [-937.321] * (-936.830) [-937.941] (-935.540) (-937.451) -- 0:01:02
87500 -- (-935.725) (-937.260) [-943.546] (-937.670) * (-936.816) (-941.429) (-936.114) [-935.756] -- 0:01:02
88000 -- (-936.471) (-938.122) (-938.028) [-938.372] * (-939.395) (-935.827) [-937.048] (-939.571) -- 0:01:12
88500 -- (-936.476) [-936.348] (-938.631) (-939.077) * (-936.934) [-936.763] (-941.202) (-938.097) -- 0:01:12
89000 -- (-936.409) (-935.830) (-936.683) [-937.008] * (-935.897) (-943.118) (-940.297) [-937.763] -- 0:01:11
89500 -- (-938.387) (-935.908) (-936.660) [-936.473] * (-935.279) (-937.502) (-936.776) [-936.333] -- 0:01:11
90000 -- (-937.193) (-936.062) (-938.050) [-935.626] * (-936.137) [-938.998] (-937.462) (-936.982) -- 0:01:10
Average standard deviation of split frequencies: 0.031196
90500 -- (-937.063) (-935.664) (-936.571) [-935.322] * [-935.391] (-940.408) (-936.210) (-935.644) -- 0:01:10
91000 -- (-936.067) (-936.176) [-937.234] (-942.103) * (-937.527) (-939.314) [-936.369] (-935.230) -- 0:01:09
91500 -- (-934.942) (-936.538) [-936.097] (-940.346) * (-937.320) (-940.689) [-937.675] (-935.652) -- 0:01:09
92000 -- (-935.069) [-935.348] (-935.712) (-940.708) * [-934.871] (-936.763) (-942.528) (-935.435) -- 0:01:09
92500 -- (-936.748) (-936.336) (-935.147) [-935.661] * (-936.145) (-936.586) (-936.016) [-935.249] -- 0:01:08
93000 -- (-936.926) (-936.670) [-935.357] (-935.629) * (-941.313) (-936.594) (-935.085) [-935.695] -- 0:01:08
93500 -- (-937.148) [-937.295] (-936.328) (-936.653) * (-937.916) (-938.211) [-935.085] (-937.065) -- 0:01:07
94000 -- (-938.080) (-940.659) [-936.257] (-937.894) * (-936.491) [-937.410] (-937.266) (-936.741) -- 0:01:07
94500 -- (-937.792) (-937.274) [-935.315] (-942.600) * (-935.352) [-937.374] (-938.515) (-935.192) -- 0:01:07
95000 -- (-940.778) (-937.113) [-935.317] (-937.333) * (-935.775) (-938.018) (-937.079) [-935.766] -- 0:01:06
Average standard deviation of split frequencies: 0.029708
95500 -- (-942.558) [-938.917] (-935.434) (-939.850) * [-936.606] (-936.821) (-936.626) (-939.906) -- 0:01:06
96000 -- (-944.537) (-938.654) (-936.910) [-935.460] * (-938.525) (-937.873) (-937.394) [-937.810] -- 0:01:05
96500 -- [-938.212] (-936.604) (-936.884) (-937.740) * (-935.559) [-939.168] (-935.553) (-938.542) -- 0:01:05
97000 -- (-938.331) (-937.592) [-935.834] (-935.335) * (-935.884) [-938.466] (-941.253) (-937.215) -- 0:01:05
97500 -- (-939.967) (-937.605) (-938.493) [-938.011] * (-938.188) (-936.483) (-940.225) [-937.613] -- 0:01:04
98000 -- (-939.021) (-937.143) (-936.026) [-936.975] * [-935.643] (-936.209) (-942.469) (-935.004) -- 0:01:04
98500 -- (-937.090) (-940.185) [-935.556] (-937.567) * (-935.524) (-936.460) (-944.659) [-936.151] -- 0:01:04
99000 -- (-936.065) (-939.643) (-936.199) [-940.448] * (-935.205) [-936.815] (-940.494) (-940.163) -- 0:01:03
99500 -- (-937.278) (-936.783) (-937.755) [-936.277] * [-935.402] (-936.255) (-936.309) (-936.308) -- 0:01:03
100000 -- [-938.244] (-937.239) (-939.229) (-939.630) * (-935.892) (-936.794) [-936.004] (-936.101) -- 0:01:02
Average standard deviation of split frequencies: 0.025879
100500 -- (-937.010) (-938.452) [-936.708] (-938.136) * (-936.024) (-936.587) (-935.221) [-935.817] -- 0:01:02
101000 -- [-935.866] (-941.625) (-935.693) (-936.993) * (-939.490) (-936.477) (-938.784) [-936.685] -- 0:01:02
101500 -- (-937.284) [-938.060] (-937.473) (-941.507) * (-938.566) (-937.235) (-936.498) [-935.850] -- 0:01:01
102000 -- [-937.822] (-936.779) (-939.593) (-940.349) * (-938.625) (-935.297) [-937.519] (-936.763) -- 0:01:10
102500 -- (-935.858) (-937.021) (-937.586) [-938.540] * (-937.772) [-939.665] (-937.158) (-937.182) -- 0:01:10
103000 -- (-935.675) (-939.123) (-936.136) [-939.121] * (-936.788) (-938.587) (-935.730) [-939.355] -- 0:01:09
103500 -- [-935.504] (-935.081) (-938.109) (-937.248) * (-938.262) [-937.452] (-936.986) (-938.564) -- 0:01:09
104000 -- [-935.090] (-934.956) (-937.837) (-937.710) * (-935.470) (-938.896) (-939.096) [-936.562] -- 0:01:08
104500 -- (-937.984) (-934.956) [-937.750] (-936.698) * (-936.223) [-936.350] (-938.967) (-934.978) -- 0:01:08
105000 -- [-936.914] (-936.469) (-941.608) (-936.292) * [-935.666] (-938.429) (-937.408) (-937.563) -- 0:01:08
Average standard deviation of split frequencies: 0.026461
105500 -- (-935.865) [-936.440] (-939.987) (-937.220) * (-936.110) (-937.473) (-937.448) [-938.075] -- 0:01:07
106000 -- (-936.989) [-936.305] (-936.881) (-937.454) * (-936.081) (-941.369) (-935.489) [-937.786] -- 0:01:07
106500 -- [-937.242] (-936.477) (-936.966) (-935.762) * (-935.910) [-943.552] (-936.146) (-937.045) -- 0:01:07
107000 -- [-937.829] (-937.117) (-941.137) (-935.762) * (-937.358) (-934.769) [-934.828] (-936.821) -- 0:01:06
107500 -- (-935.567) (-938.018) (-939.173) [-937.752] * (-935.376) [-936.431] (-935.547) (-935.810) -- 0:01:06
108000 -- (-935.867) [-936.875] (-935.312) (-935.440) * (-935.369) (-936.299) (-938.263) [-939.328] -- 0:01:06
108500 -- (-937.364) (-937.810) (-935.981) [-937.050] * (-937.597) [-941.285] (-935.847) (-940.877) -- 0:01:05
109000 -- (-937.010) (-936.847) (-937.570) [-936.836] * [-936.137] (-941.119) (-937.895) (-951.427) -- 0:01:05
109500 -- [-936.567] (-937.207) (-937.220) (-935.734) * [-936.940] (-937.494) (-935.566) (-938.929) -- 0:01:05
110000 -- (-937.166) (-935.271) (-935.987) [-938.218] * (-936.842) [-939.229] (-940.187) (-937.961) -- 0:01:04
Average standard deviation of split frequencies: 0.025795
110500 -- (-937.726) (-936.481) (-936.175) [-937.230] * (-937.907) [-935.335] (-937.848) (-936.831) -- 0:01:04
111000 -- (-937.149) (-935.563) (-935.526) [-936.832] * (-936.806) (-938.948) [-935.415] (-944.433) -- 0:01:04
111500 -- (-935.781) (-939.815) [-935.204] (-938.632) * (-936.869) (-935.411) (-938.274) [-936.842] -- 0:01:03
112000 -- (-939.573) (-936.651) [-934.786] (-936.751) * [-938.836] (-935.310) (-938.647) (-936.636) -- 0:01:03
112500 -- (-938.512) (-937.532) (-938.284) [-939.065] * (-937.261) (-935.808) [-936.029] (-937.913) -- 0:01:03
113000 -- [-939.988] (-938.353) (-937.647) (-940.059) * (-938.245) (-940.007) (-939.844) [-935.993] -- 0:01:02
113500 -- (-939.539) (-937.858) [-936.526] (-937.153) * (-936.784) (-938.851) (-937.966) [-936.698] -- 0:01:02
114000 -- (-936.373) [-937.253] (-939.270) (-936.752) * (-936.624) (-940.656) [-940.696] (-936.561) -- 0:01:02
114500 -- (-937.245) (-935.283) [-936.415] (-936.126) * (-935.583) (-945.385) (-936.746) [-936.433] -- 0:01:01
115000 -- (-937.583) (-936.869) (-938.209) [-938.088] * (-936.568) [-936.401] (-938.363) (-939.734) -- 0:01:01
Average standard deviation of split frequencies: 0.026308
115500 -- [-936.968] (-937.632) (-938.931) (-939.519) * [-935.996] (-938.273) (-941.912) (-937.333) -- 0:01:01
116000 -- [-936.417] (-938.374) (-938.118) (-936.007) * (-937.001) (-948.033) (-939.401) [-938.426] -- 0:01:00
116500 -- (-937.060) (-936.116) (-936.814) [-935.288] * (-937.187) (-948.974) (-936.971) [-937.228] -- 0:01:08
117000 -- (-937.095) [-935.297] (-935.139) (-935.485) * (-937.858) (-937.318) [-937.808] (-936.079) -- 0:01:07
117500 -- (-935.609) (-937.016) [-935.481] (-935.409) * (-937.237) (-936.878) [-936.745] (-941.834) -- 0:01:07
118000 -- (-936.714) [-936.990] (-935.989) (-938.427) * [-936.439] (-938.175) (-939.653) (-940.020) -- 0:01:07
118500 -- (-935.661) (-939.010) [-936.386] (-940.519) * (-937.182) (-940.170) (-936.489) [-938.595] -- 0:01:06
119000 -- (-935.838) (-938.150) [-937.508] (-937.447) * (-937.125) (-937.932) [-936.635] (-945.244) -- 0:01:06
119500 -- [-938.579] (-938.229) (-937.215) (-937.303) * [-935.972] (-936.776) (-937.399) (-936.745) -- 0:01:06
120000 -- (-936.345) (-938.816) (-937.171) [-935.291] * (-937.304) (-936.380) [-938.880] (-938.995) -- 0:01:06
Average standard deviation of split frequencies: 0.023646
120500 -- [-936.401] (-942.262) (-939.041) (-939.336) * (-936.908) (-938.012) [-937.050] (-937.589) -- 0:01:05
121000 -- [-936.911] (-936.081) (-938.278) (-938.131) * (-942.058) (-937.031) [-937.097] (-936.943) -- 0:01:05
121500 -- (-935.840) (-936.209) (-937.217) [-935.769] * (-940.300) [-937.361] (-936.535) (-937.088) -- 0:01:05
122000 -- (-935.460) (-936.165) [-938.818] (-938.494) * (-935.798) (-937.398) [-936.902] (-937.013) -- 0:01:04
122500 -- (-936.413) (-936.143) [-936.380] (-940.683) * (-936.363) (-937.744) (-935.885) [-936.478] -- 0:01:04
123000 -- [-935.900] (-936.777) (-937.202) (-938.135) * (-937.106) (-937.744) (-935.885) [-935.601] -- 0:01:04
123500 -- (-937.226) (-936.449) [-937.608] (-936.035) * (-936.447) [-935.732] (-937.546) (-935.855) -- 0:01:03
124000 -- [-936.183] (-936.923) (-941.609) (-935.243) * (-938.429) (-937.002) (-938.388) [-937.572] -- 0:01:03
124500 -- [-935.878] (-935.688) (-935.745) (-936.011) * (-936.512) (-938.112) [-936.281] (-937.109) -- 0:01:03
125000 -- (-937.494) [-935.436] (-935.715) (-935.868) * (-942.788) [-936.211] (-943.071) (-940.374) -- 0:01:03
Average standard deviation of split frequencies: 0.024131
125500 -- (-935.777) (-939.969) (-938.414) [-936.831] * (-937.315) [-936.096] (-937.566) (-938.617) -- 0:01:02
126000 -- [-936.193] (-938.231) (-935.948) (-936.205) * (-936.669) [-935.256] (-937.488) (-937.794) -- 0:01:02
126500 -- (-939.012) (-936.630) (-938.609) [-936.253] * (-935.886) (-936.163) [-937.650] (-940.115) -- 0:01:02
127000 -- (-935.586) [-935.152] (-938.185) (-937.092) * (-936.754) [-936.062] (-939.083) (-941.607) -- 0:01:01
127500 -- [-936.324] (-937.929) (-937.838) (-936.205) * (-937.764) [-936.596] (-938.498) (-936.388) -- 0:01:01
128000 -- (-938.183) [-934.991] (-935.087) (-936.127) * (-940.069) (-937.408) (-937.223) [-935.706] -- 0:01:01
128500 -- (-937.215) (-934.996) (-936.985) [-935.094] * (-935.342) [-935.926] (-935.618) (-938.092) -- 0:01:01
129000 -- (-935.183) (-935.247) (-938.838) [-935.367] * (-937.706) (-935.789) [-937.113] (-934.800) -- 0:01:00
129500 -- (-936.886) (-939.767) (-939.628) [-937.915] * [-936.028] (-939.813) (-937.714) (-934.889) -- 0:01:00
130000 -- (-935.672) (-936.809) [-935.403] (-937.069) * (-937.309) (-945.531) (-935.885) [-935.512] -- 0:01:06
Average standard deviation of split frequencies: 0.020564
130500 -- (-937.452) (-942.153) (-935.229) [-936.523] * [-935.180] (-938.255) (-935.815) (-938.893) -- 0:01:06
131000 -- (-937.313) (-937.967) [-938.747] (-935.441) * (-937.606) (-939.851) [-935.727] (-938.027) -- 0:01:06
131500 -- [-935.932] (-935.033) (-936.509) (-940.378) * (-938.200) [-939.135] (-935.516) (-935.695) -- 0:01:06
132000 -- (-935.716) [-937.874] (-935.128) (-945.115) * [-938.733] (-936.657) (-937.140) (-937.341) -- 0:01:05
132500 -- (-935.226) [-936.449] (-936.999) (-944.856) * (-937.694) (-937.231) [-938.608] (-937.341) -- 0:01:05
133000 -- [-936.935] (-936.764) (-936.848) (-940.441) * (-936.629) (-936.504) [-937.487] (-938.011) -- 0:01:05
133500 -- (-937.009) (-937.906) (-936.830) [-939.138] * (-935.737) (-937.110) (-936.416) [-935.893] -- 0:01:04
134000 -- [-935.260] (-937.141) (-938.343) (-935.579) * (-936.475) (-937.199) [-937.736] (-935.726) -- 0:01:04
134500 -- (-939.133) [-938.799] (-937.750) (-937.412) * (-937.641) (-938.046) [-935.923] (-939.795) -- 0:01:04
135000 -- (-935.947) (-935.142) [-938.276] (-937.175) * (-935.076) [-935.252] (-936.425) (-937.851) -- 0:01:04
Average standard deviation of split frequencies: 0.022283
135500 -- (-939.010) (-935.826) [-939.054] (-936.734) * (-936.132) (-935.634) [-935.607] (-938.462) -- 0:01:03
136000 -- (-936.407) [-936.031] (-939.445) (-936.669) * (-935.278) [-938.165] (-941.284) (-940.194) -- 0:01:03
136500 -- (-940.138) (-937.164) (-936.591) [-936.656] * (-942.158) (-938.586) [-935.599] (-939.212) -- 0:01:03
137000 -- (-939.071) [-934.978] (-937.485) (-935.495) * (-940.212) (-937.021) (-938.945) [-937.008] -- 0:01:02
137500 -- (-936.548) (-936.878) (-939.328) [-936.373] * (-940.477) [-936.285] (-942.379) (-938.631) -- 0:01:02
138000 -- (-939.720) [-937.066] (-943.124) (-936.422) * (-938.958) (-938.733) [-938.349] (-940.499) -- 0:01:02
138500 -- (-937.480) (-939.033) [-941.051] (-937.953) * (-937.543) (-938.005) [-935.303] (-936.991) -- 0:01:02
139000 -- (-936.395) (-941.614) [-939.977] (-936.379) * (-938.700) (-936.074) (-939.337) [-936.355] -- 0:01:01
139500 -- [-938.193] (-936.777) (-936.512) (-942.424) * (-938.450) (-936.198) (-936.462) [-937.465] -- 0:01:01
140000 -- (-936.754) (-936.031) [-936.522] (-938.299) * [-938.179] (-937.287) (-937.337) (-937.660) -- 0:01:01
Average standard deviation of split frequencies: 0.021224
140500 -- (-935.032) [-936.467] (-937.155) (-936.301) * (-938.287) (-938.476) (-938.641) [-935.996] -- 0:01:01
141000 -- (-936.375) (-935.217) (-939.625) [-935.437] * (-936.340) (-937.503) [-935.905] (-935.867) -- 0:01:00
141500 -- (-935.778) (-934.850) (-936.406) [-935.290] * [-936.725] (-935.870) (-936.062) (-937.048) -- 0:01:00
142000 -- (-936.990) [-936.547] (-937.768) (-935.169) * (-936.448) (-936.539) [-936.778] (-937.449) -- 0:01:00
142500 -- (-936.176) (-935.565) (-939.253) [-936.586] * (-936.299) [-935.430] (-936.832) (-937.874) -- 0:01:00
143000 -- (-937.170) [-937.365] (-936.420) (-936.520) * [-935.259] (-937.907) (-937.495) (-938.065) -- 0:00:59
143500 -- (-940.003) (-939.199) [-936.375] (-935.803) * [-935.321] (-937.000) (-936.976) (-936.229) -- 0:00:59
144000 -- (-937.660) [-939.959] (-937.707) (-935.987) * (-935.315) (-938.551) [-937.869] (-936.454) -- 0:00:59
144500 -- [-935.774] (-939.174) (-938.133) (-936.758) * (-935.661) [-938.056] (-936.291) (-937.100) -- 0:00:59
145000 -- (-935.352) (-939.099) [-939.340] (-937.893) * [-935.518] (-937.973) (-935.110) (-938.724) -- 0:00:58
Average standard deviation of split frequencies: 0.020757
145500 -- [-936.191] (-936.110) (-938.510) (-935.936) * [-935.606] (-937.730) (-941.542) (-940.837) -- 0:01:04
146000 -- [-937.412] (-936.574) (-938.113) (-937.308) * (-935.854) (-941.729) [-938.716] (-937.168) -- 0:01:04
146500 -- (-936.358) (-936.470) [-937.797] (-942.109) * (-935.620) (-942.055) [-936.382] (-937.210) -- 0:01:04
147000 -- (-936.402) (-936.494) [-935.983] (-936.271) * (-940.538) (-937.586) (-936.488) [-936.852] -- 0:01:03
147500 -- (-936.544) (-936.210) [-937.873] (-938.708) * (-938.762) (-935.567) [-935.986] (-939.820) -- 0:01:03
148000 -- (-941.093) (-937.334) (-938.111) [-939.436] * (-941.840) [-935.992] (-940.470) (-942.789) -- 0:01:03
148500 -- (-940.389) (-935.677) [-938.137] (-938.630) * [-939.465] (-941.009) (-937.183) (-937.031) -- 0:01:03
149000 -- (-937.772) [-938.524] (-935.492) (-938.416) * [-937.998] (-936.210) (-939.354) (-937.088) -- 0:01:02
149500 -- (-938.765) [-936.786] (-935.437) (-937.571) * [-936.627] (-936.022) (-938.225) (-936.598) -- 0:01:02
150000 -- [-935.039] (-936.576) (-939.313) (-936.158) * (-936.098) [-936.639] (-937.093) (-936.305) -- 0:01:02
Average standard deviation of split frequencies: 0.020114
150500 -- (-938.030) (-935.959) (-936.417) [-938.010] * (-936.079) (-936.103) (-936.241) [-936.040] -- 0:01:02
151000 -- (-938.663) [-936.410] (-935.791) (-937.890) * (-934.776) (-935.858) [-936.973] (-936.864) -- 0:01:01
151500 -- (-940.637) [-937.096] (-935.483) (-943.508) * (-940.863) (-936.670) (-936.617) [-937.663] -- 0:01:01
152000 -- (-937.211) (-936.087) [-937.459] (-934.976) * [-935.867] (-937.099) (-938.879) (-936.127) -- 0:01:01
152500 -- (-937.401) (-935.268) (-936.658) [-935.687] * [-937.209] (-935.000) (-941.909) (-937.046) -- 0:01:01
153000 -- (-937.144) [-937.078] (-946.650) (-936.341) * (-935.988) [-939.948] (-935.789) (-940.833) -- 0:01:00
153500 -- [-935.916] (-937.965) (-937.266) (-936.989) * [-936.651] (-936.131) (-936.579) (-940.077) -- 0:01:00
154000 -- (-942.375) (-937.059) [-936.405] (-937.774) * (-940.900) [-937.532] (-940.256) (-937.914) -- 0:01:00
154500 -- (-940.244) [-935.518] (-937.013) (-935.945) * [-935.734] (-938.287) (-936.113) (-938.833) -- 0:01:00
155000 -- (-940.848) (-935.660) [-937.039] (-941.767) * (-938.720) (-937.390) [-935.612] (-939.080) -- 0:00:59
Average standard deviation of split frequencies: 0.021297
155500 -- [-936.797] (-935.963) (-938.385) (-935.610) * (-939.090) [-936.470] (-936.846) (-936.635) -- 0:00:59
156000 -- (-935.394) (-937.663) (-938.891) [-937.838] * [-936.536] (-941.693) (-936.519) (-938.590) -- 0:00:59
156500 -- (-935.264) (-939.016) [-936.172] (-938.821) * (-936.455) [-942.279] (-940.353) (-938.655) -- 0:00:59
157000 -- [-938.475] (-938.474) (-937.693) (-938.375) * (-936.370) (-938.310) [-934.790] (-941.914) -- 0:00:59
157500 -- (-937.579) (-939.742) [-935.853] (-936.798) * (-937.551) [-937.893] (-935.008) (-938.402) -- 0:00:58
158000 -- [-936.153] (-941.716) (-938.660) (-938.145) * (-935.835) [-938.890] (-936.610) (-936.835) -- 0:00:58
158500 -- (-936.549) (-942.878) (-935.113) [-935.626] * (-935.135) [-938.226] (-937.115) (-941.216) -- 0:00:58
159000 -- (-936.868) (-935.625) (-935.375) [-935.116] * (-937.210) (-938.428) (-939.558) [-937.079] -- 0:00:58
159500 -- [-935.477] (-936.998) (-937.013) (-936.170) * [-936.519] (-937.095) (-935.238) (-936.488) -- 0:00:57
160000 -- (-936.529) [-935.685] (-939.365) (-935.876) * (-935.466) [-936.952] (-936.007) (-935.640) -- 0:00:57
Average standard deviation of split frequencies: 0.019980
160500 -- (-940.124) (-936.018) [-938.138] (-937.073) * (-936.060) (-935.610) [-938.744] (-936.213) -- 0:01:02
161000 -- (-939.104) (-936.941) [-937.041] (-937.931) * (-935.199) (-934.855) [-935.961] (-934.919) -- 0:01:02
161500 -- (-939.968) (-937.132) (-938.577) [-937.188] * (-936.629) [-935.214] (-935.398) (-935.071) -- 0:01:02
162000 -- (-937.155) [-937.236] (-941.591) (-938.901) * (-936.361) (-935.494) (-937.469) [-936.081] -- 0:01:02
162500 -- (-936.565) (-939.196) [-936.491] (-938.101) * (-936.485) (-937.068) [-939.848] (-941.287) -- 0:01:01
163000 -- [-940.663] (-937.751) (-937.613) (-938.457) * (-938.018) [-936.253] (-937.253) (-934.921) -- 0:01:01
163500 -- (-938.807) [-936.759] (-941.372) (-939.104) * (-935.805) (-934.981) [-937.923] (-939.100) -- 0:01:01
164000 -- (-936.584) (-937.445) [-935.099] (-945.731) * (-935.626) (-935.849) (-935.365) [-936.287] -- 0:01:01
164500 -- [-935.840] (-936.051) (-938.381) (-937.834) * (-935.136) [-942.629] (-935.006) (-935.937) -- 0:01:00
165000 -- (-937.879) [-937.139] (-939.971) (-940.408) * (-935.041) (-936.674) (-934.882) [-938.000] -- 0:01:00
Average standard deviation of split frequencies: 0.020825
165500 -- [-936.930] (-938.603) (-936.351) (-937.100) * (-940.699) (-937.982) [-936.390] (-938.715) -- 0:01:00
166000 -- (-938.372) (-935.984) (-936.138) [-937.355] * (-943.123) (-940.224) (-936.616) [-938.279] -- 0:01:00
166500 -- (-937.779) (-936.113) [-935.175] (-935.786) * [-936.346] (-935.132) (-935.533) (-937.138) -- 0:01:00
167000 -- (-936.739) (-937.608) [-936.473] (-936.344) * (-936.466) [-935.418] (-937.979) (-936.998) -- 0:00:59
167500 -- (-936.314) (-936.889) (-941.749) [-935.542] * [-936.507] (-939.454) (-937.976) (-938.599) -- 0:00:59
168000 -- (-937.787) [-936.677] (-935.120) (-935.163) * [-938.207] (-940.463) (-938.848) (-938.841) -- 0:00:59
168500 -- (-938.816) [-936.440] (-939.992) (-938.057) * (-939.250) (-939.089) (-936.480) [-937.726] -- 0:00:59
169000 -- (-936.876) [-936.531] (-940.625) (-937.127) * (-937.088) (-936.727) [-937.500] (-937.426) -- 0:00:59
169500 -- (-936.597) [-936.053] (-937.140) (-938.020) * [-939.740] (-936.306) (-937.498) (-938.665) -- 0:00:58
170000 -- (-936.835) [-936.189] (-937.123) (-937.929) * (-937.192) [-936.031] (-941.773) (-937.453) -- 0:00:58
Average standard deviation of split frequencies: 0.021439
170500 -- (-937.987) [-939.093] (-937.094) (-939.008) * [-937.325] (-936.584) (-940.198) (-939.199) -- 0:00:58
171000 -- [-936.355] (-937.794) (-936.385) (-937.780) * (-938.539) [-937.064] (-938.131) (-936.855) -- 0:00:58
171500 -- (-937.303) (-937.951) (-941.294) [-937.614] * (-939.744) [-936.135] (-938.242) (-940.713) -- 0:00:57
172000 -- (-937.273) (-939.569) (-935.996) [-936.555] * [-937.369] (-938.048) (-936.333) (-937.398) -- 0:00:57
172500 -- [-941.005] (-940.286) (-940.043) (-936.104) * [-937.558] (-937.754) (-935.717) (-936.712) -- 0:00:57
173000 -- (-935.678) (-936.784) (-941.197) [-937.180] * (-941.733) (-936.958) [-936.190] (-935.759) -- 0:00:57
173500 -- [-936.096] (-938.660) (-938.788) (-940.567) * (-936.614) [-936.654] (-936.060) (-939.845) -- 0:00:57
174000 -- (-935.288) (-937.589) [-936.662] (-937.646) * [-936.721] (-936.136) (-938.889) (-941.327) -- 0:01:01
174500 -- [-935.658] (-935.931) (-935.712) (-935.258) * (-937.625) [-936.179] (-942.210) (-938.711) -- 0:01:01
175000 -- (-940.148) (-938.990) [-935.189] (-938.577) * (-935.251) (-937.689) (-941.612) [-936.199] -- 0:01:01
Average standard deviation of split frequencies: 0.023086
175500 -- [-937.275] (-939.410) (-936.672) (-936.842) * (-936.094) [-936.489] (-943.374) (-937.252) -- 0:01:01
176000 -- (-938.515) (-936.592) [-936.276] (-940.848) * [-936.892] (-937.009) (-941.431) (-937.209) -- 0:01:00
176500 -- (-936.691) (-938.030) [-937.407] (-936.394) * [-940.589] (-936.677) (-941.424) (-936.073) -- 0:01:00
177000 -- (-938.248) (-937.494) [-938.904] (-938.740) * [-938.000] (-938.058) (-943.845) (-935.459) -- 0:01:00
177500 -- [-936.241] (-938.664) (-938.636) (-936.559) * [-940.050] (-937.632) (-936.852) (-938.053) -- 0:01:00
178000 -- (-937.188) (-938.397) (-937.583) [-935.801] * (-935.890) [-936.470] (-937.491) (-938.080) -- 0:01:00
178500 -- (-936.386) [-939.033] (-938.164) (-939.887) * (-936.684) (-938.017) [-936.784] (-935.979) -- 0:00:59
179000 -- (-936.704) [-935.900] (-940.639) (-936.997) * (-936.116) [-940.181] (-939.178) (-935.448) -- 0:00:59
179500 -- [-936.336] (-939.854) (-936.970) (-935.978) * (-936.054) [-941.845] (-936.763) (-936.123) -- 0:00:59
180000 -- (-936.623) (-941.082) [-937.307] (-936.665) * (-936.121) (-938.341) [-938.052] (-937.748) -- 0:00:59
Average standard deviation of split frequencies: 0.022489
180500 -- (-935.726) [-941.519] (-939.063) (-937.546) * (-939.580) (-936.839) (-936.220) [-938.630] -- 0:00:59
181000 -- (-937.884) (-944.418) (-941.853) [-936.152] * [-939.543] (-939.165) (-935.242) (-938.361) -- 0:00:58
181500 -- (-936.226) [-941.259] (-936.909) (-938.392) * [-935.858] (-939.772) (-935.565) (-937.275) -- 0:00:58
182000 -- (-937.152) (-936.640) (-936.085) [-937.125] * (-938.071) (-935.559) [-937.280] (-942.831) -- 0:00:58
182500 -- (-941.471) (-937.046) (-936.182) [-939.709] * (-936.515) [-938.075] (-936.306) (-941.870) -- 0:00:58
183000 -- [-937.859] (-937.432) (-939.044) (-937.010) * [-936.220] (-937.360) (-936.257) (-936.362) -- 0:00:58
183500 -- [-938.381] (-936.448) (-940.647) (-940.066) * (-939.260) (-936.276) (-938.425) [-936.961] -- 0:00:57
184000 -- (-941.433) (-937.947) [-939.737] (-939.281) * (-936.712) [-938.292] (-935.427) (-935.201) -- 0:00:57
184500 -- (-940.953) [-938.549] (-942.407) (-938.449) * [-936.177] (-937.560) (-939.014) (-936.294) -- 0:00:57
185000 -- [-936.992] (-936.197) (-937.552) (-935.193) * (-936.226) (-938.080) (-941.563) [-938.439] -- 0:00:57
Average standard deviation of split frequencies: 0.022086
185500 -- (-938.844) [-935.390] (-939.599) (-935.057) * (-936.407) (-938.629) [-935.752] (-937.423) -- 0:00:57
186000 -- (-936.563) [-935.038] (-941.958) (-941.755) * (-936.125) (-936.722) (-935.946) [-938.728] -- 0:00:56
186500 -- (-937.845) (-936.326) (-938.672) [-935.668] * (-935.773) (-936.925) [-935.339] (-937.028) -- 0:00:56
187000 -- (-936.247) [-935.109] (-936.475) (-938.562) * [-937.266] (-937.795) (-935.660) (-937.125) -- 0:01:00
187500 -- (-936.315) (-937.310) [-939.014] (-936.119) * (-935.914) [-936.780] (-935.499) (-938.817) -- 0:01:00
188000 -- [-937.185] (-936.229) (-935.382) (-938.288) * (-935.829) [-936.369] (-936.025) (-935.464) -- 0:01:00
188500 -- [-937.267] (-938.456) (-935.629) (-936.724) * [-935.997] (-939.481) (-937.022) (-936.307) -- 0:01:00
189000 -- (-937.756) (-938.811) (-936.267) [-938.310] * (-936.094) (-938.902) (-936.540) [-935.614] -- 0:01:00
189500 -- (-937.388) (-936.309) [-937.620] (-938.162) * (-936.091) [-938.580] (-936.473) (-936.966) -- 0:00:59
190000 -- (-936.599) (-937.489) [-937.910] (-937.386) * [-936.837] (-939.452) (-937.827) (-937.911) -- 0:00:59
Average standard deviation of split frequencies: 0.020486
190500 -- [-937.933] (-937.308) (-938.682) (-936.452) * (-935.574) [-937.426] (-939.427) (-937.904) -- 0:00:59
191000 -- (-937.352) (-937.151) (-937.318) [-936.005] * [-936.277] (-936.854) (-936.744) (-939.138) -- 0:00:59
191500 -- (-936.013) [-936.578] (-941.645) (-936.643) * (-935.853) [-937.098] (-935.242) (-937.310) -- 0:00:59
192000 -- (-935.636) (-938.877) (-936.481) [-938.162] * (-936.227) [-935.994] (-935.217) (-940.089) -- 0:00:58
192500 -- [-935.436] (-937.694) (-940.015) (-939.171) * (-936.516) [-937.911] (-935.348) (-940.706) -- 0:00:58
193000 -- (-936.655) (-936.976) [-942.581] (-939.473) * [-937.854] (-937.214) (-939.447) (-936.620) -- 0:00:58
193500 -- (-938.241) (-937.937) (-939.929) [-935.958] * [-935.291] (-936.349) (-938.643) (-937.957) -- 0:00:58
194000 -- (-934.822) (-937.431) [-937.900] (-935.866) * (-938.993) (-937.323) [-936.695] (-936.176) -- 0:00:58
194500 -- (-937.480) (-940.265) [-938.518] (-935.154) * (-940.644) (-937.954) (-937.172) [-935.230] -- 0:00:57
195000 -- (-938.288) (-936.343) (-939.176) [-938.470] * (-942.759) (-938.118) [-935.784] (-939.430) -- 0:00:57
Average standard deviation of split frequencies: 0.020043
195500 -- (-939.185) (-935.779) [-940.381] (-939.630) * [-942.384] (-935.519) (-935.950) (-935.681) -- 0:00:57
196000 -- (-937.294) (-935.880) (-940.984) [-938.083] * [-937.752] (-938.139) (-938.130) (-937.344) -- 0:00:57
196500 -- (-935.608) (-936.912) (-936.385) [-935.787] * (-937.164) [-938.496] (-940.070) (-938.094) -- 0:00:57
197000 -- [-935.127] (-937.491) (-937.359) (-938.188) * (-937.351) (-936.764) [-938.849] (-937.306) -- 0:00:57
197500 -- (-935.389) (-935.496) (-942.378) [-938.450] * (-942.048) (-936.604) (-940.890) [-936.619] -- 0:00:56
198000 -- [-936.190] (-937.772) (-936.173) (-936.070) * (-939.539) (-937.229) [-937.831] (-938.031) -- 0:00:56
198500 -- (-936.362) (-941.194) [-935.430] (-936.522) * (-939.013) (-936.588) [-936.070] (-942.079) -- 0:00:56
199000 -- (-936.976) (-938.610) (-935.629) [-935.302] * (-935.449) (-937.646) [-935.324] (-937.765) -- 0:00:56
199500 -- (-935.194) [-935.813] (-937.458) (-939.510) * (-935.545) (-941.906) (-935.812) [-937.590] -- 0:00:56
200000 -- (-936.856) [-935.999] (-936.313) (-938.957) * (-938.697) (-944.835) [-935.015] (-935.784) -- 0:00:55
Average standard deviation of split frequencies: 0.017501
200500 -- (-935.214) [-939.118] (-935.888) (-938.417) * [-937.150] (-939.525) (-937.227) (-935.784) -- 0:00:59
201000 -- (-938.367) [-935.395] (-937.762) (-936.546) * [-938.613] (-940.380) (-936.566) (-937.101) -- 0:00:59
201500 -- (-936.610) (-941.785) (-935.462) [-936.933] * (-936.001) (-937.865) [-937.053] (-935.929) -- 0:00:59
202000 -- (-935.599) (-938.679) [-935.355] (-940.028) * (-935.883) (-938.454) (-936.786) [-935.587] -- 0:00:59
202500 -- (-937.785) (-939.597) [-937.079] (-938.390) * (-937.504) [-935.934] (-935.511) (-940.709) -- 0:00:59
203000 -- (-936.600) (-938.597) (-938.572) [-935.481] * (-937.455) (-936.590) (-937.328) [-937.475] -- 0:00:58
203500 -- (-934.969) (-937.918) (-938.387) [-938.336] * [-936.014] (-942.042) (-945.282) (-935.225) -- 0:00:58
204000 -- (-935.721) (-940.211) [-938.666] (-939.215) * [-936.814] (-939.196) (-938.222) (-935.380) -- 0:00:58
204500 -- (-939.304) (-936.742) (-938.749) [-935.962] * [-935.898] (-935.687) (-936.870) (-936.367) -- 0:00:58
205000 -- (-937.611) (-936.345) [-937.105] (-940.542) * (-936.753) (-935.999) [-935.864] (-935.535) -- 0:00:58
Average standard deviation of split frequencies: 0.018525
205500 -- (-938.646) (-936.841) [-936.583] (-937.204) * (-936.418) (-938.277) (-938.237) [-936.668] -- 0:00:57
206000 -- (-937.505) (-937.609) (-940.102) [-937.638] * [-935.949] (-937.454) (-936.228) (-935.528) -- 0:00:57
206500 -- (-937.992) [-937.973] (-937.040) (-935.460) * [-935.362] (-936.928) (-935.086) (-939.966) -- 0:00:57
207000 -- [-936.903] (-935.621) (-938.392) (-935.266) * (-934.924) (-935.816) [-937.287] (-937.782) -- 0:00:57
207500 -- (-935.677) [-936.752] (-936.806) (-936.153) * [-937.226] (-939.165) (-937.223) (-939.780) -- 0:00:57
208000 -- (-936.722) [-939.354] (-938.037) (-936.304) * [-937.137] (-939.532) (-936.846) (-938.520) -- 0:00:57
208500 -- (-937.698) (-939.463) [-935.358] (-938.795) * (-935.186) (-940.158) (-940.997) [-936.751] -- 0:00:56
209000 -- (-939.327) (-935.167) [-937.169] (-938.456) * [-935.871] (-940.680) (-937.785) (-936.731) -- 0:00:56
209500 -- (-938.110) [-935.941] (-936.998) (-937.871) * (-935.818) (-936.721) (-936.648) [-936.901] -- 0:00:56
210000 -- (-938.306) (-937.207) (-937.159) [-936.051] * (-936.584) (-937.014) (-937.289) [-936.790] -- 0:00:56
Average standard deviation of split frequencies: 0.018647
210500 -- (-938.522) [-940.678] (-937.277) (-937.057) * (-934.984) (-936.651) (-936.335) [-934.645] -- 0:00:56
211000 -- (-940.723) [-937.052] (-936.485) (-938.026) * (-936.413) (-937.959) (-935.466) [-935.068] -- 0:00:56
211500 -- [-936.466] (-939.334) (-937.742) (-939.755) * (-934.996) (-937.510) [-936.431] (-935.472) -- 0:00:55
212000 -- [-937.193] (-936.819) (-936.088) (-937.373) * (-936.099) [-938.305] (-935.945) (-936.477) -- 0:00:55
212500 -- [-936.336] (-938.839) (-936.974) (-938.070) * (-936.256) (-936.259) [-937.512] (-936.744) -- 0:00:55
213000 -- (-937.839) (-939.496) [-936.628] (-937.367) * [-935.652] (-935.670) (-939.977) (-937.742) -- 0:00:55
213500 -- [-938.948] (-936.459) (-936.215) (-938.723) * [-937.670] (-935.566) (-936.494) (-936.859) -- 0:00:55
214000 -- (-937.854) (-939.477) (-936.646) [-938.100] * (-936.509) (-935.398) [-941.493] (-944.082) -- 0:00:55
214500 -- (-937.244) (-937.475) [-941.474] (-942.348) * (-939.076) [-936.653] (-935.517) (-938.114) -- 0:00:58
215000 -- (-936.462) [-935.949] (-936.467) (-940.985) * (-937.745) (-937.632) (-936.481) [-937.474] -- 0:00:58
Average standard deviation of split frequencies: 0.019538
215500 -- (-936.488) [-935.656] (-937.698) (-940.895) * (-936.487) [-938.368] (-935.988) (-939.528) -- 0:00:58
216000 -- (-937.804) [-936.190] (-936.741) (-936.788) * (-941.038) [-941.120] (-934.778) (-937.932) -- 0:00:58
216500 -- (-938.967) (-935.400) [-935.360] (-936.370) * (-936.481) (-938.390) [-934.968] (-938.266) -- 0:00:57
217000 -- [-937.836] (-936.514) (-935.359) (-936.629) * (-935.570) (-937.256) (-935.867) [-937.726] -- 0:00:57
217500 -- [-936.673] (-936.111) (-942.140) (-937.803) * [-935.683] (-936.700) (-935.440) (-937.897) -- 0:00:57
218000 -- (-940.074) (-937.645) (-939.755) [-938.317] * [-935.665] (-935.541) (-935.842) (-935.544) -- 0:00:57
218500 -- (-935.457) [-941.243] (-940.197) (-937.215) * (-936.779) (-935.810) (-935.316) [-937.321] -- 0:00:57
219000 -- (-935.866) (-944.678) [-938.148] (-935.393) * [-941.368] (-935.582) (-935.590) (-938.594) -- 0:00:57
219500 -- [-938.201] (-936.157) (-936.394) (-935.810) * (-939.263) (-936.962) [-936.711] (-941.742) -- 0:00:56
220000 -- (-936.616) (-936.800) [-935.776] (-935.714) * (-939.435) [-935.711] (-938.106) (-942.525) -- 0:00:56
Average standard deviation of split frequencies: 0.017731
220500 -- [-937.601] (-936.151) (-935.219) (-941.243) * (-935.366) (-934.960) (-939.461) [-937.185] -- 0:00:56
221000 -- (-937.924) [-936.302] (-936.076) (-938.016) * (-935.492) (-934.898) [-935.342] (-936.187) -- 0:00:56
221500 -- (-936.614) (-936.160) [-936.003] (-937.645) * [-935.483] (-935.239) (-939.045) (-936.218) -- 0:00:56
222000 -- (-936.573) [-935.050] (-941.298) (-938.328) * [-937.904] (-936.366) (-940.628) (-938.370) -- 0:00:56
222500 -- (-935.872) [-936.861] (-939.397) (-938.570) * (-934.968) [-935.301] (-935.680) (-937.478) -- 0:00:55
223000 -- (-935.856) [-934.890] (-939.119) (-938.443) * (-940.840) [-936.222] (-937.375) (-938.624) -- 0:00:55
223500 -- (-936.670) (-938.658) (-936.450) [-936.988] * [-935.645] (-935.119) (-938.213) (-939.993) -- 0:00:55
224000 -- (-936.245) [-938.453] (-937.658) (-939.401) * (-935.346) [-936.562] (-936.304) (-939.615) -- 0:00:55
224500 -- (-936.226) [-935.618] (-938.053) (-936.981) * (-935.590) (-936.016) [-935.535] (-942.432) -- 0:00:55
225000 -- (-936.811) [-935.753] (-940.163) (-935.892) * (-935.606) (-936.594) [-937.013] (-938.662) -- 0:00:55
Average standard deviation of split frequencies: 0.016478
225500 -- [-939.012] (-935.883) (-938.039) (-939.244) * [-936.418] (-936.308) (-935.451) (-936.092) -- 0:00:54
226000 -- (-939.540) (-936.339) [-936.709] (-937.334) * (-934.743) (-938.328) (-935.949) [-937.166] -- 0:00:54
226500 -- (-940.494) (-937.228) [-936.675] (-936.259) * (-935.854) (-935.894) [-936.237] (-938.236) -- 0:00:54
227000 -- (-938.429) (-937.485) [-936.005] (-938.171) * (-936.963) (-936.894) (-936.407) [-941.730] -- 0:00:54
227500 -- [-935.295] (-937.837) (-937.069) (-941.258) * (-936.033) (-935.898) [-935.503] (-942.726) -- 0:00:54
228000 -- (-934.891) (-938.775) (-941.003) [-936.650] * (-937.219) [-936.156] (-936.169) (-936.842) -- 0:00:54
228500 -- (-935.904) [-938.782] (-938.809) (-936.617) * (-935.682) (-935.364) [-936.431] (-937.799) -- 0:00:54
229000 -- (-936.965) (-936.353) [-936.846] (-936.569) * [-937.670] (-935.294) (-935.957) (-937.612) -- 0:00:53
229500 -- (-936.802) (-934.624) [-938.964] (-935.653) * (-936.781) (-935.026) [-935.621] (-935.248) -- 0:00:57
230000 -- (-940.809) [-936.044] (-938.187) (-935.983) * [-935.266] (-935.343) (-935.621) (-935.357) -- 0:00:56
Average standard deviation of split frequencies: 0.016043
230500 -- [-937.943] (-937.399) (-939.323) (-935.315) * (-935.763) (-936.862) (-935.203) [-935.082] -- 0:00:56
231000 -- [-935.437] (-937.958) (-943.112) (-937.898) * [-935.824] (-938.086) (-935.198) (-935.319) -- 0:00:56
231500 -- (-936.519) (-937.914) (-934.965) [-941.159] * [-935.905] (-939.084) (-935.834) (-936.177) -- 0:00:56
232000 -- (-936.431) (-936.641) [-935.812] (-940.816) * (-935.704) (-939.486) (-936.445) [-936.430] -- 0:00:56
232500 -- (-936.875) [-937.133] (-936.094) (-940.517) * (-936.963) (-935.176) [-935.454] (-935.935) -- 0:00:56
233000 -- (-936.804) (-940.185) [-934.835] (-936.125) * (-938.777) [-935.517] (-935.328) (-935.826) -- 0:00:55
233500 -- (-936.247) (-939.547) [-936.094] (-936.012) * (-935.966) (-935.482) [-935.861] (-935.790) -- 0:00:55
234000 -- (-939.659) [-935.342] (-939.614) (-939.355) * (-937.248) (-935.567) [-938.639] (-936.535) -- 0:00:55
234500 -- (-937.665) (-936.076) [-936.194] (-938.911) * (-935.914) [-936.156] (-939.769) (-935.063) -- 0:00:55
235000 -- (-936.500) (-937.203) (-937.248) [-939.457] * [-936.466] (-936.126) (-941.024) (-940.730) -- 0:00:55
Average standard deviation of split frequencies: 0.015409
235500 -- (-936.060) [-935.399] (-937.313) (-936.243) * (-935.612) (-935.620) [-936.641] (-940.034) -- 0:00:55
236000 -- (-936.778) [-936.371] (-940.729) (-935.481) * (-939.645) (-938.979) (-935.843) [-936.416] -- 0:00:55
236500 -- [-936.972] (-939.455) (-939.584) (-938.979) * (-937.897) [-939.660] (-938.079) (-937.030) -- 0:00:54
237000 -- [-936.530] (-939.146) (-942.590) (-935.584) * (-937.802) (-939.360) [-936.297] (-936.712) -- 0:00:54
237500 -- [-937.287] (-938.174) (-938.627) (-935.007) * (-939.321) (-939.210) (-936.269) [-935.322] -- 0:00:54
238000 -- (-935.040) [-937.118] (-936.019) (-937.932) * (-936.412) [-935.845] (-937.578) (-935.577) -- 0:00:54
238500 -- (-936.244) [-938.069] (-937.992) (-935.592) * (-937.447) (-935.449) [-938.908] (-935.517) -- 0:00:54
239000 -- (-937.790) (-938.284) (-938.357) [-935.647] * [-935.932] (-939.708) (-936.988) (-938.611) -- 0:00:54
239500 -- (-940.245) [-937.367] (-938.285) (-935.377) * [-935.144] (-937.231) (-937.587) (-936.770) -- 0:00:53
240000 -- (-941.226) [-935.102] (-936.115) (-935.730) * (-935.322) (-935.240) [-938.051] (-937.124) -- 0:00:53
Average standard deviation of split frequencies: 0.013481
240500 -- [-941.529] (-935.557) (-936.696) (-937.394) * (-936.862) (-936.251) [-940.101] (-942.796) -- 0:00:53
241000 -- (-937.516) (-937.752) [-937.067] (-938.854) * (-936.051) (-935.943) [-937.791] (-938.416) -- 0:00:53
241500 -- (-939.175) (-936.179) [-939.423] (-934.996) * (-938.506) [-937.846] (-940.337) (-937.850) -- 0:00:53
242000 -- (-937.509) (-935.471) [-937.746] (-935.477) * (-936.205) [-935.947] (-936.501) (-939.763) -- 0:00:53
242500 -- (-940.060) (-935.452) (-939.923) [-937.261] * [-936.367] (-936.146) (-935.626) (-938.915) -- 0:00:53
243000 -- (-937.185) (-937.473) (-935.881) [-935.659] * [-936.087] (-936.746) (-939.230) (-938.135) -- 0:00:52
243500 -- (-939.076) [-936.315] (-936.757) (-937.090) * [-940.042] (-938.261) (-935.540) (-938.651) -- 0:00:52
244000 -- (-942.009) (-939.351) (-937.186) [-935.946] * (-937.822) [-936.942] (-936.257) (-936.522) -- 0:00:55
244500 -- [-937.784] (-936.976) (-938.653) (-936.591) * [-936.932] (-938.164) (-935.716) (-937.328) -- 0:00:55
245000 -- (-935.649) [-939.590] (-940.538) (-935.535) * (-938.836) (-935.062) (-938.100) [-936.201] -- 0:00:55
Average standard deviation of split frequencies: 0.012506
245500 -- (-937.637) [-935.669] (-944.695) (-938.655) * [-938.393] (-934.737) (-935.425) (-938.229) -- 0:00:55
246000 -- (-935.290) (-935.317) (-945.584) [-936.224] * (-941.393) (-936.091) [-935.650] (-938.182) -- 0:00:55
246500 -- [-934.954] (-936.957) (-937.778) (-937.958) * (-940.656) (-937.326) [-935.639] (-935.917) -- 0:00:55
247000 -- (-937.271) (-935.896) (-937.720) [-936.117] * [-942.582] (-936.177) (-939.999) (-937.492) -- 0:00:54
247500 -- (-937.908) (-937.435) (-939.261) [-936.513] * (-942.162) (-936.454) [-936.406] (-936.969) -- 0:00:54
248000 -- (-937.784) [-935.717] (-939.648) (-935.016) * (-940.134) [-938.364] (-936.296) (-935.074) -- 0:00:54
248500 -- (-936.781) [-935.902] (-937.185) (-937.429) * [-936.148] (-938.129) (-936.962) (-935.576) -- 0:00:54
249000 -- (-935.852) (-938.251) (-938.248) [-939.326] * (-935.862) (-937.617) [-935.792] (-935.897) -- 0:00:54
249500 -- (-935.250) [-939.840] (-936.498) (-936.420) * (-937.449) (-938.145) (-937.209) [-935.268] -- 0:00:54
250000 -- (-935.190) (-935.894) [-935.796] (-936.695) * [-936.525] (-938.179) (-939.711) (-935.542) -- 0:00:54
Average standard deviation of split frequencies: 0.010866
250500 -- (-936.255) (-940.842) [-935.577] (-936.100) * (-937.021) [-937.338] (-936.597) (-937.420) -- 0:00:53
251000 -- (-937.646) (-941.676) (-935.996) [-938.034] * (-936.075) (-938.706) [-935.628] (-936.308) -- 0:00:53
251500 -- (-941.952) [-938.571] (-936.025) (-937.511) * (-937.635) [-938.703] (-940.215) (-935.092) -- 0:00:53
252000 -- [-941.119] (-936.138) (-938.424) (-940.326) * (-937.108) [-937.198] (-935.751) (-934.936) -- 0:00:53
252500 -- (-938.573) (-936.800) [-937.503] (-937.061) * (-937.537) (-936.173) [-937.340] (-934.959) -- 0:00:53
253000 -- (-936.861) (-936.466) (-937.964) [-936.967] * [-939.750] (-935.152) (-939.015) (-938.168) -- 0:00:53
253500 -- [-939.121] (-936.853) (-935.965) (-939.233) * (-936.316) (-936.389) [-935.803] (-936.545) -- 0:00:53
254000 -- (-941.165) [-940.441] (-936.282) (-937.953) * (-936.057) (-939.066) [-935.811] (-936.582) -- 0:00:52
254500 -- (-935.963) (-938.394) [-936.339] (-942.201) * [-934.825] (-936.292) (-936.840) (-940.208) -- 0:00:52
255000 -- (-935.491) (-937.164) (-936.290) [-938.980] * (-936.146) [-937.425] (-935.819) (-935.718) -- 0:00:52
Average standard deviation of split frequencies: 0.011049
255500 -- (-936.601) (-938.287) [-936.457] (-936.744) * (-942.224) [-937.143] (-938.531) (-936.077) -- 0:00:52
256000 -- (-935.315) [-936.091] (-936.526) (-942.392) * [-937.567] (-937.258) (-938.487) (-937.422) -- 0:00:52
256500 -- (-937.714) (-936.200) (-937.490) [-938.431] * (-938.491) (-936.288) (-938.171) [-939.399] -- 0:00:52
257000 -- (-935.131) [-937.133] (-937.785) (-936.535) * [-937.124] (-937.031) (-935.783) (-937.725) -- 0:00:52
257500 -- (-935.982) (-943.191) (-936.636) [-936.220] * (-936.614) (-937.230) (-935.894) [-936.003] -- 0:00:51
258000 -- (-936.881) (-941.197) (-936.188) [-935.288] * [-936.613] (-936.867) (-935.698) (-936.999) -- 0:00:51
258500 -- (-940.760) (-936.930) (-936.938) [-936.470] * (-937.516) (-936.979) [-938.303] (-936.815) -- 0:00:54
259000 -- (-939.212) [-938.120] (-937.353) (-936.881) * [-936.021] (-936.348) (-939.358) (-936.820) -- 0:00:54
259500 -- (-936.956) (-937.314) (-936.809) [-937.385] * [-935.920] (-936.267) (-936.570) (-944.310) -- 0:00:54
260000 -- [-939.709] (-938.296) (-939.148) (-935.242) * (-937.015) [-935.033] (-938.924) (-938.438) -- 0:00:54
Average standard deviation of split frequencies: 0.011170
260500 -- (-940.981) (-935.772) (-938.038) [-936.760] * [-935.273] (-935.371) (-939.249) (-938.407) -- 0:00:53
261000 -- (-939.716) [-936.340] (-939.135) (-935.856) * [-936.673] (-935.370) (-937.331) (-940.726) -- 0:00:53
261500 -- (-939.704) (-936.630) (-940.797) [-942.090] * (-937.710) [-936.684] (-936.615) (-938.010) -- 0:00:53
262000 -- (-935.519) (-939.397) (-939.186) [-938.441] * (-935.892) [-936.928] (-940.178) (-938.532) -- 0:00:53
262500 -- (-936.673) (-937.117) (-938.290) [-938.977] * [-935.648] (-941.256) (-937.003) (-939.462) -- 0:00:53
263000 -- [-935.343] (-938.548) (-937.106) (-940.584) * (-938.062) [-936.746] (-936.530) (-935.258) -- 0:00:53
263500 -- (-936.152) [-936.788] (-937.903) (-937.113) * (-940.093) (-936.679) (-935.760) [-938.421] -- 0:00:53
264000 -- (-938.541) [-936.667] (-937.591) (-935.566) * (-938.755) [-936.767] (-936.195) (-937.294) -- 0:00:52
264500 -- (-937.027) (-936.413) (-937.860) [-936.221] * (-937.969) [-937.546] (-936.711) (-937.694) -- 0:00:52
265000 -- [-939.757] (-938.879) (-935.266) (-939.155) * (-936.403) [-937.411] (-940.076) (-937.468) -- 0:00:52
Average standard deviation of split frequencies: 0.011962
265500 -- (-936.530) [-936.236] (-940.411) (-941.985) * (-936.139) [-936.340] (-938.018) (-939.809) -- 0:00:52
266000 -- (-935.336) [-935.624] (-940.982) (-939.222) * (-935.736) (-937.602) [-936.081] (-936.856) -- 0:00:52
266500 -- (-935.603) (-938.383) [-937.571] (-936.070) * [-936.324] (-935.994) (-936.320) (-938.612) -- 0:00:52
267000 -- (-935.776) [-937.822] (-941.069) (-936.056) * [-938.560] (-939.214) (-937.295) (-936.675) -- 0:00:52
267500 -- (-935.370) [-936.203] (-942.031) (-936.075) * [-938.148] (-937.412) (-938.929) (-935.802) -- 0:00:52
268000 -- (-937.610) [-935.329] (-938.707) (-936.346) * (-940.783) (-937.071) [-936.138] (-938.170) -- 0:00:51
268500 -- (-940.509) (-935.826) [-937.044] (-938.461) * (-936.633) (-936.340) (-938.026) [-937.722] -- 0:00:51
269000 -- [-936.207] (-936.371) (-940.823) (-936.751) * (-939.977) (-935.981) (-939.436) [-937.987] -- 0:00:51
269500 -- (-935.656) [-936.679] (-936.503) (-938.668) * (-938.938) [-935.981] (-936.914) (-935.202) -- 0:00:51
270000 -- (-935.903) [-937.354] (-935.301) (-939.340) * [-936.786] (-938.975) (-935.857) (-936.177) -- 0:00:51
Average standard deviation of split frequencies: 0.012482
270500 -- [-936.206] (-936.783) (-936.437) (-940.380) * (-938.467) [-937.430] (-937.422) (-936.522) -- 0:00:51
271000 -- (-934.666) (-936.920) (-935.665) [-937.278] * (-936.023) [-936.125] (-936.432) (-936.762) -- 0:00:51
271500 -- (-936.321) (-937.423) [-937.522] (-942.421) * (-935.870) (-935.546) (-936.051) [-937.640] -- 0:00:50
272000 -- (-939.074) [-936.161] (-938.930) (-938.573) * [-938.200] (-935.535) (-936.077) (-936.357) -- 0:00:53
272500 -- (-938.152) [-936.491] (-939.758) (-938.440) * (-937.403) (-935.471) [-938.460] (-938.188) -- 0:00:53
273000 -- (-936.775) (-934.913) (-937.366) [-937.085] * (-936.920) [-937.599] (-937.935) (-935.747) -- 0:00:53
273500 -- (-938.108) (-935.127) [-936.233] (-938.651) * [-937.232] (-935.951) (-935.884) (-937.979) -- 0:00:53
274000 -- (-940.604) (-935.951) (-936.885) [-935.334] * (-936.160) (-936.996) [-935.114] (-937.831) -- 0:00:52
274500 -- [-938.187] (-937.346) (-937.948) (-936.317) * [-936.902] (-937.890) (-935.869) (-935.873) -- 0:00:52
275000 -- [-939.083] (-939.077) (-938.098) (-936.891) * (-937.182) (-939.259) [-936.206] (-935.600) -- 0:00:52
Average standard deviation of split frequencies: 0.011481
275500 -- (-939.445) (-936.738) (-936.228) [-937.083] * (-935.180) (-939.816) [-934.989] (-937.728) -- 0:00:52
276000 -- (-936.498) [-942.626] (-938.729) (-936.113) * [-938.265] (-941.731) (-936.692) (-937.397) -- 0:00:52
276500 -- (-937.318) (-938.934) (-938.696) [-936.082] * (-936.705) [-940.171] (-935.228) (-939.553) -- 0:00:52
277000 -- (-936.068) (-936.615) (-936.967) [-937.175] * [-937.849] (-940.243) (-936.677) (-939.773) -- 0:00:52
277500 -- (-939.384) [-935.599] (-936.571) (-938.456) * (-938.791) (-936.099) (-936.612) [-936.552] -- 0:00:52
278000 -- (-936.077) (-938.438) (-937.295) [-936.321] * (-938.228) (-935.750) [-937.892] (-940.132) -- 0:00:51
278500 -- (-937.857) (-937.834) [-936.027] (-938.425) * (-935.458) (-936.505) [-936.375] (-937.289) -- 0:00:51
279000 -- (-939.896) [-938.504] (-938.120) (-936.997) * (-936.499) (-937.901) [-934.967] (-936.924) -- 0:00:51
279500 -- (-942.530) (-935.737) (-936.995) [-936.634] * [-935.020] (-938.259) (-935.003) (-937.325) -- 0:00:51
280000 -- (-947.814) [-935.890] (-936.302) (-938.633) * (-936.762) (-936.926) [-935.676] (-939.154) -- 0:00:51
Average standard deviation of split frequencies: 0.010572
280500 -- (-938.403) [-935.628] (-938.890) (-940.155) * [-936.202] (-937.213) (-935.168) (-937.108) -- 0:00:51
281000 -- (-936.440) (-938.059) [-942.042] (-937.085) * (-941.454) (-938.428) (-935.682) [-939.310] -- 0:00:51
281500 -- (-935.729) [-938.376] (-938.341) (-940.733) * (-935.508) (-936.489) (-938.385) [-935.338] -- 0:00:51
282000 -- (-936.936) [-936.553] (-939.072) (-937.108) * [-936.988] (-936.316) (-941.323) (-935.594) -- 0:00:50
282500 -- (-935.067) (-936.885) [-937.187] (-937.102) * (-937.473) (-938.333) (-936.727) [-939.398] -- 0:00:50
283000 -- (-937.719) [-935.315] (-938.382) (-936.816) * (-937.189) [-936.280] (-936.464) (-942.455) -- 0:00:50
283500 -- [-936.044] (-935.951) (-935.349) (-936.788) * (-935.580) [-935.527] (-938.293) (-936.314) -- 0:00:50
284000 -- (-936.900) [-935.573] (-938.757) (-935.940) * (-935.818) [-936.316] (-937.104) (-938.087) -- 0:00:50
284500 -- (-935.935) [-936.396] (-935.490) (-935.853) * (-935.290) (-941.394) (-941.647) [-938.685] -- 0:00:50
285000 -- (-937.329) (-936.304) (-937.723) [-937.218] * (-935.870) (-942.546) [-936.602] (-936.835) -- 0:00:50
Average standard deviation of split frequencies: 0.010665
285500 -- (-936.030) (-936.421) [-936.846] (-936.853) * (-936.418) (-938.419) (-936.761) [-937.113] -- 0:00:52
286000 -- (-938.216) [-936.437] (-935.985) (-940.167) * (-935.854) (-937.030) [-936.808] (-935.832) -- 0:00:52
286500 -- (-935.939) [-936.308] (-935.177) (-936.030) * (-938.961) (-936.925) [-940.416] (-935.118) -- 0:00:52
287000 -- (-936.126) (-935.227) [-934.909] (-936.035) * (-935.367) [-937.730] (-945.598) (-936.860) -- 0:00:52
287500 -- (-936.130) (-936.768) (-934.807) [-936.988] * [-936.093] (-939.294) (-941.064) (-937.718) -- 0:00:52
288000 -- [-937.559] (-940.275) (-937.133) (-938.537) * (-938.025) (-935.933) (-939.819) [-939.028] -- 0:00:51
288500 -- (-936.785) (-937.679) (-935.998) [-936.780] * [-941.956] (-936.001) (-935.004) (-937.485) -- 0:00:51
289000 -- (-935.103) (-936.195) (-937.927) [-937.831] * (-935.284) (-937.849) (-939.022) [-939.718] -- 0:00:51
289500 -- (-935.190) (-939.670) (-937.597) [-936.163] * [-936.824] (-938.518) (-938.533) (-936.725) -- 0:00:51
290000 -- (-935.178) (-936.870) (-937.727) [-935.017] * (-938.031) (-941.731) (-936.898) [-936.386] -- 0:00:51
Average standard deviation of split frequencies: 0.011623
290500 -- (-935.590) (-937.322) [-935.267] (-935.498) * (-936.045) (-938.453) (-937.264) [-936.583] -- 0:00:51
291000 -- (-937.173) (-935.183) (-936.659) [-935.331] * (-937.880) (-935.300) [-936.950] (-937.360) -- 0:00:51
291500 -- [-936.622] (-936.220) (-937.161) (-935.063) * (-936.621) [-939.460] (-935.723) (-936.823) -- 0:00:51
292000 -- (-936.163) (-937.630) (-936.409) [-936.302] * (-935.823) (-936.123) (-938.314) [-937.022] -- 0:00:50
292500 -- [-937.641] (-938.372) (-935.614) (-941.028) * (-938.206) (-938.707) [-940.047] (-937.360) -- 0:00:50
293000 -- (-935.230) (-935.701) [-936.445] (-938.986) * (-936.722) (-939.459) [-935.856] (-935.435) -- 0:00:50
293500 -- [-937.542] (-935.645) (-935.846) (-940.038) * (-937.098) [-937.613] (-940.200) (-936.570) -- 0:00:50
294000 -- (-936.301) (-935.662) [-935.817] (-938.193) * (-938.917) [-935.878] (-940.621) (-937.600) -- 0:00:50
294500 -- (-936.207) (-935.837) (-937.254) [-936.995] * (-938.686) [-936.117] (-936.054) (-935.549) -- 0:00:50
295000 -- [-937.292] (-936.276) (-935.212) (-938.798) * (-938.698) (-937.551) [-935.122] (-940.485) -- 0:00:50
Average standard deviation of split frequencies: 0.012121
295500 -- [-936.154] (-936.720) (-935.264) (-936.581) * (-937.105) (-936.402) [-935.475] (-936.785) -- 0:00:50
296000 -- (-936.894) (-938.202) [-937.588] (-937.296) * (-939.744) (-938.569) [-936.184] (-937.571) -- 0:00:49
296500 -- (-938.817) (-937.484) (-937.030) [-935.730] * (-937.692) [-941.366] (-936.938) (-936.648) -- 0:00:49
297000 -- [-936.718] (-936.244) (-935.446) (-936.257) * [-936.664] (-941.291) (-939.592) (-936.952) -- 0:00:49
297500 -- [-935.702] (-939.845) (-935.936) (-935.621) * [-942.462] (-938.872) (-938.529) (-936.196) -- 0:00:49
298000 -- (-937.476) (-939.248) [-935.440] (-936.934) * (-937.681) (-938.604) (-934.979) [-938.296] -- 0:00:49
298500 -- [-935.179] (-939.897) (-935.904) (-937.247) * (-940.494) (-942.318) (-938.500) [-937.465] -- 0:00:49
299000 -- [-936.975] (-940.684) (-937.689) (-937.451) * [-936.157] (-936.996) (-937.589) (-948.461) -- 0:00:49
299500 -- (-939.344) (-940.338) [-938.078] (-938.133) * [-936.204] (-936.826) (-939.816) (-936.042) -- 0:00:49
300000 -- [-937.919] (-938.258) (-936.183) (-940.898) * [-936.009] (-936.925) (-936.062) (-936.775) -- 0:00:48
Average standard deviation of split frequencies: 0.012194
300500 -- (-939.200) [-936.169] (-937.691) (-935.769) * (-938.211) (-936.940) (-936.794) [-937.431] -- 0:00:51
301000 -- (-936.675) (-935.120) (-937.655) [-935.734] * (-936.762) (-936.680) [-939.727] (-938.569) -- 0:00:51
301500 -- (-938.622) (-935.323) [-935.893] (-936.710) * (-934.921) (-937.376) (-937.415) [-935.634] -- 0:00:50
302000 -- (-937.398) [-936.285] (-935.760) (-935.752) * (-936.987) [-935.242] (-938.531) (-937.095) -- 0:00:50
302500 -- (-939.252) [-936.368] (-935.451) (-935.692) * (-938.946) (-935.099) (-939.274) [-939.193] -- 0:00:50
303000 -- [-938.477] (-938.402) (-934.709) (-936.763) * [-938.999] (-938.177) (-938.106) (-941.237) -- 0:00:50
303500 -- (-939.577) [-936.281] (-936.396) (-935.655) * (-939.471) [-935.465] (-936.597) (-939.352) -- 0:00:50
304000 -- (-937.607) (-937.339) (-937.256) [-941.253] * (-936.019) (-935.053) [-936.581] (-942.226) -- 0:00:50
304500 -- (-936.902) (-937.580) [-936.437] (-938.641) * (-936.878) (-936.324) [-935.503] (-939.602) -- 0:00:50
305000 -- (-941.383) (-938.907) [-938.453] (-936.930) * (-937.407) (-935.194) (-935.787) [-935.743] -- 0:00:50
Average standard deviation of split frequencies: 0.012752
305500 -- (-939.555) (-938.718) [-937.352] (-936.091) * (-936.754) [-935.113] (-940.534) (-936.466) -- 0:00:50
306000 -- (-940.418) (-938.903) [-936.727] (-936.946) * (-938.196) [-935.160] (-938.010) (-937.518) -- 0:00:49
306500 -- (-935.669) (-941.305) [-935.990] (-935.158) * (-939.699) (-939.040) (-938.493) [-935.841] -- 0:00:49
307000 -- [-937.154] (-938.937) (-935.681) (-937.563) * (-935.665) (-937.350) (-939.582) [-936.871] -- 0:00:49
307500 -- [-935.875] (-938.803) (-935.627) (-938.122) * [-937.829] (-938.091) (-940.731) (-939.766) -- 0:00:49
308000 -- (-936.263) (-937.414) (-935.331) [-938.616] * [-937.902] (-937.362) (-935.520) (-937.281) -- 0:00:49
308500 -- (-941.211) (-940.564) (-936.137) [-936.426] * (-936.538) (-941.180) (-935.820) [-938.817] -- 0:00:49
309000 -- (-937.563) (-941.071) [-941.985] (-939.656) * (-937.219) [-936.629] (-939.610) (-937.940) -- 0:00:49
309500 -- [-935.708] (-938.506) (-938.400) (-939.142) * (-935.669) [-937.914] (-939.860) (-937.477) -- 0:00:49
310000 -- (-939.374) [-935.319] (-937.622) (-941.065) * (-937.763) [-938.097] (-943.733) (-934.738) -- 0:00:48
Average standard deviation of split frequencies: 0.013319
310500 -- (-937.724) [-937.312] (-940.289) (-936.268) * (-937.696) (-938.852) [-938.321] (-935.437) -- 0:00:48
311000 -- (-936.724) (-934.758) [-937.749] (-936.163) * (-939.735) (-941.288) (-938.005) [-936.109] -- 0:00:48
311500 -- (-936.518) [-936.782] (-936.719) (-935.577) * (-936.301) (-936.379) (-937.646) [-936.702] -- 0:00:48
312000 -- (-936.406) (-936.461) [-937.998] (-937.916) * [-939.043] (-935.741) (-937.366) (-936.775) -- 0:00:48
312500 -- (-935.443) (-936.097) [-938.182] (-936.434) * [-936.838] (-939.071) (-938.320) (-937.534) -- 0:00:48
313000 -- (-936.721) (-940.661) (-935.335) [-937.015] * (-938.076) (-941.117) (-936.996) [-935.987] -- 0:00:48
313500 -- (-937.514) (-936.511) (-936.378) [-938.368] * (-936.029) (-937.141) [-937.388] (-936.851) -- 0:00:48
314000 -- (-938.637) (-935.542) [-937.686] (-938.640) * (-936.149) (-935.686) [-937.501] (-939.465) -- 0:00:48
314500 -- (-941.376) [-935.150] (-936.143) (-938.446) * (-937.304) (-936.033) [-936.446] (-940.115) -- 0:00:47
315000 -- [-938.081] (-934.957) (-935.550) (-943.471) * (-939.857) [-936.044] (-938.287) (-941.310) -- 0:00:47
Average standard deviation of split frequencies: 0.013426
315500 -- (-937.521) (-939.482) (-943.655) [-942.916] * [-936.199] (-940.627) (-939.724) (-937.081) -- 0:00:49
316000 -- (-940.115) (-937.280) [-942.647] (-935.544) * [-936.237] (-941.975) (-938.261) (-935.628) -- 0:00:49
316500 -- (-938.481) [-937.403] (-937.136) (-935.349) * (-936.190) (-936.236) (-935.443) [-935.044] -- 0:00:49
317000 -- (-935.399) (-938.374) [-936.808] (-939.211) * (-935.184) (-938.459) (-935.412) [-935.699] -- 0:00:49
317500 -- (-938.205) (-936.826) [-936.551] (-938.633) * (-938.902) [-936.736] (-941.881) (-937.296) -- 0:00:49
318000 -- (-939.827) [-935.205] (-936.410) (-938.344) * (-938.113) [-937.575] (-943.103) (-938.344) -- 0:00:49
318500 -- (-938.256) (-935.528) (-944.618) [-936.401] * (-935.977) [-935.326] (-938.805) (-937.684) -- 0:00:49
319000 -- (-937.523) (-935.721) (-937.321) [-936.317] * (-940.283) (-936.102) (-937.731) [-936.689] -- 0:00:49
319500 -- (-936.841) (-935.581) [-938.101] (-938.160) * [-936.635] (-935.451) (-937.359) (-935.937) -- 0:00:48
320000 -- (-939.332) (-937.004) (-935.939) [-938.360] * (-935.102) (-937.936) [-937.368] (-936.663) -- 0:00:48
Average standard deviation of split frequencies: 0.013721
320500 -- (-939.160) (-941.218) [-938.795] (-936.557) * (-936.460) (-939.733) [-936.581] (-940.643) -- 0:00:48
321000 -- (-939.387) [-938.268] (-936.003) (-935.083) * (-935.479) (-938.422) [-936.170] (-940.939) -- 0:00:48
321500 -- [-937.564] (-935.318) (-937.870) (-937.480) * (-936.045) [-936.429] (-937.778) (-940.466) -- 0:00:48
322000 -- (-935.739) [-937.068] (-937.602) (-936.291) * [-938.160] (-938.135) (-938.613) (-936.557) -- 0:00:48
322500 -- (-936.244) (-939.861) [-936.353] (-935.371) * (-936.036) [-938.132] (-936.990) (-935.431) -- 0:00:48
323000 -- (-936.981) (-937.836) [-935.580] (-936.895) * (-936.572) [-937.159] (-942.326) (-936.453) -- 0:00:48
323500 -- (-935.635) (-935.573) (-934.740) [-936.662] * (-935.827) (-936.845) [-939.347] (-939.759) -- 0:00:48
324000 -- (-940.000) (-939.868) (-935.811) [-935.287] * (-938.413) (-938.140) [-937.282] (-938.656) -- 0:00:47
324500 -- (-937.537) [-937.081] (-936.574) (-936.322) * [-939.084] (-937.083) (-935.225) (-938.186) -- 0:00:47
325000 -- (-939.127) (-937.390) (-935.632) [-936.848] * (-935.372) (-936.393) (-937.138) [-937.145] -- 0:00:47
Average standard deviation of split frequencies: 0.013336
325500 -- (-937.882) [-935.935] (-937.200) (-935.750) * (-936.953) (-936.884) [-937.535] (-937.004) -- 0:00:47
326000 -- (-935.987) (-936.912) (-937.923) [-935.388] * (-937.010) (-937.200) (-939.400) [-937.380] -- 0:00:47
326500 -- (-935.900) [-937.888] (-936.252) (-936.609) * [-937.429] (-937.848) (-939.312) (-941.808) -- 0:00:47
327000 -- (-936.495) [-936.421] (-936.656) (-936.658) * (-936.820) (-937.113) [-942.035] (-937.898) -- 0:00:47
327500 -- [-935.971] (-935.280) (-936.641) (-938.468) * (-937.025) (-937.216) [-938.951] (-940.722) -- 0:00:47
328000 -- [-938.152] (-936.299) (-937.465) (-940.572) * (-935.319) (-935.713) [-934.850] (-937.511) -- 0:00:47
328500 -- (-936.730) (-936.096) (-941.998) [-934.991] * (-937.636) (-935.730) [-936.323] (-935.367) -- 0:00:47
329000 -- [-936.732] (-935.974) (-935.752) (-936.981) * (-937.275) [-935.807] (-936.626) (-938.761) -- 0:00:46
329500 -- (-944.697) [-936.989] (-939.212) (-935.345) * (-937.441) [-937.156] (-935.519) (-941.239) -- 0:00:46
330000 -- (-937.311) [-935.940] (-936.294) (-937.680) * [-937.888] (-938.653) (-936.797) (-937.929) -- 0:00:46
Average standard deviation of split frequencies: 0.013082
330500 -- (-936.101) (-935.109) [-938.071] (-938.159) * (-943.600) [-937.768] (-935.338) (-935.651) -- 0:00:48
331000 -- [-936.774] (-936.529) (-939.406) (-937.379) * (-935.670) (-936.919) (-938.177) [-935.850] -- 0:00:48
331500 -- (-937.191) (-939.704) [-935.781] (-940.305) * [-935.762] (-939.345) (-935.474) (-942.229) -- 0:00:48
332000 -- (-936.909) [-935.142] (-936.632) (-941.031) * (-938.325) [-942.692] (-937.359) (-941.363) -- 0:00:48
332500 -- (-939.625) (-935.734) [-935.839] (-938.201) * (-938.949) [-937.790] (-940.229) (-940.345) -- 0:00:48
333000 -- (-936.829) (-936.414) [-937.862] (-936.458) * (-937.708) (-937.183) (-936.133) [-940.579] -- 0:00:48
333500 -- (-937.260) (-935.744) [-937.076] (-936.581) * (-939.829) [-938.405] (-938.836) (-939.437) -- 0:00:47
334000 -- (-939.406) (-936.128) (-937.049) [-937.899] * (-939.110) (-941.509) (-940.791) [-940.591] -- 0:00:47
334500 -- (-937.033) (-935.770) (-937.933) [-935.341] * (-935.963) (-937.591) (-938.148) [-938.730] -- 0:00:47
335000 -- (-935.576) (-937.613) [-935.592] (-935.685) * (-936.799) [-936.850] (-937.540) (-935.325) -- 0:00:47
Average standard deviation of split frequencies: 0.012544
335500 -- (-936.935) [-938.427] (-935.765) (-935.563) * (-937.724) (-935.812) [-935.490] (-939.384) -- 0:00:47
336000 -- (-936.275) (-937.657) [-935.901] (-935.486) * (-938.899) (-935.232) (-937.611) [-937.564] -- 0:00:47
336500 -- [-937.719] (-936.439) (-936.895) (-935.813) * (-940.253) (-938.351) (-937.127) [-938.634] -- 0:00:47
337000 -- (-937.655) (-935.733) [-937.773] (-939.548) * (-940.185) (-936.643) (-936.927) [-936.968] -- 0:00:47
337500 -- (-940.491) (-936.116) (-938.694) [-939.971] * (-935.471) (-936.077) (-936.990) [-937.256] -- 0:00:47
338000 -- (-939.884) [-937.944] (-937.951) (-935.322) * (-935.114) (-936.683) [-936.879] (-935.968) -- 0:00:47
338500 -- (-940.266) (-941.111) [-936.739] (-937.456) * (-937.912) [-936.098] (-939.799) (-935.241) -- 0:00:46
339000 -- (-937.281) (-937.444) (-936.853) [-935.640] * (-938.162) [-937.315] (-935.391) (-937.171) -- 0:00:46
339500 -- [-937.547] (-938.069) (-935.719) (-936.083) * (-939.151) [-937.020] (-937.313) (-937.478) -- 0:00:46
340000 -- [-938.612] (-940.757) (-937.229) (-942.195) * (-935.368) (-935.914) (-937.312) [-937.429] -- 0:00:46
Average standard deviation of split frequencies: 0.011762
340500 -- (-937.782) [-939.345] (-938.860) (-937.257) * (-938.789) [-940.745] (-936.630) (-935.823) -- 0:00:46
341000 -- [-936.595] (-940.935) (-940.774) (-935.966) * (-937.857) (-938.609) [-938.957] (-934.982) -- 0:00:46
341500 -- (-936.831) [-936.669] (-935.408) (-936.661) * [-936.537] (-936.720) (-940.558) (-938.939) -- 0:00:46
342000 -- (-937.099) [-936.322] (-935.162) (-937.971) * [-936.355] (-935.312) (-935.972) (-938.057) -- 0:00:46
342500 -- [-936.531] (-937.197) (-935.095) (-937.657) * (-937.714) (-936.210) (-935.569) [-936.422] -- 0:00:46
343000 -- [-941.256] (-937.477) (-939.238) (-935.535) * (-936.815) (-937.692) (-935.709) [-936.901] -- 0:00:45
343500 -- (-937.546) (-939.836) [-939.001] (-937.735) * (-940.810) (-939.639) (-936.198) [-936.077] -- 0:00:45
344000 -- (-935.967) (-937.452) (-936.527) [-937.279] * [-939.983] (-936.398) (-939.191) (-935.534) -- 0:00:45
344500 -- (-938.094) (-936.305) (-935.653) [-936.822] * (-940.017) (-937.296) [-937.950] (-937.690) -- 0:00:45
345000 -- [-936.039] (-936.441) (-936.922) (-938.650) * [-937.992] (-940.705) (-935.802) (-936.141) -- 0:00:47
Average standard deviation of split frequencies: 0.011541
345500 -- (-936.542) (-935.907) (-936.492) [-936.463] * (-938.747) [-936.716] (-940.724) (-936.841) -- 0:00:47
346000 -- (-936.753) (-936.241) [-935.341] (-935.596) * (-937.706) [-936.174] (-940.155) (-936.270) -- 0:00:47
346500 -- [-937.087] (-935.600) (-935.756) (-936.555) * [-936.892] (-935.814) (-939.915) (-937.915) -- 0:00:47
347000 -- (-935.671) (-937.885) [-935.453] (-936.198) * (-937.734) (-937.364) (-936.351) [-935.979] -- 0:00:47
347500 -- [-938.984] (-936.335) (-936.170) (-935.843) * (-937.486) [-935.452] (-937.442) (-938.391) -- 0:00:46
348000 -- [-935.827] (-939.929) (-937.246) (-936.512) * (-939.849) (-935.402) (-934.881) [-936.951] -- 0:00:46
348500 -- (-935.488) (-940.335) (-942.867) [-935.428] * (-936.533) [-935.994] (-939.612) (-937.172) -- 0:00:46
349000 -- [-936.309] (-940.920) (-937.327) (-937.252) * (-937.417) (-936.884) [-935.652] (-938.867) -- 0:00:46
349500 -- (-938.681) (-940.624) (-937.956) [-938.975] * (-937.826) [-934.861] (-936.579) (-935.884) -- 0:00:46
350000 -- [-935.472] (-934.983) (-943.963) (-940.460) * (-940.494) [-940.665] (-936.846) (-937.507) -- 0:00:46
Average standard deviation of split frequencies: 0.012969
350500 -- [-938.058] (-936.557) (-938.991) (-936.592) * (-940.520) (-935.972) [-937.219] (-938.120) -- 0:00:46
351000 -- [-935.599] (-936.431) (-936.207) (-936.405) * (-939.638) (-939.790) (-942.983) [-936.804] -- 0:00:46
351500 -- (-937.722) [-936.113] (-936.510) (-936.384) * (-937.059) [-939.631] (-936.323) (-936.553) -- 0:00:46
352000 -- (-936.207) (-936.537) [-936.250] (-935.747) * (-937.961) [-936.739] (-937.868) (-940.065) -- 0:00:46
352500 -- [-936.164] (-936.194) (-938.347) (-935.512) * (-937.445) (-939.286) [-936.801] (-935.752) -- 0:00:45
353000 -- (-935.456) (-939.264) [-936.407] (-935.808) * [-937.377] (-938.288) (-936.414) (-935.683) -- 0:00:45
353500 -- (-936.138) (-937.186) [-935.897] (-935.696) * (-940.317) (-936.857) [-936.186] (-939.775) -- 0:00:45
354000 -- [-936.749] (-940.339) (-937.992) (-935.714) * (-937.356) (-935.472) [-937.222] (-939.834) -- 0:00:45
354500 -- (-937.190) (-941.138) [-936.359] (-938.823) * (-936.764) (-943.875) [-935.554] (-938.341) -- 0:00:45
355000 -- (-936.095) (-939.411) [-935.122] (-939.240) * [-938.249] (-938.587) (-934.816) (-937.743) -- 0:00:45
Average standard deviation of split frequencies: 0.013397
355500 -- (-939.629) (-936.875) [-936.494] (-943.518) * (-937.097) (-936.609) [-935.681] (-937.939) -- 0:00:45
356000 -- (-938.990) [-936.643] (-937.829) (-935.053) * (-936.985) (-938.451) [-935.615] (-937.853) -- 0:00:45
356500 -- (-936.763) (-941.359) (-935.625) [-934.935] * (-936.013) (-938.047) (-936.037) [-937.070] -- 0:00:45
357000 -- (-936.376) (-945.143) (-937.276) [-938.326] * [-935.340] (-936.982) (-936.925) (-938.066) -- 0:00:45
357500 -- [-936.955] (-939.434) (-937.690) (-935.934) * (-935.261) [-940.414] (-938.617) (-939.589) -- 0:00:44
358000 -- [-935.353] (-936.891) (-937.494) (-935.985) * (-936.571) (-936.562) (-935.625) [-938.464] -- 0:00:44
358500 -- [-938.573] (-936.419) (-936.469) (-936.945) * (-936.730) (-946.332) (-940.201) [-936.762] -- 0:00:44
359000 -- (-938.125) [-937.157] (-939.094) (-940.804) * (-937.692) (-936.641) (-935.098) [-936.455] -- 0:00:44
359500 -- (-940.598) [-936.082] (-936.491) (-936.375) * (-939.314) (-935.390) (-935.669) [-935.210] -- 0:00:44
360000 -- (-938.933) [-935.378] (-936.984) (-936.791) * (-936.793) (-938.344) [-935.647] (-935.596) -- 0:00:46
Average standard deviation of split frequencies: 0.012989
360500 -- [-937.267] (-935.614) (-939.647) (-937.666) * (-938.312) (-936.091) [-937.294] (-936.624) -- 0:00:46
361000 -- [-936.633] (-935.931) (-938.883) (-935.607) * (-936.521) (-936.501) [-938.949] (-938.274) -- 0:00:46
361500 -- (-935.115) (-934.986) (-939.269) [-937.216] * [-937.556] (-937.621) (-938.230) (-937.306) -- 0:00:45
362000 -- (-936.121) [-935.963] (-936.078) (-938.158) * (-937.268) (-935.701) [-936.997] (-937.662) -- 0:00:45
362500 -- [-935.902] (-938.132) (-937.306) (-936.798) * (-940.521) [-937.313] (-937.791) (-937.786) -- 0:00:45
363000 -- (-938.136) (-939.375) (-938.046) [-935.264] * (-937.826) (-936.244) (-936.009) [-935.525] -- 0:00:45
363500 -- (-939.570) (-936.672) [-936.914] (-939.384) * (-936.898) (-935.484) (-935.395) [-938.017] -- 0:00:45
364000 -- [-941.418] (-935.921) (-937.415) (-937.950) * (-937.057) (-937.161) (-936.328) [-936.812] -- 0:00:45
364500 -- [-937.208] (-938.190) (-935.220) (-935.783) * (-937.133) (-937.069) (-936.410) [-935.104] -- 0:00:45
365000 -- (-938.029) [-935.043] (-936.330) (-937.291) * (-936.815) (-939.110) (-937.258) [-936.303] -- 0:00:45
Average standard deviation of split frequencies: 0.014092
365500 -- [-935.414] (-935.764) (-936.749) (-938.890) * (-937.398) (-936.620) [-937.258] (-937.113) -- 0:00:45
366000 -- (-936.445) [-935.764] (-938.896) (-936.751) * [-937.414] (-935.265) (-939.330) (-935.309) -- 0:00:45
366500 -- [-936.909] (-938.254) (-938.351) (-936.984) * (-937.241) (-937.332) (-941.701) [-935.367] -- 0:00:44
367000 -- [-936.025] (-935.815) (-939.068) (-936.261) * (-936.392) (-935.519) [-939.266] (-935.681) -- 0:00:44
367500 -- [-937.146] (-937.527) (-937.354) (-936.119) * [-935.224] (-937.686) (-941.310) (-941.287) -- 0:00:44
368000 -- (-937.533) [-934.945] (-936.047) (-938.536) * (-938.407) [-937.798] (-938.177) (-940.748) -- 0:00:44
368500 -- (-938.775) [-934.921] (-935.994) (-936.501) * (-940.855) [-938.954] (-939.117) (-940.813) -- 0:00:44
369000 -- [-937.913] (-936.939) (-936.232) (-937.434) * (-937.333) [-937.590] (-937.162) (-940.132) -- 0:00:44
369500 -- (-936.172) [-937.327] (-936.966) (-940.887) * (-938.714) (-937.897) [-936.381] (-939.807) -- 0:00:44
370000 -- (-937.739) (-939.143) [-938.318] (-937.451) * (-936.548) (-935.773) [-936.780] (-936.250) -- 0:00:44
Average standard deviation of split frequencies: 0.013840
370500 -- (-939.369) (-944.805) (-937.266) [-937.936] * [-935.546] (-936.129) (-936.830) (-939.304) -- 0:00:44
371000 -- (-952.953) (-936.393) [-934.979] (-939.252) * (-939.166) (-938.067) [-936.940] (-937.861) -- 0:00:44
371500 -- [-939.430] (-936.530) (-939.305) (-937.282) * (-940.049) (-936.015) (-936.954) [-938.670] -- 0:00:43
372000 -- (-937.621) (-935.875) (-938.074) [-936.639] * (-938.170) (-936.229) (-936.790) [-942.183] -- 0:00:43
372500 -- (-940.055) (-935.574) (-938.897) [-935.657] * (-938.726) (-936.641) (-937.898) [-937.524] -- 0:00:43
373000 -- (-935.571) (-937.891) (-935.837) [-939.288] * [-937.644] (-936.744) (-937.305) (-935.974) -- 0:00:43
373500 -- [-936.819] (-937.425) (-939.447) (-936.899) * (-939.679) (-936.293) (-937.993) [-935.864] -- 0:00:43
374000 -- (-936.878) (-938.519) (-937.806) [-936.877] * (-939.797) (-939.258) (-938.276) [-934.964] -- 0:00:45
374500 -- (-937.086) (-938.464) (-936.446) [-937.132] * (-937.524) (-936.670) (-938.003) [-935.629] -- 0:00:45
375000 -- (-934.875) (-937.193) [-935.725] (-935.159) * (-937.385) [-936.784] (-939.764) (-936.440) -- 0:00:45
Average standard deviation of split frequencies: 0.014307
375500 -- [-934.862] (-938.546) (-935.143) (-936.573) * (-936.143) (-935.648) [-939.762] (-937.041) -- 0:00:44
376000 -- (-938.274) [-939.141] (-937.061) (-938.747) * (-940.298) (-935.715) (-937.021) [-937.982] -- 0:00:44
376500 -- (-937.533) (-941.490) [-937.263] (-937.671) * [-937.023] (-935.611) (-937.417) (-938.979) -- 0:00:44
377000 -- (-939.926) (-941.401) (-936.734) [-936.657] * (-940.260) (-936.266) [-936.465] (-938.823) -- 0:00:44
377500 -- (-936.038) [-936.339] (-943.127) (-936.509) * (-938.048) (-937.502) (-937.833) [-939.260] -- 0:00:44
378000 -- (-935.785) [-936.001] (-935.915) (-941.399) * (-935.848) [-938.240] (-940.491) (-937.355) -- 0:00:44
378500 -- (-936.143) (-939.976) (-935.248) [-941.800] * (-936.531) (-936.821) (-943.487) [-936.633] -- 0:00:44
379000 -- (-938.459) [-938.379] (-936.042) (-944.490) * (-938.965) (-937.006) (-935.215) [-937.461] -- 0:00:44
379500 -- [-937.345] (-936.932) (-937.880) (-937.564) * (-939.170) (-935.934) [-937.512] (-936.485) -- 0:00:44
380000 -- (-935.632) (-936.601) [-940.333] (-938.775) * (-938.048) (-936.443) [-938.560] (-935.739) -- 0:00:44
Average standard deviation of split frequencies: 0.014423
380500 -- (-937.304) [-940.520] (-937.212) (-938.754) * (-941.029) (-936.255) [-936.634] (-937.143) -- 0:00:43
381000 -- (-936.812) (-938.691) [-935.802] (-939.829) * (-936.847) [-938.573] (-939.226) (-935.888) -- 0:00:43
381500 -- (-935.693) (-939.100) (-938.309) [-936.306] * (-939.140) (-936.793) (-934.940) [-936.339] -- 0:00:43
382000 -- [-938.832] (-940.101) (-937.842) (-935.119) * (-937.650) (-938.008) [-935.864] (-937.274) -- 0:00:43
382500 -- (-937.316) (-942.411) (-936.622) [-937.152] * (-936.897) (-937.194) [-939.333] (-935.770) -- 0:00:43
383000 -- (-940.421) (-937.804) (-935.865) [-936.288] * [-936.382] (-937.159) (-938.489) (-936.339) -- 0:00:43
383500 -- (-939.365) (-939.794) [-936.568] (-938.460) * (-936.670) (-935.678) (-937.726) [-937.809] -- 0:00:43
384000 -- (-936.259) (-937.521) [-937.183] (-936.103) * (-940.082) [-937.459] (-938.708) (-938.210) -- 0:00:43
384500 -- (-936.241) (-935.891) (-941.435) [-935.770] * (-937.406) [-935.767] (-940.844) (-940.573) -- 0:00:43
385000 -- (-936.115) (-937.229) (-936.924) [-935.659] * [-937.845] (-936.056) (-937.673) (-934.791) -- 0:00:43
Average standard deviation of split frequencies: 0.015086
385500 -- (-943.436) (-935.520) [-936.350] (-935.223) * (-938.770) (-937.267) (-936.714) [-934.818] -- 0:00:43
386000 -- [-937.565] (-936.917) (-938.686) (-935.739) * (-936.295) (-936.746) [-937.417] (-934.641) -- 0:00:42
386500 -- (-942.818) (-938.301) [-936.451] (-936.772) * [-936.305] (-936.447) (-938.013) (-935.014) -- 0:00:42
387000 -- (-936.222) (-937.480) [-940.175] (-936.544) * [-936.111] (-936.544) (-937.768) (-935.787) -- 0:00:42
387500 -- (-936.267) (-938.125) [-935.538] (-937.179) * (-937.210) (-937.564) (-937.658) [-936.110] -- 0:00:44
388000 -- (-937.615) [-937.628] (-936.740) (-936.903) * [-936.659] (-936.161) (-939.764) (-938.318) -- 0:00:44
388500 -- (-936.647) (-939.603) [-935.683] (-936.507) * (-937.910) (-935.888) (-936.364) [-937.857] -- 0:00:44
389000 -- (-936.732) (-941.083) [-938.663] (-937.597) * (-937.168) (-935.330) [-939.481] (-937.156) -- 0:00:43
389500 -- [-936.473] (-936.100) (-936.922) (-935.172) * (-939.266) (-935.765) [-935.553] (-936.778) -- 0:00:43
390000 -- (-937.034) (-936.562) (-938.884) [-936.197] * (-936.636) (-940.538) [-935.513] (-935.372) -- 0:00:43
Average standard deviation of split frequencies: 0.015083
390500 -- (-936.264) (-938.222) (-939.343) [-935.425] * (-935.784) [-940.061] (-936.737) (-936.161) -- 0:00:43
391000 -- [-937.044] (-935.688) (-937.180) (-934.828) * (-938.038) (-939.889) [-939.370] (-936.077) -- 0:00:43
391500 -- [-934.671] (-937.114) (-935.828) (-935.441) * (-936.227) [-939.805] (-940.116) (-937.086) -- 0:00:43
392000 -- (-936.195) (-938.654) [-935.511] (-936.044) * (-936.626) (-937.282) (-941.882) [-938.765] -- 0:00:43
392500 -- (-937.313) (-937.158) (-936.772) [-936.622] * (-935.633) [-936.293] (-938.441) (-936.867) -- 0:00:43
393000 -- [-937.294] (-938.324) (-936.881) (-937.693) * [-936.198] (-937.988) (-935.752) (-936.455) -- 0:00:43
393500 -- (-936.656) (-944.822) [-935.239] (-938.187) * [-935.846] (-938.199) (-935.824) (-939.257) -- 0:00:43
394000 -- (-936.854) [-937.123] (-935.469) (-937.760) * (-935.147) (-937.013) [-938.026] (-936.681) -- 0:00:43
394500 -- (-935.800) (-940.440) (-937.113) [-937.788] * (-937.117) [-936.199] (-935.380) (-936.915) -- 0:00:42
395000 -- [-935.081] (-936.586) (-934.975) (-936.105) * [-935.411] (-937.599) (-938.524) (-938.509) -- 0:00:42
Average standard deviation of split frequencies: 0.014434
395500 -- (-936.584) [-934.841] (-939.193) (-937.743) * (-934.852) (-938.241) (-937.112) [-940.252] -- 0:00:42
396000 -- [-937.970] (-936.355) (-936.283) (-939.432) * (-940.001) (-941.849) (-938.998) [-937.432] -- 0:00:42
396500 -- (-943.281) (-936.837) [-935.600] (-937.210) * (-935.805) [-939.994] (-936.112) (-936.515) -- 0:00:42
397000 -- (-935.585) (-937.118) (-935.787) [-935.703] * (-939.927) [-935.307] (-940.824) (-938.027) -- 0:00:42
397500 -- (-938.055) (-937.519) [-936.005] (-936.907) * (-939.602) [-935.259] (-937.282) (-938.028) -- 0:00:42
398000 -- [-937.226] (-937.510) (-939.679) (-935.212) * (-937.218) (-935.734) [-936.144] (-936.274) -- 0:00:42
398500 -- (-938.873) (-935.813) [-936.462] (-936.043) * (-936.905) [-940.490] (-936.441) (-939.060) -- 0:00:42
399000 -- (-935.440) [-936.526] (-938.273) (-938.509) * (-935.914) (-938.735) [-936.355] (-941.471) -- 0:00:42
399500 -- [-937.459] (-934.935) (-936.473) (-937.360) * (-938.380) (-937.305) [-935.128] (-936.673) -- 0:00:42
400000 -- (-938.764) (-936.352) [-936.013] (-935.976) * (-939.844) (-935.513) (-937.556) [-936.628] -- 0:00:41
Average standard deviation of split frequencies: 0.014486
400500 -- [-938.041] (-935.908) (-935.518) (-936.145) * (-938.013) (-935.886) (-935.903) [-937.260] -- 0:00:41
401000 -- (-936.286) (-941.759) (-936.800) [-936.555] * (-937.818) (-936.203) (-938.971) [-936.684] -- 0:00:41
401500 -- (-938.625) (-945.942) [-936.441] (-935.740) * (-940.566) (-938.588) [-937.011] (-943.138) -- 0:00:41
402000 -- (-939.010) [-938.021] (-935.476) (-935.935) * (-937.162) [-937.946] (-938.225) (-940.940) -- 0:00:41
402500 -- (-938.879) (-938.202) [-935.303] (-936.112) * (-937.300) (-937.640) [-936.424] (-938.486) -- 0:00:41
403000 -- [-937.319] (-936.651) (-937.127) (-936.734) * [-937.348] (-937.423) (-941.831) (-941.974) -- 0:00:42
403500 -- [-939.662] (-935.149) (-938.560) (-939.461) * [-939.167] (-938.191) (-938.227) (-937.901) -- 0:00:42
404000 -- (-935.846) [-936.322] (-942.662) (-938.498) * (-938.815) (-939.055) [-938.293] (-937.608) -- 0:00:42
404500 -- (-938.900) (-937.300) [-940.400] (-936.413) * [-936.347] (-936.989) (-937.374) (-935.264) -- 0:00:42
405000 -- [-937.796] (-938.522) (-938.783) (-936.353) * (-937.165) [-939.408] (-936.545) (-936.512) -- 0:00:42
Average standard deviation of split frequencies: 0.014256
405500 -- (-938.629) [-935.459] (-935.779) (-937.504) * [-936.550] (-937.187) (-935.748) (-937.308) -- 0:00:42
406000 -- [-936.683] (-936.078) (-936.168) (-939.006) * (-936.114) [-937.230] (-936.113) (-936.780) -- 0:00:42
406500 -- (-938.230) (-935.927) (-935.883) [-935.338] * (-935.866) (-936.188) [-937.462] (-935.877) -- 0:00:42
407000 -- (-938.076) (-939.869) [-935.609] (-935.464) * [-937.466] (-937.666) (-935.440) (-938.524) -- 0:00:42
407500 -- (-937.940) (-937.451) [-936.168] (-936.731) * (-936.792) (-939.766) [-935.665] (-940.014) -- 0:00:42
408000 -- [-937.076] (-936.024) (-935.780) (-936.021) * (-935.620) (-939.785) [-935.708] (-936.421) -- 0:00:42
408500 -- [-937.540] (-936.735) (-936.009) (-935.970) * (-936.318) [-935.692] (-937.947) (-937.084) -- 0:00:41
409000 -- (-937.704) [-938.603] (-935.768) (-939.264) * (-936.260) (-937.312) [-939.550] (-937.237) -- 0:00:41
409500 -- (-938.893) (-937.374) [-936.252] (-940.393) * (-939.318) [-937.285] (-935.778) (-937.323) -- 0:00:41
410000 -- [-936.859] (-940.565) (-935.853) (-945.633) * (-936.683) (-935.195) (-940.272) [-937.748] -- 0:00:41
Average standard deviation of split frequencies: 0.013520
410500 -- (-936.807) (-940.193) (-937.046) [-940.106] * (-935.151) [-935.541] (-940.181) (-936.237) -- 0:00:41
411000 -- (-934.861) (-936.977) (-941.061) [-940.017] * [-937.274] (-935.637) (-938.659) (-937.616) -- 0:00:41
411500 -- [-935.403] (-937.768) (-940.142) (-936.587) * (-947.751) (-936.680) (-940.399) [-936.081] -- 0:00:41
412000 -- (-936.354) (-935.804) [-936.172] (-936.903) * [-939.809] (-934.832) (-938.722) (-937.862) -- 0:00:41
412500 -- (-936.953) [-939.124] (-938.105) (-935.930) * (-938.227) (-935.409) [-935.259] (-936.607) -- 0:00:41
413000 -- (-934.908) (-937.819) (-938.931) [-937.695] * [-936.486] (-936.470) (-936.258) (-936.449) -- 0:00:41
413500 -- (-935.358) (-938.724) [-936.388] (-937.497) * (-935.587) (-936.053) [-936.281] (-935.558) -- 0:00:41
414000 -- (-935.464) [-936.438] (-935.232) (-935.683) * (-947.283) [-937.051] (-938.558) (-937.229) -- 0:00:41
414500 -- [-936.113] (-936.990) (-938.572) (-937.305) * (-943.360) [-935.626] (-939.332) (-936.948) -- 0:00:40
415000 -- (-935.194) (-937.904) [-938.267] (-938.160) * (-944.264) [-935.239] (-938.665) (-935.882) -- 0:00:40
Average standard deviation of split frequencies: 0.013724
415500 -- [-937.844] (-937.370) (-936.249) (-936.922) * [-935.552] (-935.871) (-938.000) (-936.963) -- 0:00:40
416000 -- (-938.967) [-939.736] (-936.788) (-938.007) * [-935.502] (-935.769) (-936.475) (-937.209) -- 0:00:40
416500 -- [-936.129] (-941.117) (-937.069) (-937.566) * (-935.792) (-935.857) [-941.678] (-937.300) -- 0:00:40
417000 -- (-935.473) (-938.579) [-938.021] (-936.440) * [-936.448] (-936.489) (-941.350) (-936.382) -- 0:00:41
417500 -- (-936.896) (-935.739) (-936.644) [-937.111] * (-936.003) [-937.290] (-942.975) (-936.592) -- 0:00:41
418000 -- (-936.866) (-936.188) [-935.897] (-940.401) * (-935.794) (-936.965) (-938.727) [-939.535] -- 0:00:41
418500 -- (-937.299) (-935.702) [-940.147] (-940.379) * [-939.872] (-936.839) (-939.470) (-935.160) -- 0:00:41
419000 -- (-941.151) (-937.867) [-936.750] (-938.701) * (-938.421) (-937.828) [-937.489] (-941.802) -- 0:00:41
419500 -- (-935.728) [-936.247] (-936.162) (-936.862) * (-938.373) (-935.968) [-938.471] (-937.332) -- 0:00:41
420000 -- [-937.424] (-938.763) (-936.172) (-937.686) * [-936.343] (-936.529) (-941.810) (-935.604) -- 0:00:41
Average standard deviation of split frequencies: 0.012722
420500 -- (-938.579) (-943.198) [-938.275] (-937.390) * (-934.917) (-937.281) (-935.759) [-937.007] -- 0:00:41
421000 -- (-942.801) [-939.086] (-940.286) (-936.941) * (-935.829) [-937.748] (-944.796) (-937.507) -- 0:00:41
421500 -- (-941.128) (-938.614) (-937.664) [-937.451] * (-936.784) [-935.220] (-937.771) (-938.868) -- 0:00:41
422000 -- (-942.122) (-938.456) [-937.738] (-937.973) * (-938.090) [-936.037] (-936.312) (-938.161) -- 0:00:41
422500 -- (-938.215) (-938.119) [-937.804] (-936.280) * [-936.809] (-941.337) (-936.970) (-937.157) -- 0:00:41
423000 -- (-939.860) [-935.274] (-942.814) (-938.481) * [-935.755] (-936.941) (-938.170) (-936.034) -- 0:00:40
423500 -- (-941.001) (-936.976) [-937.061] (-935.945) * (-937.181) (-936.315) [-936.288] (-938.580) -- 0:00:40
424000 -- [-937.472] (-936.212) (-940.347) (-938.395) * (-937.127) (-940.747) [-938.143] (-937.544) -- 0:00:40
424500 -- (-936.054) [-938.316] (-940.981) (-937.982) * (-937.895) [-935.784] (-937.806) (-937.962) -- 0:00:40
425000 -- [-937.617] (-935.816) (-937.324) (-939.829) * (-940.168) (-935.968) (-935.983) [-937.108] -- 0:00:40
Average standard deviation of split frequencies: 0.013648
425500 -- (-940.177) (-936.990) (-940.785) [-937.178] * (-943.077) (-936.128) [-935.539] (-935.433) -- 0:00:40
426000 -- (-941.117) [-937.075] (-942.472) (-935.060) * (-938.918) (-941.439) (-938.371) [-937.475] -- 0:00:40
426500 -- (-938.570) (-941.642) [-936.802] (-935.966) * (-937.257) [-937.248] (-938.313) (-937.999) -- 0:00:40
427000 -- (-936.000) (-936.334) [-937.540] (-936.667) * (-935.365) (-937.397) [-935.977] (-938.234) -- 0:00:40
427500 -- (-937.349) (-936.091) [-938.071] (-937.566) * (-937.091) (-935.530) (-935.444) [-938.778] -- 0:00:40
428000 -- (-940.768) (-939.589) [-936.053] (-944.639) * [-939.919] (-935.705) (-936.111) (-939.471) -- 0:00:40
428500 -- (-935.859) (-939.009) [-935.665] (-940.472) * (-938.354) (-938.510) (-940.519) [-935.454] -- 0:00:40
429000 -- [-938.085] (-935.479) (-937.444) (-937.154) * (-936.412) (-935.220) (-936.793) [-937.547] -- 0:00:39
429500 -- [-935.857] (-935.615) (-936.336) (-938.361) * (-936.916) (-937.336) (-936.147) [-936.723] -- 0:00:39
430000 -- (-935.722) (-936.843) (-937.698) [-936.483] * (-938.187) (-936.288) [-936.252] (-937.468) -- 0:00:39
Average standard deviation of split frequencies: 0.013586
430500 -- (-936.132) (-938.989) (-938.148) [-938.171] * (-937.697) [-937.332] (-936.966) (-936.228) -- 0:00:41
431000 -- [-937.571] (-937.255) (-938.482) (-935.646) * (-935.938) (-938.635) [-935.407] (-937.681) -- 0:00:40
431500 -- (-936.226) (-937.071) [-935.207] (-939.218) * [-937.506] (-936.608) (-936.764) (-937.399) -- 0:00:40
432000 -- (-935.201) [-938.009] (-935.988) (-935.730) * (-936.445) (-936.319) [-937.627] (-936.320) -- 0:00:40
432500 -- (-936.762) (-938.163) (-938.215) [-939.134] * (-936.155) (-936.961) [-936.397] (-937.853) -- 0:00:40
433000 -- (-936.106) (-938.272) [-938.516] (-939.485) * (-938.449) (-935.429) [-938.886] (-936.815) -- 0:00:40
433500 -- (-935.677) (-935.375) (-936.966) [-940.209] * (-937.092) (-937.812) [-937.208] (-936.822) -- 0:00:40
434000 -- (-934.757) (-935.950) (-939.526) [-939.075] * (-936.069) [-935.541] (-935.771) (-937.208) -- 0:00:40
434500 -- (-937.319) (-938.601) (-939.534) [-937.929] * (-935.524) (-936.911) (-938.159) [-935.987] -- 0:00:40
435000 -- [-936.294] (-936.474) (-941.726) (-938.113) * [-936.891] (-936.934) (-937.128) (-935.300) -- 0:00:40
Average standard deviation of split frequencies: 0.014119
435500 -- (-936.201) (-940.373) [-942.873] (-938.038) * (-935.713) (-936.559) (-936.751) [-934.992] -- 0:00:40
436000 -- (-935.588) (-937.767) (-938.186) [-936.744] * (-937.214) (-936.363) [-936.395] (-935.891) -- 0:00:40
436500 -- (-939.301) (-935.236) (-937.385) [-936.331] * (-938.808) (-937.028) [-936.847] (-936.813) -- 0:00:40
437000 -- (-938.572) (-935.851) [-937.323] (-936.347) * (-935.478) (-936.221) (-937.092) [-941.871] -- 0:00:39
437500 -- (-936.342) (-936.626) (-936.152) [-935.452] * [-938.454] (-936.607) (-937.678) (-939.911) -- 0:00:39
438000 -- (-935.479) (-937.780) [-935.469] (-937.194) * (-936.097) (-935.921) (-939.684) [-936.515] -- 0:00:39
438500 -- [-936.206] (-935.884) (-937.559) (-937.337) * (-935.469) [-938.555] (-935.291) (-937.626) -- 0:00:39
439000 -- (-935.993) [-935.951] (-940.222) (-935.082) * (-935.939) [-935.308] (-935.747) (-934.926) -- 0:00:39
439500 -- (-937.248) (-937.344) (-937.167) [-937.376] * (-936.264) (-937.970) (-938.862) [-935.166] -- 0:00:39
440000 -- [-935.631] (-940.879) (-935.162) (-937.180) * (-938.333) (-935.912) [-935.823] (-935.912) -- 0:00:39
Average standard deviation of split frequencies: 0.013372
440500 -- (-935.869) (-937.032) (-935.634) [-936.661] * (-936.053) (-938.609) [-936.072] (-937.643) -- 0:00:39
441000 -- [-934.978] (-934.945) (-937.077) (-936.527) * (-936.115) (-936.486) (-934.946) [-935.058] -- 0:00:39
441500 -- (-936.272) (-935.651) (-938.091) [-935.719] * (-936.823) (-935.591) [-935.572] (-940.848) -- 0:00:39
442000 -- (-936.182) (-936.723) (-936.509) [-935.587] * (-936.587) [-937.538] (-935.244) (-935.740) -- 0:00:39
442500 -- [-940.289] (-936.375) (-935.524) (-935.572) * (-935.354) (-936.538) [-938.316] (-935.641) -- 0:00:39
443000 -- [-937.609] (-936.108) (-937.158) (-935.317) * (-938.578) (-937.090) [-938.378] (-935.838) -- 0:00:38
443500 -- (-937.284) (-936.106) [-935.115] (-936.305) * [-936.591] (-935.582) (-942.672) (-935.760) -- 0:00:38
444000 -- [-937.870] (-935.479) (-935.767) (-940.287) * (-935.512) (-935.491) [-941.491] (-935.187) -- 0:00:38
444500 -- (-939.974) (-936.540) (-935.487) [-936.953] * [-936.768] (-935.735) (-936.847) (-935.454) -- 0:00:38
445000 -- [-936.258] (-934.904) (-935.160) (-942.745) * (-936.297) [-935.858] (-935.449) (-937.908) -- 0:00:38
Average standard deviation of split frequencies: 0.012870
445500 -- (-939.563) [-937.911] (-935.111) (-938.696) * (-936.593) [-935.333] (-939.003) (-940.292) -- 0:00:39
446000 -- (-937.262) (-938.667) [-938.541] (-937.371) * (-935.960) (-936.936) [-938.652] (-935.258) -- 0:00:39
446500 -- [-936.145] (-936.254) (-938.786) (-937.017) * [-938.463] (-936.912) (-936.649) (-937.144) -- 0:00:39
447000 -- (-944.352) [-936.469] (-937.517) (-939.531) * (-940.918) (-939.096) [-934.951] (-937.723) -- 0:00:39
447500 -- (-943.311) [-935.623] (-936.682) (-938.206) * (-940.362) (-941.446) [-935.444] (-936.760) -- 0:00:39
448000 -- (-939.329) (-938.867) [-936.150] (-938.284) * (-935.341) [-944.199] (-937.915) (-940.542) -- 0:00:39
448500 -- (-942.584) (-937.380) [-935.810] (-938.328) * (-936.951) [-936.638] (-935.655) (-937.989) -- 0:00:39
449000 -- (-936.641) (-937.656) [-939.403] (-936.363) * (-935.905) (-936.666) (-935.548) [-936.263] -- 0:00:39
449500 -- (-936.715) (-938.116) [-935.095] (-936.340) * (-942.024) (-935.190) (-937.068) [-935.063] -- 0:00:39
450000 -- (-936.519) [-938.015] (-938.504) (-937.259) * [-936.140] (-936.256) (-935.479) (-942.034) -- 0:00:39
Average standard deviation of split frequencies: 0.013044
450500 -- (-936.535) (-938.146) (-936.806) [-936.435] * (-937.883) (-936.877) [-938.134] (-935.898) -- 0:00:39
451000 -- (-936.962) [-935.175] (-937.891) (-935.523) * (-939.125) (-938.766) [-935.819] (-938.139) -- 0:00:38
451500 -- (-934.913) [-936.813] (-936.457) (-935.524) * (-938.536) (-939.640) (-940.835) [-937.824] -- 0:00:38
452000 -- [-938.230] (-935.912) (-940.156) (-938.867) * (-939.164) [-936.917] (-937.981) (-936.429) -- 0:00:38
452500 -- (-942.275) [-935.788] (-938.944) (-936.184) * (-935.934) [-936.097] (-936.310) (-938.080) -- 0:00:38
453000 -- [-936.918] (-941.890) (-936.120) (-936.213) * (-935.903) (-937.151) [-937.316] (-937.495) -- 0:00:38
453500 -- (-938.852) (-939.541) (-935.358) [-939.018] * [-938.367] (-937.173) (-936.832) (-938.286) -- 0:00:38
454000 -- (-938.163) [-935.268] (-935.150) (-937.001) * (-935.983) (-937.247) [-937.028] (-938.164) -- 0:00:38
454500 -- (-938.901) (-938.198) [-936.032] (-937.191) * (-939.922) (-937.786) (-935.265) [-940.090] -- 0:00:38
455000 -- (-937.523) (-940.684) (-937.056) [-941.410] * (-943.088) (-936.884) [-938.807] (-939.220) -- 0:00:38
Average standard deviation of split frequencies: 0.012466
455500 -- [-934.943] (-937.003) (-937.719) (-938.520) * (-939.386) [-935.359] (-940.400) (-936.633) -- 0:00:38
456000 -- (-934.956) (-935.637) (-936.956) [-937.413] * (-936.819) [-935.317] (-944.271) (-937.506) -- 0:00:38
456500 -- (-935.837) (-935.706) (-936.815) [-936.648] * (-936.571) (-936.015) [-936.878] (-936.252) -- 0:00:38
457000 -- (-937.407) (-937.641) [-937.091] (-938.427) * (-937.962) (-936.284) [-937.625] (-939.507) -- 0:00:38
457500 -- [-937.979] (-940.407) (-937.703) (-935.680) * [-936.659] (-937.695) (-935.723) (-937.535) -- 0:00:37
458000 -- (-938.313) (-935.354) (-937.677) [-935.901] * [-937.032] (-937.325) (-938.383) (-941.742) -- 0:00:37
458500 -- (-936.701) (-937.786) [-936.427] (-935.294) * (-937.357) (-936.842) (-935.361) [-935.532] -- 0:00:37
459000 -- (-935.614) (-938.652) [-936.866] (-934.889) * [-939.632] (-936.207) (-936.196) (-935.852) -- 0:00:37
459500 -- [-935.737] (-945.684) (-935.150) (-935.531) * (-935.348) (-938.163) (-939.335) [-939.351] -- 0:00:37
460000 -- (-939.527) [-941.161] (-936.863) (-936.171) * (-940.384) (-936.434) [-939.115] (-937.471) -- 0:00:37
Average standard deviation of split frequencies: 0.012701
460500 -- [-936.119] (-936.508) (-937.045) (-937.256) * (-938.806) [-936.265] (-935.821) (-935.983) -- 0:00:37
461000 -- (-936.946) [-937.981] (-941.510) (-937.123) * (-937.307) (-936.260) [-938.016] (-937.120) -- 0:00:38
461500 -- [-938.858] (-934.967) (-936.440) (-936.259) * [-940.393] (-936.065) (-934.831) (-938.466) -- 0:00:38
462000 -- (-936.687) (-934.939) [-938.010] (-936.181) * (-938.600) (-936.882) (-937.533) [-938.225] -- 0:00:38
462500 -- (-935.766) [-935.166] (-939.260) (-937.817) * (-937.828) (-936.472) (-935.495) [-936.689] -- 0:00:38
463000 -- (-935.693) (-935.820) (-936.487) [-938.755] * (-935.870) [-937.576] (-935.281) (-935.487) -- 0:00:38
463500 -- (-937.970) [-935.772] (-936.461) (-940.827) * (-935.542) [-939.895] (-935.857) (-935.788) -- 0:00:38
464000 -- (-936.911) [-937.796] (-943.432) (-939.632) * [-936.139] (-946.891) (-935.683) (-936.375) -- 0:00:38
464500 -- (-937.186) (-937.468) [-936.205] (-938.383) * (-937.194) (-937.869) (-935.458) [-934.989] -- 0:00:38
465000 -- (-936.724) (-936.936) [-937.127] (-939.604) * (-938.873) (-937.044) [-936.476] (-936.216) -- 0:00:37
Average standard deviation of split frequencies: 0.012645
465500 -- (-939.847) (-935.446) (-937.143) [-937.337] * (-939.247) [-936.315] (-937.329) (-935.380) -- 0:00:37
466000 -- (-939.438) (-937.705) (-938.421) [-936.798] * (-935.061) [-937.589] (-936.501) (-937.269) -- 0:00:37
466500 -- [-936.052] (-937.456) (-937.824) (-936.507) * [-937.205] (-936.945) (-939.498) (-939.411) -- 0:00:37
467000 -- (-937.465) [-935.340] (-936.755) (-937.501) * (-934.910) [-939.325] (-937.678) (-936.945) -- 0:00:37
467500 -- [-937.095] (-936.332) (-936.626) (-937.549) * [-935.498] (-935.488) (-935.140) (-937.322) -- 0:00:37
468000 -- (-936.400) (-936.018) (-936.938) [-937.614] * [-934.561] (-935.772) (-935.653) (-936.962) -- 0:00:37
468500 -- [-937.317] (-935.201) (-940.659) (-939.405) * (-935.303) (-939.185) (-936.529) [-937.766] -- 0:00:37
469000 -- (-936.744) [-935.133] (-936.855) (-936.853) * (-935.428) (-938.745) (-937.581) [-935.972] -- 0:00:37
469500 -- (-938.437) [-935.313] (-935.736) (-937.376) * (-934.931) (-940.209) [-936.413] (-936.927) -- 0:00:37
470000 -- (-938.233) (-936.426) [-936.118] (-936.428) * [-936.214] (-941.335) (-937.624) (-938.236) -- 0:00:37
Average standard deviation of split frequencies: 0.012909
470500 -- (-937.629) (-934.937) (-940.859) [-936.792] * [-938.102] (-935.743) (-938.466) (-936.275) -- 0:00:37
471000 -- [-936.283] (-935.014) (-939.796) (-936.311) * [-935.771] (-936.739) (-938.027) (-937.400) -- 0:00:37
471500 -- (-935.947) (-935.977) [-937.570] (-937.845) * (-939.609) (-938.541) (-942.284) [-939.297] -- 0:00:36
472000 -- (-937.044) [-938.500] (-937.428) (-937.152) * (-936.372) [-935.708] (-939.405) (-935.830) -- 0:00:36
472500 -- (-936.617) (-934.868) [-936.699] (-936.965) * [-936.789] (-936.536) (-937.296) (-938.467) -- 0:00:36
473000 -- (-936.035) [-938.381] (-935.941) (-937.372) * [-937.639] (-936.667) (-936.941) (-936.655) -- 0:00:36
473500 -- (-936.331) (-939.512) (-935.910) [-937.578] * (-936.083) (-937.014) [-936.387] (-944.167) -- 0:00:36
474000 -- (-935.742) [-935.032] (-936.918) (-937.664) * (-942.786) [-938.219] (-935.931) (-939.570) -- 0:00:36
474500 -- [-934.681] (-939.924) (-936.997) (-936.367) * (-937.325) (-936.114) (-936.523) [-936.052] -- 0:00:36
475000 -- (-936.960) (-936.932) (-937.910) [-935.428] * (-935.822) (-938.363) [-938.077] (-938.478) -- 0:00:37
Average standard deviation of split frequencies: 0.012525
475500 -- (-937.582) [-935.863] (-937.100) (-935.266) * [-936.671] (-938.732) (-936.296) (-938.394) -- 0:00:37
476000 -- (-938.781) [-936.001] (-938.114) (-938.255) * [-935.109] (-938.522) (-937.177) (-940.699) -- 0:00:37
476500 -- (-939.966) [-936.956] (-940.001) (-937.188) * (-939.197) (-939.681) [-937.514] (-935.160) -- 0:00:37
477000 -- (-938.157) (-936.822) [-937.658] (-938.886) * (-934.947) (-936.372) (-939.749) [-934.953] -- 0:00:37
477500 -- (-939.450) (-936.447) (-936.209) [-937.910] * (-943.041) [-940.778] (-940.515) (-935.824) -- 0:00:37
478000 -- (-939.034) (-936.667) (-937.646) [-936.917] * (-939.492) [-935.667] (-940.613) (-937.944) -- 0:00:37
478500 -- [-938.443] (-938.292) (-939.027) (-937.564) * [-939.099] (-935.278) (-939.399) (-939.410) -- 0:00:37
479000 -- [-936.635] (-935.698) (-939.189) (-938.103) * (-940.125) (-936.064) [-939.366] (-937.887) -- 0:00:36
479500 -- (-934.853) (-935.324) [-935.708] (-936.647) * (-936.352) [-935.897] (-937.006) (-936.529) -- 0:00:36
480000 -- (-936.135) (-935.594) [-935.706] (-936.520) * (-939.405) (-941.027) (-939.568) [-937.336] -- 0:00:36
Average standard deviation of split frequencies: 0.012576
480500 -- (-936.250) (-936.656) (-939.680) [-936.298] * (-937.302) (-938.510) [-936.528] (-937.135) -- 0:00:36
481000 -- (-935.068) (-939.559) (-938.242) [-936.300] * (-936.448) [-937.071] (-935.662) (-936.223) -- 0:00:36
481500 -- [-940.881] (-938.371) (-937.211) (-938.987) * (-937.749) (-937.377) [-937.163] (-936.343) -- 0:00:36
482000 -- [-940.626] (-938.662) (-937.820) (-936.451) * (-937.389) (-938.920) [-936.080] (-936.340) -- 0:00:36
482500 -- (-940.186) (-936.600) [-940.348] (-935.618) * (-938.494) (-937.865) (-935.131) [-940.118] -- 0:00:36
483000 -- (-936.810) [-935.015] (-936.462) (-935.789) * (-935.393) [-937.967] (-934.855) (-935.088) -- 0:00:36
483500 -- [-936.124] (-936.088) (-937.785) (-935.670) * (-935.810) (-937.247) (-935.979) [-934.968] -- 0:00:36
484000 -- (-936.647) (-939.882) [-936.770] (-939.814) * (-937.842) (-936.899) [-935.590] (-935.612) -- 0:00:36
484500 -- (-941.741) [-935.178] (-938.168) (-936.149) * (-937.262) (-936.075) [-935.919] (-939.020) -- 0:00:36
485000 -- (-940.017) [-936.087] (-937.141) (-936.445) * [-937.473] (-937.999) (-938.624) (-936.569) -- 0:00:36
Average standard deviation of split frequencies: 0.012781
485500 -- (-939.085) (-936.487) [-937.076] (-940.580) * (-938.216) [-937.184] (-936.429) (-934.975) -- 0:00:36
486000 -- (-938.953) (-939.665) (-935.043) [-941.724] * (-938.739) [-938.363] (-938.228) (-936.265) -- 0:00:35
486500 -- (-937.133) (-937.176) [-936.041] (-936.835) * (-940.284) (-936.624) (-938.357) [-936.516] -- 0:00:35
487000 -- (-938.942) [-937.561] (-938.498) (-936.254) * (-937.893) [-938.069] (-936.815) (-940.885) -- 0:00:35
487500 -- [-937.691] (-938.412) (-938.110) (-937.996) * [-937.604] (-941.907) (-936.923) (-935.923) -- 0:00:35
488000 -- (-936.335) (-937.690) (-939.600) [-940.297] * (-937.711) (-937.011) [-936.967] (-935.654) -- 0:00:35
488500 -- (-935.820) (-935.201) [-934.743] (-941.235) * (-940.840) (-936.916) (-935.574) [-935.388] -- 0:00:35
489000 -- [-935.938] (-935.643) (-937.796) (-935.416) * (-939.947) (-937.106) [-935.139] (-936.556) -- 0:00:35
489500 -- [-937.525] (-940.181) (-935.777) (-942.662) * (-936.634) [-936.086] (-936.982) (-935.746) -- 0:00:35
490000 -- [-935.982] (-937.999) (-935.918) (-937.009) * (-936.348) (-937.164) (-934.783) [-934.986] -- 0:00:36
Average standard deviation of split frequencies: 0.012433
490500 -- (-938.119) (-938.850) (-936.452) [-938.945] * (-935.657) (-935.874) (-940.143) [-935.501] -- 0:00:36
491000 -- (-939.020) (-939.079) (-935.334) [-937.169] * [-935.758] (-935.377) (-937.279) (-936.750) -- 0:00:36
491500 -- (-935.616) [-939.818] (-936.533) (-938.267) * [-936.485] (-935.446) (-937.256) (-937.448) -- 0:00:36
492000 -- (-935.651) (-937.113) (-935.991) [-939.756] * (-937.125) (-935.665) [-937.373] (-938.954) -- 0:00:36
492500 -- (-936.013) (-935.713) [-937.066] (-935.032) * (-935.261) (-936.317) (-935.672) [-937.199] -- 0:00:36
493000 -- (-936.648) (-939.054) (-938.456) [-934.799] * [-935.592] (-937.308) (-938.535) (-935.229) -- 0:00:35
493500 -- (-942.371) (-938.814) (-938.580) [-934.870] * (-936.843) (-937.150) [-939.372] (-939.329) -- 0:00:35
494000 -- (-936.580) (-938.189) [-939.002] (-936.759) * (-940.439) (-937.832) [-938.885] (-936.210) -- 0:00:35
494500 -- (-936.714) (-937.598) [-937.409] (-935.998) * (-939.600) (-938.313) (-936.821) [-937.937] -- 0:00:35
495000 -- (-935.927) [-937.457] (-937.373) (-936.202) * (-937.327) [-939.461] (-937.977) (-940.492) -- 0:00:35
Average standard deviation of split frequencies: 0.012523
495500 -- (-937.272) (-938.850) (-937.895) [-936.034] * [-935.785] (-938.110) (-936.954) (-939.563) -- 0:00:35
496000 -- [-937.956] (-938.477) (-937.324) (-938.122) * [-935.641] (-937.506) (-935.599) (-939.275) -- 0:00:35
496500 -- (-936.148) (-942.158) [-938.414] (-935.018) * (-934.704) (-939.718) [-935.175] (-936.984) -- 0:00:35
497000 -- (-936.479) (-940.065) (-936.062) [-936.844] * (-936.494) (-935.552) [-935.194] (-938.983) -- 0:00:35
497500 -- (-938.306) [-939.721] (-936.866) (-937.433) * [-939.017] (-934.719) (-935.655) (-942.861) -- 0:00:35
498000 -- (-937.209) [-937.550] (-936.916) (-936.131) * (-936.498) (-935.364) (-936.696) [-938.799] -- 0:00:35
498500 -- (-935.189) (-935.301) (-940.591) [-936.539] * (-938.693) (-938.770) [-937.216] (-935.629) -- 0:00:35
499000 -- [-935.477] (-935.497) (-939.647) (-936.522) * (-938.684) (-936.309) (-936.484) [-935.001] -- 0:00:35
499500 -- (-937.371) (-939.428) [-938.173] (-936.380) * [-935.348] (-939.526) (-938.134) (-936.075) -- 0:00:35
500000 -- (-935.749) (-936.256) [-935.790] (-938.399) * (-937.756) (-939.174) [-937.096] (-938.641) -- 0:00:35
Average standard deviation of split frequencies: 0.012683
500500 -- (-936.576) (-936.044) [-937.075] (-937.559) * [-936.421] (-937.095) (-940.286) (-937.530) -- 0:00:34
501000 -- (-937.653) (-935.192) (-937.108) [-937.259] * (-938.284) [-935.800] (-943.682) (-938.247) -- 0:00:34
501500 -- [-940.034] (-934.935) (-935.455) (-936.426) * (-936.645) (-939.254) [-940.840] (-937.134) -- 0:00:34
502000 -- (-939.121) [-935.625] (-935.228) (-936.662) * (-937.226) (-937.631) (-939.193) [-936.247] -- 0:00:34
502500 -- (-943.067) (-935.068) [-935.414] (-939.235) * (-938.584) (-940.785) (-940.369) [-939.082] -- 0:00:34
503000 -- [-940.846] (-936.309) (-936.405) (-938.842) * [-937.424] (-936.010) (-940.545) (-935.846) -- 0:00:34
503500 -- (-935.866) (-937.066) (-937.018) [-936.056] * (-940.295) (-936.243) (-936.876) [-937.875] -- 0:00:34
504000 -- [-937.026] (-937.986) (-937.711) (-938.363) * [-937.069] (-936.224) (-936.786) (-936.043) -- 0:00:34
504500 -- (-939.598) [-936.587] (-941.447) (-937.504) * (-936.139) (-936.213) (-936.268) [-935.745] -- 0:00:35
505000 -- (-938.900) [-936.524] (-938.023) (-937.613) * [-935.483] (-936.560) (-935.641) (-935.541) -- 0:00:35
Average standard deviation of split frequencies: 0.013098
505500 -- (-935.585) [-936.831] (-937.912) (-940.410) * (-939.070) (-936.507) [-938.111] (-936.211) -- 0:00:35
506000 -- (-938.451) (-937.953) (-937.948) [-936.155] * [-936.113] (-935.299) (-937.181) (-938.212) -- 0:00:35
506500 -- (-936.468) (-938.273) [-937.015] (-936.348) * [-936.527] (-935.207) (-935.424) (-939.245) -- 0:00:35
507000 -- (-936.079) (-937.766) (-937.390) [-940.160] * [-938.119] (-936.325) (-938.383) (-937.073) -- 0:00:35
507500 -- (-940.279) (-938.816) (-940.817) [-935.326] * [-935.253] (-935.231) (-937.290) (-942.248) -- 0:00:34
508000 -- (-941.399) (-938.484) [-934.957] (-939.888) * [-936.307] (-935.546) (-938.212) (-934.815) -- 0:00:34
508500 -- (-936.650) [-935.757] (-937.499) (-937.554) * (-937.303) (-935.937) [-938.497] (-937.474) -- 0:00:34
509000 -- (-938.787) (-937.836) [-934.928] (-939.958) * (-937.039) [-937.745] (-935.898) (-936.512) -- 0:00:34
509500 -- (-936.652) (-936.259) [-935.262] (-938.877) * (-938.313) (-944.523) [-936.015] (-937.880) -- 0:00:34
510000 -- (-939.268) (-936.986) (-937.483) [-938.885] * (-938.495) (-944.294) (-935.520) [-937.279] -- 0:00:34
Average standard deviation of split frequencies: 0.012706
510500 -- [-937.771] (-936.281) (-938.716) (-935.467) * (-937.555) (-938.015) (-935.810) [-936.295] -- 0:00:34
511000 -- (-937.721) (-942.065) [-936.245] (-935.495) * (-937.030) (-937.207) (-936.524) [-936.170] -- 0:00:34
511500 -- (-938.876) (-938.304) [-940.198] (-939.151) * [-935.857] (-935.693) (-938.123) (-936.227) -- 0:00:34
512000 -- [-937.583] (-935.667) (-938.596) (-936.484) * (-935.571) [-936.952] (-935.461) (-936.712) -- 0:00:34
512500 -- (-936.507) [-935.644] (-937.678) (-939.281) * (-935.444) (-936.167) (-936.087) [-936.622] -- 0:00:34
513000 -- (-938.469) [-937.084] (-938.014) (-938.505) * (-936.917) [-936.028] (-936.686) (-937.138) -- 0:00:34
513500 -- (-940.973) (-938.967) (-938.864) [-935.335] * (-937.454) (-935.157) [-936.143] (-939.157) -- 0:00:34
514000 -- (-937.832) (-935.779) [-937.038] (-937.241) * (-935.654) [-937.565] (-938.882) (-940.763) -- 0:00:34
514500 -- (-935.070) [-936.296] (-936.349) (-936.203) * (-935.709) [-937.482] (-937.051) (-938.330) -- 0:00:33
515000 -- (-935.051) (-936.981) [-936.587] (-935.649) * (-938.457) (-937.063) (-941.193) [-935.575] -- 0:00:33
Average standard deviation of split frequencies: 0.012414
515500 -- (-935.528) [-937.445] (-936.462) (-938.428) * (-935.653) (-938.682) (-939.981) [-935.911] -- 0:00:33
516000 -- (-936.788) (-935.792) [-937.253] (-938.745) * (-939.724) [-937.180] (-936.021) (-937.093) -- 0:00:33
516500 -- [-936.529] (-935.777) (-935.752) (-937.241) * [-937.882] (-937.781) (-934.791) (-937.423) -- 0:00:33
517000 -- [-937.649] (-940.794) (-936.823) (-936.181) * (-937.443) [-935.332] (-937.402) (-936.115) -- 0:00:33
517500 -- (-937.334) (-938.233) (-935.536) [-937.047] * [-936.155] (-937.847) (-938.168) (-936.201) -- 0:00:34
518000 -- [-938.114] (-940.170) (-936.278) (-935.556) * (-938.190) [-935.954] (-936.981) (-940.257) -- 0:00:34
518500 -- (-936.825) (-939.193) [-936.216] (-935.119) * (-935.746) [-936.391] (-938.671) (-935.703) -- 0:00:34
519000 -- (-936.303) (-936.051) (-935.729) [-936.730] * (-937.793) [-935.685] (-939.611) (-938.571) -- 0:00:34
519500 -- (-937.312) (-937.707) (-936.846) [-936.694] * (-937.350) (-937.397) (-939.192) [-937.936] -- 0:00:34
520000 -- [-937.954] (-936.667) (-938.478) (-937.400) * (-936.189) (-935.711) (-939.056) [-936.118] -- 0:00:34
Average standard deviation of split frequencies: 0.013208
520500 -- (-938.454) (-935.143) (-937.290) [-939.091] * (-936.344) (-937.025) [-940.062] (-938.231) -- 0:00:34
521000 -- (-937.527) [-936.874] (-935.466) (-938.023) * (-937.205) [-936.882] (-936.412) (-947.702) -- 0:00:34
521500 -- (-939.570) (-936.587) (-935.938) [-935.703] * (-940.179) (-938.584) [-938.103] (-941.280) -- 0:00:33
522000 -- [-938.272] (-935.455) (-935.614) (-943.299) * [-936.503] (-936.444) (-938.031) (-940.794) -- 0:00:33
522500 -- [-936.368] (-935.244) (-935.358) (-938.718) * (-936.424) (-935.550) [-935.196] (-942.472) -- 0:00:33
523000 -- [-935.952] (-936.713) (-936.193) (-936.369) * (-937.995) [-938.658] (-938.899) (-939.703) -- 0:00:33
523500 -- [-935.920] (-936.360) (-935.374) (-935.200) * (-935.576) (-943.598) (-937.519) [-937.975] -- 0:00:33
524000 -- (-936.312) (-939.602) (-938.510) [-939.831] * (-935.696) [-936.683] (-937.635) (-937.694) -- 0:00:33
524500 -- [-935.556] (-935.667) (-940.484) (-938.589) * [-936.006] (-938.977) (-940.365) (-938.178) -- 0:00:33
525000 -- (-936.799) [-934.905] (-937.030) (-936.403) * (-937.784) [-936.441] (-940.520) (-945.622) -- 0:00:33
Average standard deviation of split frequencies: 0.012705
525500 -- (-938.134) (-936.061) [-935.735] (-935.797) * [-938.113] (-935.483) (-940.340) (-945.579) -- 0:00:33
526000 -- (-936.473) [-936.391] (-937.855) (-936.113) * [-936.517] (-936.075) (-938.059) (-938.361) -- 0:00:33
526500 -- [-938.225] (-937.259) (-940.645) (-938.809) * [-935.911] (-936.342) (-936.480) (-939.263) -- 0:00:33
527000 -- (-936.536) (-936.764) [-937.546] (-939.641) * (-942.198) [-941.218] (-936.576) (-935.550) -- 0:00:33
527500 -- [-936.447] (-939.382) (-938.006) (-939.644) * (-936.073) [-940.260] (-936.684) (-935.627) -- 0:00:33
528000 -- (-936.853) [-936.039] (-938.026) (-943.753) * [-940.050] (-938.362) (-935.814) (-936.504) -- 0:00:33
528500 -- [-936.920] (-936.618) (-937.240) (-941.411) * (-936.172) [-939.990] (-941.757) (-935.076) -- 0:00:33
529000 -- (-937.981) [-936.361] (-938.114) (-940.767) * (-936.426) [-937.261] (-940.110) (-937.042) -- 0:00:32
529500 -- (-937.736) [-935.417] (-943.569) (-938.585) * [-938.392] (-937.568) (-939.631) (-935.778) -- 0:00:32
530000 -- (-934.794) [-937.668] (-941.881) (-936.994) * (-935.888) (-936.087) [-935.945] (-941.575) -- 0:00:32
Average standard deviation of split frequencies: 0.012123
530500 -- [-934.794] (-939.069) (-940.809) (-938.289) * (-942.440) [-937.568] (-936.201) (-938.708) -- 0:00:32
531000 -- (-935.372) [-938.732] (-938.620) (-937.103) * (-938.774) (-936.428) (-934.907) [-936.261] -- 0:00:33
531500 -- (-940.668) (-935.888) [-935.679] (-940.250) * (-936.778) (-937.507) [-935.089] (-937.212) -- 0:00:33
532000 -- (-944.046) (-936.060) (-937.314) [-937.050] * (-941.473) (-940.383) [-937.834] (-935.328) -- 0:00:33
532500 -- (-944.196) [-936.325] (-940.370) (-939.668) * [-937.542] (-935.888) (-939.626) (-936.634) -- 0:00:33
533000 -- (-938.892) (-935.989) [-936.074] (-939.552) * (-937.542) [-937.481] (-939.172) (-936.000) -- 0:00:33
533500 -- (-938.903) [-935.568] (-936.033) (-937.940) * [-936.005] (-936.458) (-935.738) (-940.986) -- 0:00:33
534000 -- (-937.870) [-938.198] (-937.477) (-935.173) * (-938.881) (-937.840) [-936.155] (-940.171) -- 0:00:33
534500 -- [-935.423] (-937.929) (-935.304) (-936.659) * [-936.479] (-937.747) (-935.869) (-936.390) -- 0:00:33
535000 -- (-937.117) (-936.003) (-936.706) [-940.940] * (-935.472) (-937.076) [-935.068] (-936.170) -- 0:00:33
Average standard deviation of split frequencies: 0.012675
535500 -- (-942.107) [-937.635] (-936.774) (-938.635) * (-936.550) (-937.343) (-935.485) [-937.391] -- 0:00:32
536000 -- (-935.196) (-935.958) (-936.360) [-935.663] * (-938.394) [-936.984] (-936.810) (-942.877) -- 0:00:32
536500 -- [-936.034] (-937.998) (-937.016) (-936.925) * [-937.806] (-936.953) (-935.446) (-944.418) -- 0:00:32
537000 -- (-935.720) (-938.195) [-935.239] (-937.510) * [-936.249] (-937.840) (-935.332) (-940.781) -- 0:00:32
537500 -- (-936.320) [-937.521] (-937.584) (-936.891) * (-936.401) (-938.339) [-936.047] (-934.996) -- 0:00:32
538000 -- [-942.057] (-935.759) (-936.599) (-938.225) * (-943.383) [-938.752] (-940.289) (-935.981) -- 0:00:32
538500 -- (-937.350) (-940.494) (-937.929) [-937.238] * [-936.226] (-935.949) (-938.004) (-936.137) -- 0:00:32
539000 -- [-934.830] (-938.220) (-936.382) (-938.100) * (-935.349) [-938.674] (-937.830) (-936.156) -- 0:00:32
539500 -- (-936.066) (-936.169) (-935.600) [-935.519] * (-937.123) [-935.429] (-935.888) (-937.189) -- 0:00:32
540000 -- [-936.561] (-937.532) (-935.839) (-942.329) * (-936.615) (-935.019) [-938.923] (-937.689) -- 0:00:32
Average standard deviation of split frequencies: 0.012309
540500 -- [-937.940] (-936.327) (-942.642) (-939.155) * [-935.023] (-935.071) (-937.548) (-936.049) -- 0:00:32
541000 -- (-936.346) [-936.894] (-936.265) (-935.163) * (-940.702) (-937.094) [-939.049] (-940.430) -- 0:00:32
541500 -- [-936.172] (-936.426) (-938.541) (-936.564) * (-936.769) [-939.273] (-937.562) (-937.268) -- 0:00:32
542000 -- [-936.393] (-939.073) (-938.007) (-936.336) * [-936.513] (-935.363) (-936.838) (-938.794) -- 0:00:32
542500 -- [-936.021] (-940.433) (-937.978) (-938.450) * (-936.986) (-936.711) (-937.183) [-934.813] -- 0:00:32
543000 -- [-937.318] (-936.525) (-936.152) (-936.063) * (-934.859) (-939.596) [-936.717] (-936.631) -- 0:00:31
543500 -- (-937.670) (-935.499) [-938.601] (-937.967) * (-936.155) [-944.133] (-935.850) (-937.374) -- 0:00:31
544000 -- (-934.949) (-937.260) [-935.850] (-937.786) * (-936.675) (-939.163) [-937.446] (-939.420) -- 0:00:31
544500 -- (-935.602) (-940.015) [-937.613] (-937.013) * (-936.108) [-935.309] (-936.209) (-936.363) -- 0:00:31
545000 -- [-934.631] (-938.185) (-937.493) (-939.200) * (-935.644) [-937.374] (-940.629) (-935.308) -- 0:00:31
Average standard deviation of split frequencies: 0.012183
545500 -- (-936.417) [-935.640] (-940.589) (-937.025) * (-939.490) (-937.240) [-936.935] (-936.011) -- 0:00:32
546000 -- (-936.219) (-935.226) (-938.581) [-935.391] * [-935.753] (-934.716) (-938.838) (-935.646) -- 0:00:32
546500 -- (-935.719) (-936.124) [-938.406] (-935.454) * [-936.245] (-934.716) (-938.427) (-939.112) -- 0:00:32
547000 -- [-936.699] (-939.284) (-940.192) (-937.509) * (-937.948) (-935.440) (-939.613) [-936.095] -- 0:00:32
547500 -- [-936.171] (-936.249) (-937.072) (-936.769) * (-935.924) (-935.440) [-936.306] (-940.801) -- 0:00:32
548000 -- [-936.941] (-939.554) (-937.775) (-943.713) * (-935.493) (-937.706) (-936.849) [-938.150] -- 0:00:32
548500 -- (-940.746) [-939.176] (-935.755) (-941.100) * [-937.604] (-936.755) (-936.493) (-936.802) -- 0:00:32
549000 -- [-938.339] (-938.266) (-936.073) (-934.932) * (-938.343) (-935.004) [-935.762] (-935.835) -- 0:00:32
549500 -- (-936.814) [-939.519] (-937.104) (-937.533) * (-935.297) (-937.664) (-938.384) [-936.431] -- 0:00:31
550000 -- [-937.245] (-940.730) (-935.723) (-938.301) * (-937.226) (-935.773) (-936.212) [-936.454] -- 0:00:31
Average standard deviation of split frequencies: 0.012080
550500 -- (-935.133) (-939.924) [-937.508] (-936.091) * (-935.754) (-937.158) [-936.511] (-937.503) -- 0:00:31
551000 -- (-935.630) (-938.654) (-937.839) [-937.217] * (-936.636) [-936.029] (-935.754) (-937.957) -- 0:00:31
551500 -- (-937.485) (-942.585) [-938.374] (-936.249) * (-937.140) (-937.665) [-936.258] (-938.940) -- 0:00:31
552000 -- (-936.153) (-943.070) (-937.950) [-936.725] * (-937.837) (-937.060) [-935.951] (-939.077) -- 0:00:31
552500 -- (-938.741) [-940.808] (-935.767) (-935.990) * (-935.133) (-937.149) [-938.344] (-938.325) -- 0:00:31
553000 -- (-938.843) (-939.748) (-937.022) [-941.018] * (-936.381) (-935.824) [-939.518] (-938.506) -- 0:00:31
553500 -- (-940.260) (-940.953) [-938.179] (-936.281) * (-937.248) (-936.415) (-935.590) [-940.220] -- 0:00:31
554000 -- (-936.085) (-940.806) (-937.382) [-935.316] * (-936.806) [-935.195] (-937.734) (-938.050) -- 0:00:31
554500 -- (-937.062) [-937.226] (-934.981) (-935.394) * [-935.276] (-937.916) (-935.382) (-938.339) -- 0:00:31
555000 -- [-938.007] (-937.056) (-936.431) (-936.914) * (-935.125) [-935.593] (-935.228) (-937.724) -- 0:00:31
Average standard deviation of split frequencies: 0.011770
555500 -- (-936.852) (-937.365) [-935.732] (-938.666) * (-941.238) (-935.074) (-937.039) [-935.827] -- 0:00:31
556000 -- (-936.173) (-937.670) [-936.136] (-936.097) * (-937.362) [-934.867] (-938.052) (-937.749) -- 0:00:31
556500 -- [-935.296] (-937.713) (-937.172) (-938.696) * (-935.718) (-936.386) [-939.665] (-935.394) -- 0:00:31
557000 -- [-936.325] (-935.874) (-936.758) (-938.436) * (-938.158) [-937.746] (-938.745) (-936.971) -- 0:00:31
557500 -- (-938.451) (-936.574) [-937.120] (-941.360) * (-941.519) (-935.855) [-936.180] (-936.737) -- 0:00:30
558000 -- (-935.936) (-936.367) [-935.655] (-936.463) * (-938.412) [-934.988] (-935.961) (-937.242) -- 0:00:30
558500 -- (-937.438) [-936.830] (-936.959) (-935.969) * (-938.174) (-934.881) [-935.686] (-937.709) -- 0:00:30
559000 -- (-937.932) (-936.201) [-937.467] (-935.986) * (-936.416) [-935.484] (-935.559) (-935.631) -- 0:00:30
559500 -- (-935.921) (-938.960) (-937.427) [-935.994] * (-938.556) [-936.727] (-935.590) (-935.696) -- 0:00:31
560000 -- (-935.296) [-938.602] (-936.613) (-937.516) * (-937.241) [-936.085] (-935.673) (-935.603) -- 0:00:31
Average standard deviation of split frequencies: 0.011865
560500 -- [-937.431] (-936.674) (-939.131) (-936.444) * (-936.602) (-936.111) (-938.294) [-935.319] -- 0:00:31
561000 -- (-940.116) (-935.304) (-940.758) [-937.684] * (-936.403) (-939.253) (-940.886) [-935.697] -- 0:00:31
561500 -- (-936.805) (-938.707) [-935.475] (-939.560) * [-939.152] (-937.999) (-937.229) (-935.426) -- 0:00:31
562000 -- (-936.616) (-938.442) (-939.827) [-935.298] * [-938.487] (-937.150) (-938.812) (-939.858) -- 0:00:31
562500 -- (-937.733) (-938.841) [-938.146] (-934.910) * (-939.490) (-938.268) [-937.689] (-935.526) -- 0:00:31
563000 -- (-937.485) (-937.963) [-936.215] (-940.987) * (-935.742) (-935.743) [-939.066] (-937.238) -- 0:00:31
563500 -- (-939.101) (-935.807) (-935.557) [-936.798] * (-938.320) (-936.269) (-936.540) [-935.430] -- 0:00:30
564000 -- (-935.363) (-936.057) [-935.685] (-938.005) * (-937.017) (-936.544) [-938.208] (-935.075) -- 0:00:30
564500 -- (-935.386) (-935.674) [-936.585] (-938.795) * [-937.525] (-938.932) (-937.471) (-935.137) -- 0:00:30
565000 -- [-935.888] (-939.531) (-937.524) (-938.554) * [-935.121] (-939.977) (-936.167) (-936.059) -- 0:00:30
Average standard deviation of split frequencies: 0.011660
565500 -- (-936.440) (-939.226) [-938.223] (-937.478) * (-940.417) [-934.918] (-942.688) (-935.636) -- 0:00:30
566000 -- (-938.078) (-936.785) [-937.797] (-936.051) * (-938.015) (-936.164) (-941.048) [-935.324] -- 0:00:30
566500 -- (-937.594) (-936.093) (-938.053) [-937.463] * [-938.540] (-936.693) (-939.697) (-937.947) -- 0:00:30
567000 -- (-940.180) (-936.525) (-937.373) [-935.433] * (-937.870) (-936.399) (-936.193) [-936.485] -- 0:00:30
567500 -- (-938.289) [-935.612] (-937.522) (-940.947) * (-936.026) [-935.245] (-935.928) (-942.682) -- 0:00:30
568000 -- (-940.220) (-937.600) (-940.416) [-937.532] * (-934.938) (-935.539) [-936.756] (-938.636) -- 0:00:30
568500 -- (-936.248) [-937.814] (-936.544) (-936.334) * [-936.349] (-938.877) (-938.337) (-941.570) -- 0:00:30
569000 -- [-935.250] (-940.312) (-935.469) (-938.149) * (-936.300) (-937.244) (-937.705) [-935.946] -- 0:00:30
569500 -- (-935.431) (-936.926) [-937.094] (-937.193) * (-938.635) [-935.356] (-936.665) (-934.963) -- 0:00:30
570000 -- [-938.297] (-935.698) (-940.739) (-935.205) * (-937.056) (-936.786) [-935.589] (-939.622) -- 0:00:30
Average standard deviation of split frequencies: 0.012207
570500 -- (-938.914) [-936.660] (-943.245) (-935.884) * (-936.479) (-937.010) [-935.509] (-939.298) -- 0:00:30
571000 -- (-937.604) (-935.668) [-941.580] (-937.003) * (-937.176) (-936.018) [-935.523] (-935.391) -- 0:00:30
571500 -- [-937.486] (-936.391) (-943.342) (-940.314) * (-938.474) (-936.393) (-935.035) [-936.545] -- 0:00:29
572000 -- (-938.079) (-939.153) (-936.914) [-938.279] * (-937.245) (-936.712) [-937.457] (-937.242) -- 0:00:29
572500 -- (-934.875) [-935.723] (-940.511) (-937.941) * (-936.302) (-934.778) (-935.415) [-935.528] -- 0:00:29
573000 -- (-937.669) [-937.991] (-936.427) (-937.443) * [-937.212] (-935.424) (-935.892) (-937.292) -- 0:00:29
573500 -- (-940.750) (-936.636) [-936.300] (-942.506) * [-939.402] (-937.210) (-936.077) (-937.682) -- 0:00:30
574000 -- (-940.536) (-938.805) (-939.406) [-937.505] * (-938.945) (-936.104) (-938.943) [-936.925] -- 0:00:30
574500 -- (-936.871) [-936.219] (-935.708) (-938.673) * (-936.038) [-935.318] (-938.956) (-935.590) -- 0:00:30
575000 -- (-935.924) [-936.482] (-937.511) (-941.780) * [-936.858] (-935.318) (-934.900) (-936.552) -- 0:00:30
Average standard deviation of split frequencies: 0.011355
575500 -- [-935.900] (-936.806) (-935.814) (-935.319) * (-938.780) (-937.669) (-935.436) [-936.869] -- 0:00:30
576000 -- (-935.743) (-937.662) [-936.086] (-937.146) * (-939.496) (-935.897) (-941.021) [-936.923] -- 0:00:30
576500 -- (-940.005) [-938.229] (-937.082) (-936.089) * (-937.568) (-935.237) (-943.831) [-940.516] -- 0:00:30
577000 -- (-939.302) (-936.873) [-936.523] (-935.298) * [-936.591] (-937.548) (-939.252) (-938.406) -- 0:00:30
577500 -- (-937.394) [-935.497] (-935.723) (-935.601) * (-935.555) [-940.524] (-937.228) (-935.166) -- 0:00:29
578000 -- (-938.257) (-944.728) [-936.676] (-936.626) * (-938.137) (-936.432) (-937.241) [-938.710] -- 0:00:29
578500 -- (-938.229) [-937.089] (-935.838) (-937.988) * (-940.134) (-936.512) (-937.643) [-935.090] -- 0:00:29
579000 -- (-938.043) (-939.952) (-936.062) [-937.653] * [-936.574] (-939.010) (-935.787) (-936.057) -- 0:00:29
579500 -- (-936.921) [-936.244] (-942.276) (-940.357) * (-937.754) (-940.999) [-938.582] (-941.548) -- 0:00:29
580000 -- (-936.398) (-937.137) (-942.277) [-937.922] * (-935.728) (-938.347) [-936.735] (-938.961) -- 0:00:29
Average standard deviation of split frequencies: 0.011721
580500 -- (-940.314) (-937.272) (-941.600) [-939.332] * (-936.352) (-936.621) [-939.290] (-935.049) -- 0:00:29
581000 -- [-942.540] (-937.083) (-936.574) (-938.848) * [-936.012] (-939.751) (-937.375) (-938.702) -- 0:00:29
581500 -- [-941.891] (-937.906) (-938.670) (-939.488) * (-936.674) (-936.641) [-938.008] (-939.300) -- 0:00:29
582000 -- (-941.541) (-936.819) [-939.295] (-939.759) * (-935.954) (-935.630) (-939.872) [-937.086] -- 0:00:29
582500 -- (-937.189) (-939.976) (-939.014) [-937.131] * (-941.330) [-937.104] (-940.135) (-937.479) -- 0:00:29
583000 -- (-939.222) (-935.534) (-937.639) [-938.730] * (-937.371) (-941.080) (-936.095) [-940.363] -- 0:00:29
583500 -- (-939.980) (-936.145) (-936.533) [-936.621] * (-939.919) [-935.725] (-938.902) (-936.466) -- 0:00:29
584000 -- (-935.505) [-937.832] (-939.441) (-936.768) * (-939.432) (-935.716) [-935.885] (-936.495) -- 0:00:29
584500 -- (-935.119) [-939.319] (-938.597) (-941.230) * (-936.409) (-935.462) (-935.231) [-935.754] -- 0:00:29
585000 -- (-938.707) (-938.464) (-937.260) [-936.396] * (-937.172) [-935.657] (-936.528) (-936.143) -- 0:00:29
Average standard deviation of split frequencies: 0.011614
585500 -- (-937.140) (-939.791) [-937.601] (-937.302) * [-937.081] (-935.874) (-938.803) (-937.932) -- 0:00:29
586000 -- [-938.643] (-937.517) (-937.297) (-937.435) * [-937.298] (-936.288) (-937.987) (-936.809) -- 0:00:28
586500 -- (-943.889) (-938.695) [-939.609] (-938.535) * (-941.641) [-936.929] (-938.562) (-936.248) -- 0:00:29
587000 -- (-937.320) (-937.864) [-937.407] (-937.396) * [-937.979] (-936.931) (-940.771) (-936.267) -- 0:00:29
587500 -- (-936.762) [-936.424] (-935.668) (-935.829) * (-937.326) (-939.072) [-937.174] (-938.320) -- 0:00:29
588000 -- (-935.424) (-937.606) [-935.466] (-935.848) * (-936.034) (-945.449) [-935.850] (-939.345) -- 0:00:29
588500 -- (-936.404) (-940.310) (-937.803) [-935.811] * [-938.096] (-938.634) (-935.087) (-939.626) -- 0:00:29
589000 -- (-937.680) (-937.743) (-938.500) [-937.718] * (-938.364) [-935.172] (-936.335) (-936.937) -- 0:00:29
589500 -- (-936.860) [-938.941] (-937.790) (-942.465) * [-935.831] (-937.764) (-937.049) (-937.102) -- 0:00:29
590000 -- (-937.656) [-937.368] (-941.194) (-937.975) * (-935.590) (-936.292) (-937.011) [-935.546] -- 0:00:29
Average standard deviation of split frequencies: 0.011408
590500 -- (-938.476) (-936.004) (-936.805) [-936.111] * (-934.794) (-939.844) (-938.624) [-935.653] -- 0:00:29
591000 -- [-936.557] (-935.952) (-939.579) (-935.347) * (-934.737) [-940.565] (-938.730) (-939.158) -- 0:00:29
591500 -- (-935.395) (-938.591) [-939.680] (-935.692) * (-939.669) (-941.184) (-936.348) [-938.428] -- 0:00:29
592000 -- [-935.575] (-936.878) (-938.592) (-935.472) * (-935.880) [-939.156] (-936.613) (-940.925) -- 0:00:28
592500 -- (-938.970) (-940.040) [-939.420] (-935.232) * [-936.541] (-937.790) (-937.546) (-940.663) -- 0:00:28
593000 -- (-940.107) (-943.083) [-936.614] (-941.798) * [-935.532] (-937.927) (-936.644) (-941.453) -- 0:00:28
593500 -- (-937.062) (-937.102) (-936.616) [-934.858] * (-935.612) [-938.528] (-935.541) (-939.882) -- 0:00:28
594000 -- (-936.518) [-935.715] (-937.887) (-935.097) * (-938.597) (-938.403) (-934.635) [-936.347] -- 0:00:28
594500 -- (-937.141) (-935.498) (-935.875) [-935.977] * [-936.739] (-939.365) (-935.619) (-935.929) -- 0:00:28
595000 -- (-938.163) (-935.187) [-939.635] (-935.699) * (-936.354) (-936.367) (-937.027) [-941.083] -- 0:00:28
Average standard deviation of split frequencies: 0.011271
595500 -- (-938.873) (-937.933) (-940.427) [-935.552] * (-937.938) [-937.225] (-940.584) (-937.198) -- 0:00:28
596000 -- (-940.835) [-936.644] (-940.012) (-937.637) * (-940.108) (-935.985) (-937.237) [-937.655] -- 0:00:28
596500 -- (-937.293) (-936.208) (-943.948) [-935.893] * (-936.245) [-936.191] (-939.404) (-936.252) -- 0:00:28
597000 -- [-935.501] (-937.189) (-935.728) (-942.602) * (-936.079) (-935.684) [-938.065] (-936.369) -- 0:00:28
597500 -- [-935.429] (-935.315) (-936.301) (-937.549) * (-937.011) (-938.302) (-936.154) [-940.415] -- 0:00:28
598000 -- (-937.061) [-936.475] (-939.320) (-938.615) * [-936.452] (-936.147) (-937.389) (-937.659) -- 0:00:28
598500 -- (-938.528) (-937.055) (-936.371) [-935.420] * [-937.288] (-938.355) (-941.362) (-942.146) -- 0:00:28
599000 -- (-937.401) (-937.343) (-942.962) [-937.534] * (-936.141) (-938.631) (-938.034) [-936.206] -- 0:00:28
599500 -- (-938.462) [-936.032] (-935.860) (-936.276) * (-934.990) [-935.660] (-940.534) (-937.902) -- 0:00:28
600000 -- (-943.528) (-934.867) [-936.222] (-937.424) * (-936.113) [-935.994] (-935.513) (-941.932) -- 0:00:27
Average standard deviation of split frequencies: 0.011495
600500 -- [-938.407] (-935.265) (-937.062) (-935.391) * (-935.968) (-937.068) (-938.799) [-935.740] -- 0:00:27
601000 -- (-935.753) (-942.340) [-939.745] (-935.458) * (-937.450) (-938.633) [-939.061] (-937.571) -- 0:00:28
601500 -- (-936.327) [-935.132] (-941.788) (-938.569) * (-937.619) [-938.544] (-937.178) (-940.057) -- 0:00:28
602000 -- (-935.024) [-936.248] (-936.507) (-934.986) * [-937.265] (-937.703) (-936.789) (-934.911) -- 0:00:28
602500 -- [-938.210] (-938.217) (-935.739) (-936.652) * [-936.375] (-940.974) (-938.094) (-935.672) -- 0:00:28
603000 -- (-937.851) (-937.134) (-935.915) [-936.926] * (-935.708) (-936.747) [-936.166] (-935.352) -- 0:00:28
603500 -- (-940.947) [-937.398] (-937.916) (-936.239) * (-939.333) (-937.078) [-938.850] (-935.512) -- 0:00:28
604000 -- (-936.728) (-935.605) [-935.947] (-935.431) * [-943.450] (-941.200) (-941.422) (-935.514) -- 0:00:28
604500 -- (-935.520) (-934.829) [-935.397] (-936.541) * (-937.163) (-942.843) (-939.228) [-936.561] -- 0:00:28
605000 -- [-936.736] (-935.135) (-935.532) (-936.276) * (-936.151) [-936.409] (-936.647) (-935.335) -- 0:00:28
Average standard deviation of split frequencies: 0.011394
605500 -- (-939.069) [-941.720] (-940.915) (-938.364) * (-935.396) [-935.955] (-942.216) (-937.105) -- 0:00:28
606000 -- (-936.427) (-939.289) (-937.930) [-938.169] * (-939.659) [-934.959] (-939.302) (-938.473) -- 0:00:27
606500 -- (-935.212) [-936.229] (-936.636) (-942.116) * [-936.389] (-935.599) (-935.942) (-935.903) -- 0:00:27
607000 -- (-937.190) [-936.507] (-936.906) (-937.486) * (-937.052) (-935.472) (-937.108) [-936.223] -- 0:00:27
607500 -- (-938.682) [-936.846] (-944.373) (-935.321) * (-941.696) (-935.723) [-938.896] (-937.768) -- 0:00:27
608000 -- [-938.356] (-938.728) (-937.743) (-935.329) * (-937.661) (-939.005) (-935.666) [-937.119] -- 0:00:27
608500 -- (-936.067) (-937.424) [-935.688] (-935.693) * (-940.980) (-939.046) [-935.556] (-935.569) -- 0:00:27
609000 -- [-936.533] (-935.219) (-941.517) (-937.217) * (-938.140) (-936.239) (-940.627) [-934.839] -- 0:00:27
609500 -- (-938.361) (-935.415) [-941.258] (-937.876) * [-937.834] (-940.110) (-942.140) (-937.076) -- 0:00:27
610000 -- (-935.514) [-935.740] (-939.335) (-936.755) * [-937.054] (-936.323) (-937.336) (-938.934) -- 0:00:27
Average standard deviation of split frequencies: 0.010762
610500 -- (-939.058) [-936.423] (-935.995) (-935.471) * (-937.539) (-938.939) [-936.893] (-938.824) -- 0:00:27
611000 -- (-937.919) (-935.372) [-936.196] (-936.361) * (-938.318) (-939.178) (-939.839) [-937.427] -- 0:00:27
611500 -- (-941.318) [-937.610] (-940.514) (-935.372) * [-938.510] (-938.122) (-934.998) (-937.226) -- 0:00:27
612000 -- (-936.696) (-936.478) [-938.270] (-935.678) * (-940.883) (-938.790) (-934.825) [-937.858] -- 0:00:27
612500 -- (-940.555) (-940.434) (-937.015) [-936.447] * (-937.200) (-937.430) (-935.676) [-939.650] -- 0:00:27
613000 -- (-937.960) [-938.229] (-937.111) (-936.301) * (-935.562) [-937.571] (-935.955) (-935.958) -- 0:00:27
613500 -- (-939.369) [-935.139] (-935.979) (-937.424) * (-938.938) (-939.581) [-937.684] (-936.073) -- 0:00:27
614000 -- [-936.652] (-936.981) (-936.484) (-940.230) * [-937.516] (-938.663) (-936.724) (-935.505) -- 0:00:27
614500 -- [-935.290] (-938.442) (-936.069) (-935.648) * (-935.156) (-940.161) (-936.279) [-936.734] -- 0:00:26
615000 -- (-937.965) (-937.241) (-938.391) [-942.897] * (-936.310) [-941.088] (-935.959) (-938.742) -- 0:00:27
Average standard deviation of split frequencies: 0.011074
615500 -- [-937.978] (-940.166) (-936.116) (-940.085) * (-935.782) (-938.461) [-937.712] (-938.567) -- 0:00:27
616000 -- [-939.076] (-938.767) (-938.235) (-935.361) * (-935.611) (-942.302) (-935.317) [-935.784] -- 0:00:27
616500 -- (-937.298) (-935.309) (-941.606) [-936.705] * (-935.852) (-937.657) (-936.468) [-935.339] -- 0:00:27
617000 -- [-935.295] (-936.333) (-941.098) (-935.772) * (-935.043) (-936.093) [-935.845] (-936.316) -- 0:00:27
617500 -- [-938.573] (-935.702) (-936.358) (-936.017) * [-936.298] (-937.641) (-935.744) (-936.338) -- 0:00:27
618000 -- [-934.946] (-936.143) (-936.365) (-938.409) * (-943.986) (-936.795) [-937.530] (-934.728) -- 0:00:27
618500 -- (-935.319) [-935.176] (-938.410) (-938.874) * (-937.289) [-941.429] (-935.222) (-935.859) -- 0:00:27
619000 -- [-936.387] (-935.749) (-937.189) (-937.150) * [-938.408] (-943.325) (-935.704) (-936.391) -- 0:00:27
619500 -- (-937.773) (-936.294) (-936.943) [-941.150] * (-939.322) [-937.583] (-938.083) (-938.739) -- 0:00:27
620000 -- (-939.219) [-937.221] (-938.948) (-938.875) * (-935.007) (-938.665) [-934.695] (-939.187) -- 0:00:26
Average standard deviation of split frequencies: 0.011795
620500 -- (-941.010) (-936.665) (-940.884) [-936.894] * [-939.261] (-939.784) (-936.540) (-936.713) -- 0:00:26
621000 -- (-936.078) [-936.666] (-935.414) (-937.532) * (-935.566) [-935.829] (-935.624) (-937.377) -- 0:00:26
621500 -- (-936.742) (-938.216) [-935.573] (-936.902) * (-939.495) (-935.579) (-937.363) [-937.847] -- 0:00:26
622000 -- [-936.527] (-934.995) (-939.457) (-937.686) * (-936.364) [-941.048] (-936.253) (-944.100) -- 0:00:26
622500 -- [-937.214] (-936.025) (-935.555) (-937.804) * (-937.408) [-936.448] (-937.263) (-940.194) -- 0:00:26
623000 -- [-936.110] (-936.095) (-937.010) (-936.876) * (-936.911) [-937.147] (-936.608) (-936.969) -- 0:00:26
623500 -- (-940.085) [-936.550] (-936.988) (-935.639) * (-936.893) (-934.707) [-935.507] (-935.762) -- 0:00:26
624000 -- (-935.967) (-936.870) [-936.298] (-935.600) * (-935.188) [-934.709] (-941.883) (-936.764) -- 0:00:26
624500 -- (-938.821) (-936.649) (-935.482) [-937.041] * (-934.970) [-936.136] (-935.178) (-936.929) -- 0:00:26
625000 -- (-939.843) (-936.078) (-935.636) [-937.090] * (-935.296) [-935.208] (-936.655) (-940.118) -- 0:00:26
Average standard deviation of split frequencies: 0.012004
625500 -- (-939.816) [-935.906] (-935.389) (-937.007) * (-937.763) (-935.551) [-935.886] (-936.498) -- 0:00:26
626000 -- (-935.928) (-936.759) (-935.199) [-936.220] * (-935.158) (-938.624) [-935.703] (-937.412) -- 0:00:26
626500 -- (-936.596) [-937.859] (-935.590) (-936.369) * (-937.861) (-940.287) (-936.960) [-942.505] -- 0:00:26
627000 -- (-935.995) [-937.943] (-941.397) (-936.068) * (-939.402) [-934.745] (-939.292) (-936.750) -- 0:00:26
627500 -- (-935.921) (-937.808) [-935.655] (-937.894) * (-937.290) (-934.788) [-936.346] (-935.568) -- 0:00:26
628000 -- [-938.948] (-939.551) (-935.247) (-937.629) * (-936.968) (-936.998) [-936.784] (-937.855) -- 0:00:26
628500 -- [-937.529] (-939.868) (-936.506) (-940.236) * (-937.843) (-936.271) [-937.019] (-938.311) -- 0:00:26
629000 -- (-939.422) (-937.803) (-936.714) [-939.882] * (-938.065) [-937.013] (-936.736) (-935.397) -- 0:00:25
629500 -- [-941.916] (-940.554) (-938.827) (-942.070) * (-940.560) (-938.564) (-935.753) [-936.496] -- 0:00:25
630000 -- (-939.065) [-938.406] (-936.238) (-939.215) * (-936.517) [-938.884] (-935.245) (-935.896) -- 0:00:26
Average standard deviation of split frequencies: 0.011916
630500 -- (-938.699) (-939.850) [-935.432] (-937.425) * (-937.736) (-936.933) [-938.551] (-936.590) -- 0:00:26
631000 -- [-938.357] (-936.516) (-936.135) (-935.722) * (-935.316) (-937.484) (-935.259) [-936.438] -- 0:00:26
631500 -- (-935.828) [-935.766] (-935.215) (-935.898) * (-936.439) [-939.045] (-936.431) (-935.055) -- 0:00:26
632000 -- [-935.913] (-937.914) (-935.803) (-935.979) * (-934.851) [-938.846] (-935.514) (-935.403) -- 0:00:26
632500 -- (-939.399) (-936.063) (-935.677) [-935.251] * (-936.241) [-939.814] (-936.366) (-936.244) -- 0:00:26
633000 -- (-936.639) [-935.737] (-936.802) (-935.912) * (-935.432) (-937.495) (-940.104) [-937.256] -- 0:00:26
633500 -- (-936.504) (-937.428) (-935.715) [-936.469] * (-934.973) (-935.670) [-936.885] (-938.552) -- 0:00:26
634000 -- (-938.298) (-937.409) [-936.361] (-937.327) * (-936.448) [-937.636] (-938.701) (-940.233) -- 0:00:25
634500 -- (-936.755) (-937.309) [-936.274] (-936.932) * (-936.704) (-937.600) [-937.842] (-936.195) -- 0:00:25
635000 -- (-938.098) (-936.853) [-936.063] (-936.728) * (-935.064) [-935.251] (-938.155) (-938.122) -- 0:00:25
Average standard deviation of split frequencies: 0.011903
635500 -- (-937.197) (-935.613) (-937.956) [-937.361] * [-935.530] (-935.470) (-937.776) (-938.550) -- 0:00:25
636000 -- [-935.868] (-935.048) (-937.510) (-935.764) * (-938.874) (-939.736) [-935.142] (-939.877) -- 0:00:25
636500 -- (-938.370) (-935.077) [-935.412] (-936.268) * (-944.043) (-939.636) [-937.362] (-936.991) -- 0:00:25
637000 -- [-936.181] (-934.906) (-937.912) (-938.276) * (-943.732) (-936.807) [-936.763] (-938.111) -- 0:00:25
637500 -- (-936.530) (-935.700) (-936.099) [-936.301] * (-936.376) (-937.437) (-937.757) [-935.674] -- 0:00:25
638000 -- (-940.886) (-936.942) (-937.632) [-936.208] * (-937.364) [-935.882] (-938.572) (-935.897) -- 0:00:25
638500 -- (-936.740) (-935.392) (-935.717) [-935.468] * (-937.851) [-936.301] (-935.138) (-936.692) -- 0:00:25
639000 -- (-935.737) [-935.389] (-937.412) (-935.510) * (-940.063) (-938.715) [-935.140] (-935.712) -- 0:00:25
639500 -- [-935.284] (-937.468) (-936.483) (-936.183) * (-935.851) [-940.729] (-935.065) (-936.579) -- 0:00:25
640000 -- (-938.402) (-935.418) (-935.461) [-936.174] * [-935.752] (-936.983) (-941.037) (-936.765) -- 0:00:25
Average standard deviation of split frequencies: 0.011643
640500 -- [-938.153] (-936.612) (-935.998) (-936.275) * [-935.665] (-939.054) (-936.848) (-937.311) -- 0:00:25
641000 -- (-937.979) [-935.613] (-935.977) (-936.418) * (-936.976) (-937.720) (-941.356) [-938.338] -- 0:00:25
641500 -- [-936.273] (-934.758) (-941.543) (-935.720) * [-935.449] (-941.787) (-939.144) (-936.704) -- 0:00:25
642000 -- (-935.803) [-935.526] (-935.469) (-939.065) * [-936.935] (-938.719) (-936.743) (-937.640) -- 0:00:25
642500 -- [-937.344] (-934.787) (-938.388) (-936.797) * (-935.470) [-936.161] (-939.675) (-938.142) -- 0:00:25
643000 -- [-936.125] (-937.482) (-936.734) (-938.322) * (-935.173) (-938.620) [-937.726] (-937.459) -- 0:00:24
643500 -- [-935.993] (-939.374) (-936.550) (-938.974) * (-940.549) (-938.505) (-937.912) [-937.010] -- 0:00:24
644000 -- (-936.559) (-938.750) (-941.719) [-938.290] * (-937.615) (-938.250) [-935.986] (-939.452) -- 0:00:24
644500 -- (-936.121) (-936.002) (-936.685) [-939.397] * (-935.419) (-937.600) (-937.733) [-935.600] -- 0:00:25
645000 -- (-938.587) (-936.919) [-936.105] (-937.499) * (-937.333) (-938.990) [-935.877] (-936.393) -- 0:00:25
Average standard deviation of split frequencies: 0.011847
645500 -- [-939.368] (-938.337) (-936.844) (-937.334) * (-937.307) (-937.690) (-935.539) [-936.025] -- 0:00:25
646000 -- (-938.639) (-938.792) [-936.028] (-938.743) * (-938.605) (-935.306) (-936.004) [-936.683] -- 0:00:25
646500 -- (-938.046) [-936.406] (-935.071) (-935.945) * (-936.788) (-936.894) [-935.812] (-941.179) -- 0:00:25
647000 -- (-937.456) [-942.174] (-937.963) (-937.518) * (-938.199) (-936.567) [-936.359] (-939.178) -- 0:00:25
647500 -- (-938.874) (-936.651) [-937.170] (-938.555) * (-941.663) (-937.927) [-935.163] (-935.209) -- 0:00:25
648000 -- (-936.332) [-935.883] (-937.056) (-941.742) * (-938.458) (-939.205) [-935.413] (-936.412) -- 0:00:24
648500 -- [-936.823] (-936.143) (-938.882) (-936.714) * (-939.667) [-937.963] (-936.479) (-936.495) -- 0:00:24
649000 -- (-938.986) [-937.781] (-940.650) (-937.371) * [-935.721] (-934.748) (-937.394) (-936.349) -- 0:00:24
649500 -- [-936.659] (-940.235) (-942.543) (-938.274) * [-936.886] (-936.557) (-938.081) (-936.853) -- 0:00:24
650000 -- (-935.638) [-938.498] (-936.932) (-939.091) * (-938.530) (-935.581) (-940.725) [-935.196] -- 0:00:24
Average standard deviation of split frequencies: 0.011890
650500 -- (-936.784) [-938.924] (-938.284) (-940.290) * (-935.999) (-938.336) [-938.094] (-937.032) -- 0:00:24
651000 -- [-938.802] (-941.959) (-935.915) (-936.709) * (-939.095) (-937.107) [-938.260] (-936.064) -- 0:00:24
651500 -- (-937.165) (-938.409) [-936.148] (-935.730) * [-937.147] (-936.737) (-937.006) (-939.102) -- 0:00:24
652000 -- (-939.516) (-935.962) [-937.477] (-936.580) * (-939.347) (-939.305) [-936.050] (-936.541) -- 0:00:24
652500 -- [-936.719] (-936.444) (-936.348) (-934.849) * (-938.059) (-940.103) [-935.818] (-936.838) -- 0:00:24
653000 -- [-935.992] (-936.573) (-938.025) (-937.071) * (-937.275) (-940.820) [-936.341] (-935.161) -- 0:00:24
653500 -- (-936.715) [-937.420] (-941.000) (-941.523) * (-938.983) (-936.977) (-935.722) [-935.161] -- 0:00:24
654000 -- (-936.084) (-936.987) (-937.464) [-937.367] * (-938.147) (-935.525) (-936.940) [-936.479] -- 0:00:24
654500 -- (-935.764) (-937.015) (-935.261) [-936.130] * (-936.068) (-935.128) (-935.098) [-940.038] -- 0:00:24
655000 -- (-935.557) (-939.368) [-936.051] (-936.564) * [-937.140] (-938.038) (-936.473) (-937.479) -- 0:00:24
Average standard deviation of split frequencies: 0.012174
655500 -- (-937.585) [-935.150] (-936.657) (-936.572) * (-936.761) (-938.304) [-935.388] (-936.168) -- 0:00:24
656000 -- (-937.711) [-934.922] (-940.197) (-939.589) * (-936.794) (-939.358) [-936.033] (-936.695) -- 0:00:24
656500 -- [-939.366] (-935.535) (-938.885) (-940.938) * (-938.110) (-937.765) [-938.480] (-936.392) -- 0:00:24
657000 -- [-935.529] (-937.495) (-937.080) (-938.026) * (-938.643) [-937.650] (-936.792) (-935.719) -- 0:00:24
657500 -- (-935.372) [-937.030] (-938.235) (-941.373) * (-936.899) [-935.570] (-942.469) (-937.281) -- 0:00:24
658000 -- (-935.915) (-937.283) [-936.005] (-936.463) * [-938.371] (-936.420) (-940.225) (-936.921) -- 0:00:24
658500 -- (-935.895) (-938.094) (-939.055) [-935.609] * (-939.904) [-935.514] (-938.289) (-936.931) -- 0:00:24
659000 -- (-935.013) [-937.145] (-938.748) (-935.504) * [-936.950] (-935.724) (-936.767) (-935.889) -- 0:00:24
659500 -- (-936.428) (-935.113) (-937.682) [-937.414] * (-936.711) (-936.619) [-937.432] (-935.515) -- 0:00:24
660000 -- [-935.504] (-935.121) (-937.105) (-939.459) * (-937.943) (-936.711) (-936.893) [-935.996] -- 0:00:24
Average standard deviation of split frequencies: 0.012424
660500 -- (-940.838) [-936.665] (-935.974) (-939.428) * [-942.757] (-936.681) (-935.502) (-936.404) -- 0:00:24
661000 -- (-938.157) (-936.874) (-937.070) [-935.689] * (-939.004) (-936.333) [-936.133] (-936.043) -- 0:00:24
661500 -- (-935.442) [-937.880] (-935.891) (-940.428) * (-935.781) [-935.453] (-936.692) (-935.816) -- 0:00:24
662000 -- [-935.998] (-937.909) (-936.789) (-934.966) * [-935.195] (-936.457) (-939.024) (-937.670) -- 0:00:23
662500 -- (-936.422) (-936.467) (-939.746) [-934.759] * (-937.250) [-938.248] (-936.787) (-937.852) -- 0:00:23
663000 -- (-938.975) (-934.843) [-937.583] (-936.838) * (-935.440) (-935.466) (-937.637) [-937.621] -- 0:00:23
663500 -- (-939.855) [-936.039] (-940.063) (-935.594) * [-936.315] (-936.731) (-936.550) (-936.689) -- 0:00:23
664000 -- (-936.419) (-936.321) [-936.772] (-942.032) * [-938.955] (-939.779) (-935.876) (-941.081) -- 0:00:23
664500 -- [-935.429] (-939.195) (-941.181) (-945.539) * [-935.835] (-942.074) (-938.172) (-938.953) -- 0:00:23
665000 -- (-936.591) (-943.233) [-935.414] (-939.419) * [-938.943] (-936.372) (-937.408) (-936.100) -- 0:00:23
Average standard deviation of split frequencies: 0.012199
665500 -- (-940.049) (-938.079) [-935.709] (-937.435) * (-937.368) [-935.956] (-936.907) (-937.998) -- 0:00:23
666000 -- (-937.463) (-935.355) [-938.711] (-937.919) * (-936.331) (-935.842) (-937.117) [-938.690] -- 0:00:23
666500 -- [-937.932] (-935.854) (-936.700) (-938.210) * [-937.235] (-935.838) (-936.631) (-936.320) -- 0:00:23
667000 -- (-936.417) (-935.542) (-936.657) [-935.672] * (-936.928) (-938.472) (-938.006) [-935.906] -- 0:00:23
667500 -- (-937.906) (-937.826) (-935.762) [-936.221] * (-935.300) (-935.413) (-940.071) [-935.972] -- 0:00:23
668000 -- (-938.132) (-936.922) (-935.500) [-936.311] * (-936.736) (-936.921) (-936.083) [-936.075] -- 0:00:23
668500 -- (-936.882) [-935.983] (-937.360) (-938.576) * (-938.092) [-936.251] (-937.682) (-936.287) -- 0:00:23
669000 -- [-935.225] (-939.285) (-935.525) (-940.664) * (-936.797) (-937.049) (-935.379) [-936.860] -- 0:00:23
669500 -- (-940.366) (-936.071) (-938.358) [-936.208] * (-935.748) [-935.859] (-937.340) (-937.465) -- 0:00:23
670000 -- (-945.550) (-936.753) [-937.758] (-936.558) * [-936.871] (-937.531) (-938.078) (-936.915) -- 0:00:23
Average standard deviation of split frequencies: 0.012496
670500 -- (-939.812) [-938.232] (-936.474) (-935.791) * (-936.202) (-937.807) [-937.957] (-936.480) -- 0:00:23
671000 -- (-937.225) (-936.069) [-936.859] (-938.114) * (-938.007) (-940.595) (-936.671) [-938.893] -- 0:00:23
671500 -- (-942.060) (-937.076) (-936.842) [-937.625] * (-936.814) (-936.878) (-937.068) [-936.856] -- 0:00:22
672000 -- (-935.814) (-937.376) [-936.861] (-935.841) * (-936.027) (-936.565) [-939.308] (-939.835) -- 0:00:22
672500 -- (-938.852) [-935.810] (-937.712) (-937.739) * (-936.311) (-937.917) (-939.934) [-936.549] -- 0:00:22
673000 -- (-937.495) (-935.547) (-936.233) [-937.496] * [-937.928] (-936.952) (-935.195) (-936.208) -- 0:00:23
673500 -- (-936.625) (-935.059) [-937.103] (-935.823) * [-935.379] (-936.128) (-935.157) (-937.063) -- 0:00:23
674000 -- [-935.575] (-935.432) (-935.417) (-935.740) * [-935.412] (-938.690) (-936.137) (-937.300) -- 0:00:23
674500 -- (-936.660) (-935.752) [-937.577] (-935.565) * (-936.075) [-938.752] (-935.818) (-935.770) -- 0:00:23
675000 -- [-935.353] (-937.105) (-936.454) (-936.019) * (-939.505) (-941.487) [-935.660] (-934.707) -- 0:00:23
Average standard deviation of split frequencies: 0.012675
675500 -- (-935.976) [-937.782] (-934.966) (-935.423) * (-937.517) (-938.868) (-936.948) [-934.682] -- 0:00:23
676000 -- (-939.378) [-935.529] (-937.002) (-935.916) * (-935.944) [-934.930] (-935.855) (-936.379) -- 0:00:23
676500 -- (-935.742) (-935.905) (-938.504) [-936.302] * (-936.612) (-939.387) (-937.008) [-935.517] -- 0:00:22
677000 -- [-936.786] (-939.966) (-934.994) (-942.944) * (-937.363) [-939.688] (-936.983) (-937.903) -- 0:00:22
677500 -- (-935.656) [-936.195] (-938.419) (-936.288) * (-936.513) [-940.638] (-935.904) (-941.118) -- 0:00:22
678000 -- [-937.631] (-936.810) (-940.724) (-937.273) * (-937.024) (-937.681) (-935.620) [-935.525] -- 0:00:22
678500 -- (-936.413) (-935.613) (-939.140) [-938.503] * (-936.242) (-939.105) (-938.744) [-936.724] -- 0:00:22
679000 -- (-936.959) [-935.613] (-938.945) (-937.728) * [-938.106] (-938.490) (-936.496) (-938.389) -- 0:00:22
679500 -- (-935.822) (-939.022) (-935.284) [-935.730] * [-939.394] (-935.223) (-935.747) (-939.247) -- 0:00:22
680000 -- (-936.114) (-936.478) (-937.025) [-937.286] * (-937.388) [-935.538] (-936.776) (-935.910) -- 0:00:22
Average standard deviation of split frequencies: 0.012303
680500 -- (-936.765) [-937.714] (-935.455) (-936.241) * (-938.891) [-937.686] (-938.791) (-935.227) -- 0:00:22
681000 -- (-936.558) [-937.746] (-935.845) (-935.914) * (-937.898) [-935.744] (-938.351) (-938.288) -- 0:00:22
681500 -- (-937.142) (-936.253) [-934.945] (-936.866) * (-935.092) [-936.386] (-941.054) (-942.764) -- 0:00:22
682000 -- (-935.055) (-942.888) [-935.903] (-936.036) * [-936.689] (-936.759) (-938.896) (-940.517) -- 0:00:22
682500 -- (-935.700) (-938.765) (-935.183) [-939.074] * (-937.779) (-936.541) (-937.260) [-939.278] -- 0:00:22
683000 -- (-935.244) (-938.236) (-935.968) [-936.425] * (-936.094) [-937.610] (-937.634) (-939.831) -- 0:00:22
683500 -- [-937.723] (-938.987) (-936.847) (-935.341) * (-936.954) [-936.916] (-940.655) (-938.509) -- 0:00:22
684000 -- (-937.794) (-935.672) [-937.700] (-938.206) * (-936.093) (-937.767) [-935.302] (-938.365) -- 0:00:22
684500 -- (-938.421) [-936.436] (-935.822) (-936.385) * [-939.184] (-935.926) (-935.566) (-937.044) -- 0:00:22
685000 -- (-938.009) [-936.443] (-940.243) (-936.327) * (-935.417) (-935.311) (-937.283) [-935.335] -- 0:00:22
Average standard deviation of split frequencies: 0.011925
685500 -- [-939.840] (-939.595) (-940.932) (-935.869) * (-935.718) (-936.499) (-945.474) [-936.888] -- 0:00:22
686000 -- (-939.098) (-937.998) (-941.139) [-936.048] * (-937.308) (-936.126) [-935.904] (-936.753) -- 0:00:21
686500 -- [-935.726] (-940.549) (-937.878) (-937.893) * (-937.922) [-936.579] (-937.895) (-935.752) -- 0:00:21
687000 -- (-935.191) (-937.149) [-939.111] (-935.201) * [-935.369] (-936.686) (-939.357) (-935.136) -- 0:00:21
687500 -- (-939.722) (-936.580) [-939.428] (-937.312) * [-935.909] (-941.295) (-937.628) (-937.062) -- 0:00:21
688000 -- (-934.889) (-939.887) (-937.810) [-935.407] * (-936.309) (-940.879) [-935.943] (-937.213) -- 0:00:21
688500 -- [-937.319] (-939.565) (-936.493) (-936.771) * (-936.501) (-941.905) [-936.819] (-938.222) -- 0:00:21
689000 -- (-935.170) (-939.176) (-939.318) [-935.816] * (-935.779) (-942.023) (-935.497) [-938.066] -- 0:00:21
689500 -- (-938.675) (-939.209) (-937.326) [-936.340] * (-937.044) [-935.552] (-936.307) (-940.139) -- 0:00:22
690000 -- (-936.651) (-935.794) (-940.108) [-936.347] * [-935.928] (-939.485) (-936.703) (-939.913) -- 0:00:22
Average standard deviation of split frequencies: 0.011844
690500 -- (-937.189) [-935.301] (-935.829) (-937.599) * (-935.035) (-936.300) (-940.274) [-938.444] -- 0:00:21
691000 -- (-936.756) (-935.764) (-937.391) [-935.617] * [-935.185] (-937.016) (-936.554) (-939.734) -- 0:00:21
691500 -- (-938.061) (-945.162) (-936.105) [-937.640] * [-937.279] (-936.157) (-935.962) (-939.314) -- 0:00:21
692000 -- (-937.163) (-938.023) (-936.149) [-935.657] * (-936.027) (-935.100) [-937.437] (-938.380) -- 0:00:21
692500 -- (-936.197) (-936.986) (-935.199) [-936.744] * (-938.439) (-936.317) (-941.047) [-936.599] -- 0:00:21
693000 -- (-935.131) [-937.097] (-937.313) (-940.133) * (-937.413) (-935.242) [-936.613] (-936.442) -- 0:00:21
693500 -- (-934.979) (-937.388) (-939.327) [-942.065] * (-937.099) [-935.642] (-936.003) (-935.106) -- 0:00:21
694000 -- (-938.973) [-936.429] (-936.106) (-936.666) * (-936.407) (-935.273) (-935.647) [-935.794] -- 0:00:21
694500 -- (-936.308) (-935.118) [-936.246] (-937.518) * (-937.660) (-938.313) (-936.724) [-939.664] -- 0:00:21
695000 -- (-936.281) (-935.175) (-937.378) [-935.509] * (-940.606) (-937.324) [-936.144] (-941.412) -- 0:00:21
Average standard deviation of split frequencies: 0.011873
695500 -- (-936.360) [-935.269] (-940.762) (-936.596) * [-938.566] (-936.425) (-935.731) (-938.365) -- 0:00:21
696000 -- (-938.448) (-941.951) [-937.012] (-935.198) * (-943.866) [-936.507] (-936.971) (-940.377) -- 0:00:21
696500 -- (-938.506) (-936.257) (-935.205) [-935.918] * (-941.606) [-935.882] (-936.975) (-935.942) -- 0:00:21
697000 -- (-938.246) (-937.103) [-935.076] (-937.412) * (-935.820) (-939.547) (-936.097) [-936.338] -- 0:00:21
697500 -- (-937.813) (-937.928) (-935.038) [-935.661] * (-936.399) [-938.799] (-941.668) (-937.325) -- 0:00:21
698000 -- [-937.307] (-937.176) (-939.392) (-935.809) * (-938.962) [-935.737] (-937.250) (-936.949) -- 0:00:21
698500 -- (-937.170) [-937.292] (-940.197) (-936.258) * (-939.401) [-935.995] (-937.324) (-935.814) -- 0:00:21
699000 -- [-936.763] (-935.747) (-936.478) (-939.372) * [-937.057] (-935.650) (-941.156) (-934.876) -- 0:00:21
699500 -- (-935.483) (-935.728) (-936.393) [-938.408] * (-937.454) [-936.398] (-939.567) (-936.543) -- 0:00:21
700000 -- (-937.127) (-936.851) (-936.441) [-936.550] * (-936.892) (-938.006) (-937.094) [-936.543] -- 0:00:20
Average standard deviation of split frequencies: 0.012150
700500 -- (-935.557) [-936.827] (-938.605) (-940.111) * [-937.030] (-937.040) (-937.498) (-938.697) -- 0:00:20
701000 -- [-940.598] (-939.460) (-940.117) (-937.600) * (-935.819) [-937.372] (-938.862) (-936.351) -- 0:00:20
701500 -- (-936.732) (-937.237) (-941.946) [-935.285] * (-935.944) [-938.069] (-938.213) (-937.735) -- 0:00:20
702000 -- (-936.733) (-935.911) [-939.429] (-940.734) * (-936.399) [-937.980] (-937.568) (-940.090) -- 0:00:20
702500 -- [-936.904] (-936.564) (-938.121) (-938.425) * (-936.164) (-940.743) (-937.242) [-939.797] -- 0:00:20
703000 -- (-940.862) (-936.882) [-936.941] (-936.826) * (-938.119) (-939.459) (-939.546) [-938.028] -- 0:00:20
703500 -- (-937.687) (-941.836) [-937.838] (-942.163) * [-937.084] (-937.523) (-936.393) (-936.902) -- 0:00:20
704000 -- (-941.004) (-937.764) [-934.957] (-937.918) * (-938.842) [-939.037] (-937.682) (-938.897) -- 0:00:21
704500 -- (-941.394) (-939.185) (-936.461) [-937.645] * [-936.679] (-938.658) (-936.504) (-936.305) -- 0:00:20
705000 -- (-935.573) [-936.662] (-935.829) (-936.743) * (-944.907) (-938.864) [-935.555] (-936.742) -- 0:00:20
Average standard deviation of split frequencies: 0.011783
705500 -- (-936.862) (-937.181) (-936.320) [-939.728] * (-939.615) (-940.218) [-936.218] (-936.229) -- 0:00:20
706000 -- (-938.511) [-936.635] (-942.942) (-940.136) * (-935.025) [-935.788] (-936.845) (-934.824) -- 0:00:20
706500 -- [-935.459] (-936.067) (-936.420) (-940.609) * (-939.089) (-936.042) [-935.639] (-935.934) -- 0:00:20
707000 -- (-935.524) [-937.004] (-935.991) (-938.987) * (-939.652) (-935.701) (-936.247) [-937.721] -- 0:00:20
707500 -- [-936.244] (-940.154) (-937.748) (-938.222) * (-944.018) [-935.373] (-938.414) (-935.826) -- 0:00:20
708000 -- [-936.644] (-937.639) (-936.472) (-938.709) * (-938.311) (-936.979) [-935.303] (-942.566) -- 0:00:20
708500 -- (-934.938) (-937.818) (-935.087) [-935.605] * [-935.495] (-942.037) (-935.406) (-937.103) -- 0:00:20
709000 -- (-936.870) [-936.504] (-943.603) (-938.070) * (-936.678) (-936.830) [-936.155] (-938.518) -- 0:00:20
709500 -- (-935.230) [-935.793] (-938.555) (-937.319) * (-936.202) (-936.151) (-936.610) [-936.605] -- 0:00:20
710000 -- (-935.735) [-936.136] (-937.987) (-937.962) * (-936.171) [-937.212] (-936.697) (-936.168) -- 0:00:20
Average standard deviation of split frequencies: 0.011394
710500 -- [-935.420] (-936.873) (-938.808) (-938.113) * (-941.157) (-938.388) [-936.233] (-937.755) -- 0:00:20
711000 -- (-942.358) (-937.455) [-938.077] (-938.078) * (-936.588) [-935.308] (-945.032) (-938.937) -- 0:00:20
711500 -- (-938.228) (-942.051) (-938.476) [-934.744] * (-936.489) (-936.156) [-937.021] (-935.797) -- 0:00:20
712000 -- [-936.580] (-937.507) (-936.574) (-937.074) * (-936.535) (-937.485) (-939.951) [-937.800] -- 0:00:20
712500 -- (-945.682) (-937.797) (-938.687) [-936.706] * [-935.229] (-940.340) (-940.295) (-937.318) -- 0:00:20
713000 -- [-935.689] (-939.768) (-936.410) (-935.601) * [-935.270] (-939.138) (-937.111) (-943.188) -- 0:00:20
713500 -- [-934.641] (-935.107) (-935.285) (-940.145) * [-935.356] (-937.220) (-935.661) (-936.342) -- 0:00:20
714000 -- [-935.570] (-941.057) (-935.227) (-936.123) * (-939.640) (-936.969) [-935.702] (-937.735) -- 0:00:20
714500 -- (-937.327) (-940.320) [-937.871] (-935.603) * [-938.008] (-939.719) (-938.471) (-936.434) -- 0:00:19
715000 -- [-937.346] (-937.570) (-936.019) (-937.554) * (-936.996) (-939.141) [-941.201] (-935.864) -- 0:00:19
Average standard deviation of split frequencies: 0.011154
715500 -- (-936.725) [-937.305] (-939.077) (-937.458) * (-936.759) [-938.393] (-935.563) (-938.507) -- 0:00:19
716000 -- (-938.064) [-935.407] (-937.183) (-936.220) * (-940.821) (-936.359) (-934.898) [-939.136] -- 0:00:19
716500 -- (-936.378) (-935.896) (-939.993) [-935.106] * [-936.044] (-937.110) (-938.506) (-938.928) -- 0:00:19
717000 -- (-938.731) [-936.336] (-939.626) (-937.805) * [-935.761] (-937.410) (-936.897) (-937.094) -- 0:00:19
717500 -- (-935.113) (-940.121) (-937.055) [-936.974] * [-934.994] (-941.188) (-938.750) (-935.643) -- 0:00:19
718000 -- [-936.144] (-941.551) (-937.599) (-936.218) * (-935.877) (-939.845) (-937.676) [-936.331] -- 0:00:19
718500 -- (-936.269) (-940.122) (-938.239) [-936.764] * (-936.566) (-936.580) (-936.591) [-935.405] -- 0:00:19
719000 -- (-936.326) (-935.842) [-936.691] (-937.245) * [-936.640] (-936.822) (-938.666) (-934.960) -- 0:00:19
719500 -- [-936.904] (-938.663) (-936.882) (-937.282) * [-939.500] (-937.355) (-939.337) (-935.828) -- 0:00:19
720000 -- (-937.222) [-936.692] (-938.502) (-935.907) * (-943.539) (-935.566) [-936.169] (-938.091) -- 0:00:19
Average standard deviation of split frequencies: 0.010658
720500 -- (-937.400) (-937.176) (-940.372) [-935.653] * (-938.774) (-938.508) (-936.254) [-936.598] -- 0:00:19
721000 -- [-936.578] (-935.824) (-937.613) (-936.436) * (-938.654) [-938.371] (-936.281) (-935.492) -- 0:00:19
721500 -- (-937.222) (-935.905) (-935.125) [-937.834] * (-936.917) (-937.236) (-939.541) [-938.014] -- 0:00:19
722000 -- (-938.782) [-935.931] (-935.863) (-938.602) * (-938.246) [-935.126] (-935.728) (-936.282) -- 0:00:19
722500 -- (-940.237) (-938.563) [-936.720] (-935.778) * (-935.643) (-937.086) (-936.410) [-935.763] -- 0:00:19
723000 -- (-940.861) (-937.630) [-936.804] (-935.332) * (-936.404) (-939.760) [-938.158] (-935.790) -- 0:00:19
723500 -- (-937.557) (-939.196) (-936.624) [-936.108] * [-938.603] (-936.186) (-937.195) (-935.738) -- 0:00:19
724000 -- [-938.334] (-935.540) (-936.596) (-936.529) * (-938.859) (-936.267) [-940.986] (-935.385) -- 0:00:19
724500 -- (-934.851) (-935.648) [-939.284] (-936.888) * (-939.525) [-936.556] (-936.555) (-938.114) -- 0:00:19
725000 -- (-938.977) (-938.330) (-936.764) [-935.395] * (-935.857) (-935.601) [-936.192] (-935.918) -- 0:00:19
Average standard deviation of split frequencies: 0.010771
725500 -- (-938.638) [-937.875] (-939.199) (-935.823) * [-937.962] (-938.680) (-938.360) (-935.755) -- 0:00:19
726000 -- [-939.554] (-936.041) (-937.923) (-936.274) * (-935.329) (-940.139) [-936.410] (-935.606) -- 0:00:19
726500 -- (-939.399) (-938.700) (-937.429) [-937.065] * [-935.571] (-937.493) (-936.061) (-937.447) -- 0:00:19
727000 -- (-936.263) [-935.779] (-939.929) (-936.105) * (-941.425) (-938.385) [-940.022] (-937.364) -- 0:00:19
727500 -- (-936.406) (-937.105) (-937.678) [-944.734] * [-937.058] (-939.676) (-943.246) (-938.930) -- 0:00:19
728000 -- [-938.381] (-938.655) (-937.870) (-935.469) * (-937.249) (-937.513) [-940.566] (-939.082) -- 0:00:19
728500 -- (-935.364) (-937.121) [-938.088] (-940.209) * (-939.119) [-940.211] (-937.141) (-941.057) -- 0:00:19
729000 -- (-936.998) [-935.936] (-938.190) (-936.827) * (-935.418) [-938.106] (-936.467) (-936.883) -- 0:00:18
729500 -- (-936.002) [-937.357] (-936.932) (-935.947) * [-937.103] (-939.612) (-936.951) (-935.615) -- 0:00:18
730000 -- (-936.021) (-936.478) (-938.369) [-937.452] * (-938.804) [-937.548] (-935.071) (-938.491) -- 0:00:18
Average standard deviation of split frequencies: 0.010930
730500 -- (-937.673) (-936.270) [-935.687] (-936.517) * (-936.854) (-936.173) (-937.701) [-937.585] -- 0:00:18
731000 -- (-937.041) (-936.166) (-936.731) [-935.708] * [-937.016] (-939.463) (-935.091) (-937.359) -- 0:00:18
731500 -- (-938.440) (-935.288) (-935.652) [-937.870] * (-937.174) [-937.271] (-937.258) (-935.851) -- 0:00:18
732000 -- (-939.040) (-935.776) (-935.953) [-936.257] * (-939.668) (-937.262) [-935.223] (-938.297) -- 0:00:18
732500 -- (-936.477) (-937.008) (-936.418) [-938.977] * (-935.102) [-936.529] (-935.293) (-939.831) -- 0:00:18
733000 -- (-938.982) (-937.055) [-940.125] (-936.392) * (-938.711) (-938.435) (-934.733) [-936.308] -- 0:00:18
733500 -- (-937.101) (-936.586) [-937.384] (-937.017) * (-937.797) (-935.013) [-935.461] (-937.325) -- 0:00:18
734000 -- [-941.518] (-941.508) (-936.895) (-935.643) * [-936.315] (-938.202) (-937.731) (-936.138) -- 0:00:18
734500 -- (-940.667) (-940.067) [-937.138] (-935.963) * (-935.346) [-938.466] (-937.789) (-936.595) -- 0:00:18
735000 -- (-935.367) (-937.757) (-935.970) [-938.316] * [-935.122] (-937.502) (-935.778) (-936.465) -- 0:00:18
Average standard deviation of split frequencies: 0.010888
735500 -- [-936.225] (-939.482) (-935.428) (-936.922) * (-935.126) [-939.566] (-937.605) (-938.447) -- 0:00:18
736000 -- [-936.399] (-938.192) (-937.306) (-937.006) * (-935.301) [-936.583] (-937.497) (-940.080) -- 0:00:18
736500 -- (-937.419) (-938.106) (-938.276) [-940.165] * (-943.362) (-940.907) (-936.539) [-941.359] -- 0:00:18
737000 -- [-936.066] (-935.870) (-939.569) (-941.461) * [-938.527] (-944.805) (-939.569) (-940.242) -- 0:00:18
737500 -- [-938.202] (-936.544) (-936.492) (-941.231) * (-936.669) (-936.749) [-940.682] (-936.150) -- 0:00:18
738000 -- (-936.919) (-935.197) (-938.350) [-934.947] * [-936.454] (-937.071) (-938.280) (-937.002) -- 0:00:18
738500 -- (-937.493) (-936.517) [-939.266] (-936.750) * (-938.151) (-937.706) (-939.491) [-934.917] -- 0:00:18
739000 -- [-937.775] (-938.231) (-936.085) (-940.850) * (-941.690) [-936.680] (-939.159) (-934.950) -- 0:00:18
739500 -- [-938.672] (-936.986) (-935.322) (-937.795) * (-940.946) (-941.116) (-937.106) [-936.648] -- 0:00:18
740000 -- [-936.303] (-939.200) (-935.417) (-936.810) * (-937.661) [-936.930] (-937.800) (-936.783) -- 0:00:18
Average standard deviation of split frequencies: 0.010108
740500 -- [-937.723] (-936.982) (-937.873) (-936.318) * (-935.595) (-942.412) (-935.950) [-936.593] -- 0:00:18
741000 -- (-934.779) (-937.344) (-941.386) [-948.565] * [-935.413] (-937.995) (-937.468) (-935.879) -- 0:00:18
741500 -- (-934.797) (-934.819) [-936.020] (-935.607) * (-935.382) (-938.864) (-936.363) [-936.466] -- 0:00:18
742000 -- (-934.788) (-939.287) (-936.485) [-934.662] * [-935.065] (-935.562) (-937.228) (-938.390) -- 0:00:18
742500 -- [-939.606] (-940.629) (-937.113) (-935.530) * [-936.668] (-935.069) (-935.653) (-935.161) -- 0:00:18
743000 -- (-938.934) (-938.313) [-935.495] (-937.558) * (-935.402) (-935.180) (-935.399) [-935.404] -- 0:00:17
743500 -- (-935.879) [-938.046] (-937.940) (-940.853) * [-939.998] (-937.681) (-936.270) (-937.270) -- 0:00:17
744000 -- (-936.444) [-936.988] (-939.781) (-936.192) * (-937.062) (-934.960) [-936.354] (-936.584) -- 0:00:17
744500 -- (-939.601) (-935.867) [-935.169] (-937.605) * (-940.535) (-935.449) [-935.507] (-938.459) -- 0:00:17
745000 -- (-935.342) (-937.506) [-937.062] (-943.473) * [-935.482] (-937.663) (-937.523) (-937.286) -- 0:00:17
Average standard deviation of split frequencies: 0.009962
745500 -- (-936.190) (-937.295) [-937.484] (-948.317) * [-935.269] (-935.772) (-937.308) (-935.974) -- 0:00:17
746000 -- (-937.782) [-937.943] (-938.031) (-936.799) * (-936.629) (-935.436) (-937.723) [-935.811] -- 0:00:17
746500 -- (-939.800) (-936.198) [-935.533] (-936.654) * (-936.206) [-935.422] (-935.227) (-939.536) -- 0:00:17
747000 -- (-939.402) (-936.126) [-935.808] (-939.359) * [-936.070] (-940.166) (-938.717) (-942.171) -- 0:00:17
747500 -- (-936.172) (-935.540) [-936.795] (-939.685) * [-936.686] (-935.392) (-937.196) (-944.296) -- 0:00:17
748000 -- (-939.013) (-936.492) [-935.569] (-940.993) * [-937.602] (-936.095) (-938.586) (-939.246) -- 0:00:17
748500 -- (-937.059) (-937.254) (-935.732) [-943.397] * (-938.781) (-937.049) [-942.254] (-936.456) -- 0:00:17
749000 -- [-936.160] (-937.401) (-936.178) (-939.787) * (-938.490) (-935.365) (-936.175) [-935.713] -- 0:00:17
749500 -- (-939.355) [-935.684] (-938.162) (-940.961) * (-937.608) (-936.802) [-938.243] (-940.777) -- 0:00:17
750000 -- [-936.831] (-936.218) (-936.738) (-938.048) * (-936.265) [-936.641] (-937.224) (-937.261) -- 0:00:17
Average standard deviation of split frequencies: 0.009789
750500 -- (-940.241) (-936.068) [-938.869] (-941.524) * (-936.909) [-936.312] (-939.259) (-939.750) -- 0:00:17
751000 -- (-940.669) [-936.433] (-935.958) (-939.366) * (-936.261) (-936.761) (-936.424) [-938.907] -- 0:00:17
751500 -- (-936.145) [-936.183] (-938.749) (-937.164) * (-938.179) (-935.702) [-940.776] (-936.677) -- 0:00:17
752000 -- (-936.793) (-937.576) [-937.026] (-936.534) * (-936.849) (-936.958) [-937.941] (-940.156) -- 0:00:17
752500 -- (-936.036) [-937.064] (-936.930) (-937.277) * (-935.647) (-937.406) (-935.058) [-940.786] -- 0:00:17
753000 -- (-941.443) (-937.745) [-936.603] (-940.542) * [-937.583] (-938.176) (-939.167) (-939.905) -- 0:00:17
753500 -- (-938.508) (-936.522) [-935.062] (-937.880) * [-937.463] (-936.608) (-940.014) (-940.270) -- 0:00:17
754000 -- (-935.504) (-937.529) [-935.972] (-941.666) * [-937.321] (-939.032) (-936.534) (-936.827) -- 0:00:17
754500 -- (-938.595) [-936.521] (-937.311) (-938.497) * (-937.311) (-936.729) [-935.793] (-937.470) -- 0:00:17
755000 -- (-937.434) [-937.357] (-937.327) (-937.455) * (-935.281) (-939.432) (-936.885) [-936.582] -- 0:00:17
Average standard deviation of split frequencies: 0.009243
755500 -- [-935.633] (-938.203) (-937.059) (-935.935) * (-936.564) (-938.875) [-936.704] (-937.219) -- 0:00:17
756000 -- [-935.702] (-936.439) (-937.716) (-938.772) * (-938.656) [-937.205] (-936.385) (-937.064) -- 0:00:17
756500 -- (-939.375) [-937.774] (-936.602) (-935.671) * (-936.960) (-935.591) [-942.218] (-938.074) -- 0:00:17
757000 -- (-935.720) (-935.704) [-936.300] (-937.148) * (-936.617) (-938.620) (-942.946) [-936.641] -- 0:00:17
757500 -- (-940.365) [-934.657] (-938.172) (-940.724) * (-936.175) (-938.590) (-936.090) [-937.029] -- 0:00:16
758000 -- (-935.896) (-935.750) [-935.971] (-941.255) * (-935.435) (-937.323) [-935.909] (-937.200) -- 0:00:16
758500 -- (-934.730) [-935.666] (-937.857) (-938.259) * (-935.049) (-934.756) [-934.958] (-937.838) -- 0:00:16
759000 -- (-936.452) (-935.714) (-940.591) [-935.022] * (-937.905) (-935.478) [-935.037] (-937.556) -- 0:00:16
759500 -- [-935.967] (-937.271) (-936.496) (-935.688) * (-940.787) (-938.435) [-935.881] (-936.057) -- 0:00:16
760000 -- [-936.022] (-936.052) (-941.105) (-936.465) * (-937.242) (-936.756) [-937.344] (-936.961) -- 0:00:16
Average standard deviation of split frequencies: 0.009114
760500 -- (-935.328) [-937.606] (-937.845) (-935.217) * (-938.390) (-936.709) (-938.809) [-940.990] -- 0:00:16
761000 -- (-936.051) (-936.460) (-937.439) [-941.458] * (-935.550) (-940.300) (-937.347) [-935.801] -- 0:00:16
761500 -- (-935.771) (-935.357) (-937.533) [-936.719] * (-935.240) (-936.862) [-937.193] (-940.469) -- 0:00:16
762000 -- [-935.597] (-935.185) (-937.078) (-938.018) * [-935.010] (-936.474) (-937.665) (-939.497) -- 0:00:16
762500 -- (-938.599) (-941.659) [-936.265] (-936.902) * (-937.895) [-936.068] (-936.006) (-937.080) -- 0:00:16
763000 -- (-936.402) (-940.498) (-939.153) [-939.755] * (-936.442) [-935.882] (-935.866) (-938.403) -- 0:00:16
763500 -- (-936.209) [-934.784] (-940.157) (-940.509) * (-935.102) (-935.826) [-938.600] (-936.844) -- 0:00:16
764000 -- (-936.266) (-936.146) (-939.460) [-939.562] * [-938.554] (-938.230) (-936.832) (-936.864) -- 0:00:16
764500 -- [-937.501] (-936.913) (-935.409) (-941.064) * (-936.663) (-936.907) (-935.843) [-936.561] -- 0:00:16
765000 -- (-936.982) [-939.169] (-934.819) (-936.434) * (-936.592) (-937.175) (-938.460) [-937.068] -- 0:00:16
Average standard deviation of split frequencies: 0.009123
765500 -- (-935.041) (-934.972) (-936.659) [-937.024] * (-936.494) (-936.143) [-939.078] (-937.543) -- 0:00:16
766000 -- (-940.764) [-935.664] (-936.538) (-935.553) * (-936.220) [-936.375] (-938.599) (-937.224) -- 0:00:16
766500 -- (-938.022) (-936.344) [-936.243] (-935.879) * (-936.320) (-938.594) [-935.769] (-936.125) -- 0:00:16
767000 -- (-939.815) (-937.242) [-937.490] (-936.364) * (-935.832) (-936.635) (-935.805) [-936.733] -- 0:00:16
767500 -- (-935.738) (-935.921) [-937.697] (-945.469) * (-935.842) [-939.067] (-936.022) (-937.003) -- 0:00:16
768000 -- (-936.369) (-942.884) (-936.624) [-936.183] * (-942.913) [-937.117] (-936.373) (-938.211) -- 0:00:16
768500 -- [-935.499] (-939.327) (-936.365) (-935.953) * (-937.039) (-935.680) [-938.958] (-937.584) -- 0:00:16
769000 -- (-935.458) (-939.895) (-939.577) [-941.040] * (-937.420) [-936.340] (-938.503) (-937.216) -- 0:00:16
769500 -- (-936.866) [-940.480] (-938.167) (-943.785) * [-941.655] (-937.613) (-938.789) (-938.910) -- 0:00:16
770000 -- (-935.481) (-938.342) [-937.131] (-939.312) * (-939.319) [-935.713] (-937.121) (-935.453) -- 0:00:16
Average standard deviation of split frequencies: 0.009247
770500 -- [-936.475] (-937.896) (-937.904) (-937.801) * (-935.706) [-935.542] (-935.270) (-940.049) -- 0:00:16
771000 -- (-936.435) (-940.776) (-937.928) [-935.707] * (-937.304) [-935.534] (-936.723) (-935.634) -- 0:00:16
771500 -- [-935.455] (-938.091) (-935.390) (-936.438) * (-937.153) (-935.418) (-937.667) [-939.093] -- 0:00:15
772000 -- [-937.214] (-937.298) (-934.989) (-936.548) * (-939.289) (-936.200) [-939.311] (-937.739) -- 0:00:15
772500 -- (-937.212) (-936.812) (-936.789) [-936.626] * [-938.358] (-936.824) (-938.914) (-940.263) -- 0:00:15
773000 -- (-938.110) [-935.606] (-939.012) (-935.285) * (-936.990) (-937.871) [-936.250] (-936.918) -- 0:00:15
773500 -- (-938.335) (-944.086) (-939.822) [-935.145] * [-936.534] (-936.967) (-937.284) (-938.892) -- 0:00:15
774000 -- (-938.492) (-936.366) [-935.375] (-936.701) * (-937.203) [-939.982] (-936.988) (-936.400) -- 0:00:15
774500 -- (-940.707) (-935.176) (-935.148) [-936.362] * (-938.617) (-937.474) [-938.947] (-939.503) -- 0:00:15
775000 -- [-937.019] (-935.833) (-936.256) (-935.649) * (-937.461) [-935.776] (-935.649) (-940.089) -- 0:00:15
Average standard deviation of split frequencies: 0.009541
775500 -- (-940.756) (-936.801) [-937.565] (-937.359) * (-941.725) [-936.494] (-939.194) (-938.785) -- 0:00:15
776000 -- (-937.145) [-937.355] (-938.105) (-939.704) * (-940.861) (-936.037) (-938.855) [-937.057] -- 0:00:15
776500 -- [-935.552] (-935.283) (-935.416) (-939.841) * (-938.200) (-937.266) [-937.025] (-936.969) -- 0:00:15
777000 -- (-937.824) [-938.748] (-936.597) (-940.119) * (-937.178) [-935.908] (-936.457) (-935.628) -- 0:00:15
777500 -- (-940.821) (-938.756) (-937.638) [-937.494] * (-935.344) (-937.354) [-937.048] (-938.591) -- 0:00:15
778000 -- [-938.562] (-939.258) (-936.959) (-937.302) * (-942.017) (-935.416) (-938.584) [-936.486] -- 0:00:15
778500 -- (-936.327) [-937.154] (-935.454) (-937.029) * (-939.197) (-937.653) [-935.275] (-936.833) -- 0:00:15
779000 -- (-940.016) (-937.638) [-936.289] (-937.127) * (-934.958) (-940.091) [-936.797] (-937.915) -- 0:00:15
779500 -- [-936.865] (-938.250) (-937.098) (-936.065) * [-934.659] (-941.053) (-936.668) (-938.436) -- 0:00:15
780000 -- (-937.176) (-939.600) [-934.732] (-936.084) * (-934.793) (-936.288) [-935.510] (-938.967) -- 0:00:15
Average standard deviation of split frequencies: 0.009360
780500 -- [-936.383] (-938.247) (-937.272) (-938.114) * (-939.642) [-938.883] (-935.595) (-939.690) -- 0:00:15
781000 -- (-935.829) (-935.963) [-936.117] (-938.922) * [-938.466] (-938.362) (-934.942) (-938.966) -- 0:00:15
781500 -- (-937.931) [-937.059] (-938.028) (-935.289) * (-938.215) (-940.174) [-943.419] (-938.861) -- 0:00:15
782000 -- (-938.404) [-939.238] (-935.345) (-935.771) * (-934.887) (-938.197) [-935.495] (-935.381) -- 0:00:15
782500 -- [-935.634] (-937.087) (-936.285) (-941.614) * (-937.235) [-937.533] (-935.164) (-936.994) -- 0:00:15
783000 -- (-935.378) (-936.205) (-936.928) [-938.398] * (-935.501) (-938.533) (-938.402) [-937.650] -- 0:00:15
783500 -- (-938.401) (-935.589) (-936.389) [-935.732] * (-939.159) (-937.732) [-937.494] (-937.163) -- 0:00:15
784000 -- (-937.163) (-937.060) (-937.253) [-935.835] * (-937.222) (-940.729) [-938.179] (-935.569) -- 0:00:15
784500 -- (-935.889) [-935.824] (-937.966) (-937.773) * [-936.906] (-937.285) (-940.175) (-935.600) -- 0:00:15
785000 -- (-939.166) (-935.801) (-946.244) [-936.896] * [-935.459] (-936.736) (-940.286) (-935.860) -- 0:00:15
Average standard deviation of split frequencies: 0.009146
785500 -- (-935.839) [-936.058] (-936.991) (-936.773) * (-936.311) [-934.683] (-936.847) (-938.552) -- 0:00:15
786000 -- [-934.900] (-940.259) (-936.468) (-936.120) * (-939.369) [-935.360] (-937.894) (-939.905) -- 0:00:14
786500 -- [-935.508] (-936.535) (-935.623) (-937.284) * (-936.364) [-935.475] (-939.193) (-935.897) -- 0:00:14
787000 -- (-939.971) (-937.601) (-936.696) [-936.627] * (-936.048) (-937.662) [-936.214] (-936.611) -- 0:00:14
787500 -- (-937.118) (-935.141) [-935.782] (-935.827) * (-937.842) (-937.235) [-936.463] (-936.275) -- 0:00:14
788000 -- [-941.984] (-935.048) (-936.986) (-936.432) * (-936.678) (-938.274) [-937.763] (-943.550) -- 0:00:14
788500 -- [-936.892] (-937.664) (-938.430) (-937.863) * (-942.344) [-938.016] (-937.683) (-940.367) -- 0:00:14
789000 -- (-936.832) [-936.938] (-935.488) (-935.247) * [-935.104] (-942.489) (-939.211) (-936.458) -- 0:00:14
789500 -- (-937.869) (-935.055) (-939.569) [-935.332] * (-935.237) (-938.465) (-936.085) [-936.423] -- 0:00:14
790000 -- (-938.630) (-935.900) (-937.043) [-936.501] * (-938.907) (-936.116) (-941.698) [-935.174] -- 0:00:14
Average standard deviation of split frequencies: 0.009434
790500 -- (-935.187) [-938.723] (-935.900) (-936.890) * (-935.987) [-935.604] (-938.048) (-937.030) -- 0:00:14
791000 -- (-936.866) [-938.899] (-936.101) (-935.563) * (-935.703) [-936.161] (-935.654) (-935.057) -- 0:00:14
791500 -- (-938.734) (-935.846) (-938.938) [-935.226] * (-935.692) (-935.265) [-935.724] (-941.090) -- 0:00:14
792000 -- (-936.364) (-935.411) [-936.592] (-935.231) * (-934.891) (-936.339) [-937.402] (-936.456) -- 0:00:14
792500 -- (-936.753) (-937.906) [-936.747] (-935.575) * (-935.851) (-935.781) (-936.941) [-936.735] -- 0:00:14
793000 -- (-939.642) [-937.180] (-938.935) (-935.914) * (-935.823) [-938.903] (-937.583) (-936.014) -- 0:00:14
793500 -- (-936.656) [-936.169] (-935.955) (-935.707) * (-935.549) (-937.679) [-936.419] (-935.606) -- 0:00:14
794000 -- (-940.248) (-935.681) (-937.649) [-938.407] * (-936.326) (-938.715) (-936.138) [-936.154] -- 0:00:14
794500 -- (-939.165) (-935.346) [-935.684] (-935.363) * (-937.356) (-941.186) [-935.430] (-939.021) -- 0:00:14
795000 -- (-934.778) (-938.228) (-936.330) [-935.201] * [-939.334] (-937.005) (-938.516) (-938.799) -- 0:00:14
Average standard deviation of split frequencies: 0.009179
795500 -- (-937.147) (-936.501) (-940.274) [-935.078] * (-938.020) (-936.952) [-936.326] (-936.449) -- 0:00:14
796000 -- [-935.007] (-936.061) (-936.362) (-937.683) * (-937.041) (-938.146) (-937.529) [-938.110] -- 0:00:14
796500 -- (-937.745) [-938.321] (-935.932) (-936.663) * (-937.009) (-938.849) [-935.498] (-943.083) -- 0:00:14
797000 -- (-936.989) (-940.785) [-938.143] (-936.969) * (-938.195) (-935.283) [-936.381] (-938.315) -- 0:00:14
797500 -- (-936.278) (-941.085) (-937.053) [-938.326] * (-935.565) [-938.088] (-938.891) (-943.061) -- 0:00:14
798000 -- (-937.732) (-940.008) [-936.669] (-938.574) * (-939.781) (-937.384) [-936.835] (-940.136) -- 0:00:14
798500 -- (-936.474) (-935.503) (-936.211) [-937.361] * (-934.901) (-935.156) (-936.093) [-937.549] -- 0:00:14
799000 -- [-939.813] (-934.923) (-941.224) (-935.044) * (-935.620) (-938.553) [-937.972] (-936.048) -- 0:00:14
799500 -- (-939.010) (-936.586) (-940.787) [-938.140] * (-934.811) [-936.897] (-935.575) (-937.368) -- 0:00:14
800000 -- [-936.479] (-938.169) (-941.737) (-938.687) * (-936.329) (-939.295) [-939.703] (-937.392) -- 0:00:13
Average standard deviation of split frequencies: 0.009199
800500 -- [-937.396] (-938.592) (-936.002) (-937.180) * (-939.138) (-935.633) [-935.499] (-937.606) -- 0:00:13
801000 -- (-936.772) (-936.676) (-936.432) [-935.177] * (-936.643) (-936.135) (-937.274) [-939.636] -- 0:00:13
801500 -- (-936.086) (-937.140) (-934.867) [-935.168] * [-936.812] (-938.305) (-935.697) (-944.860) -- 0:00:13
802000 -- (-936.493) (-940.563) [-935.190] (-938.360) * (-940.148) [-940.392] (-938.283) (-936.481) -- 0:00:13
802500 -- (-935.044) (-938.394) (-937.840) [-936.079] * (-938.391) [-939.235] (-939.499) (-937.220) -- 0:00:13
803000 -- (-937.072) (-938.787) (-937.743) [-935.547] * (-939.239) (-937.763) (-935.482) [-936.729] -- 0:00:13
803500 -- [-936.553] (-938.670) (-936.632) (-935.130) * (-937.008) [-937.431] (-937.863) (-936.842) -- 0:00:13
804000 -- (-938.458) (-937.469) (-937.806) [-937.928] * (-935.950) [-935.899] (-938.056) (-936.285) -- 0:00:13
804500 -- (-937.224) (-937.003) (-935.145) [-936.382] * [-936.122] (-935.963) (-941.220) (-936.187) -- 0:00:13
805000 -- (-936.596) (-935.513) [-937.130] (-936.450) * [-937.438] (-935.296) (-936.219) (-939.834) -- 0:00:13
Average standard deviation of split frequencies: 0.009541
805500 -- (-938.503) (-937.592) (-938.186) [-937.375] * [-936.712] (-936.637) (-938.301) (-935.503) -- 0:00:13
806000 -- (-938.968) (-936.163) [-936.195] (-938.836) * (-939.681) (-936.778) (-937.805) [-935.218] -- 0:00:13
806500 -- (-938.963) [-936.353] (-943.311) (-938.824) * (-938.070) [-936.316] (-936.249) (-939.853) -- 0:00:13
807000 -- [-936.757] (-936.627) (-938.939) (-937.034) * (-935.176) (-938.359) [-936.236] (-944.250) -- 0:00:13
807500 -- (-939.390) (-935.318) [-937.048] (-935.240) * (-936.148) [-935.269] (-939.887) (-937.450) -- 0:00:13
808000 -- (-936.476) (-939.296) [-936.156] (-935.386) * (-935.919) (-936.051) (-938.244) [-936.664] -- 0:00:13
808500 -- (-936.004) (-935.755) (-936.192) [-937.396] * (-936.530) (-936.614) (-935.647) [-938.331] -- 0:00:13
809000 -- (-936.971) [-936.645] (-937.494) (-935.269) * [-937.833] (-935.338) (-935.994) (-935.562) -- 0:00:13
809500 -- [-940.077] (-937.255) (-935.701) (-938.047) * [-936.476] (-936.305) (-935.877) (-937.198) -- 0:00:13
810000 -- (-936.331) (-937.760) (-938.934) [-939.960] * (-937.929) (-936.123) (-935.310) [-936.866] -- 0:00:13
Average standard deviation of split frequencies: 0.009988
810500 -- (-935.533) (-937.681) (-935.758) [-940.560] * (-936.289) (-935.113) (-935.372) [-935.834] -- 0:00:13
811000 -- (-935.778) (-937.642) (-935.252) [-936.516] * (-936.891) [-936.311] (-936.079) (-935.716) -- 0:00:13
811500 -- (-936.887) (-937.603) [-937.954] (-935.914) * (-936.839) [-936.223] (-937.284) (-940.761) -- 0:00:13
812000 -- (-937.438) [-935.443] (-935.689) (-935.639) * (-935.490) (-941.003) [-936.771] (-936.724) -- 0:00:13
812500 -- (-939.096) [-936.206] (-937.461) (-936.303) * [-936.665] (-936.248) (-936.472) (-935.616) -- 0:00:13
813000 -- (-937.226) (-937.415) (-939.574) [-935.849] * [-935.555] (-936.558) (-935.698) (-934.730) -- 0:00:13
813500 -- [-936.649] (-935.875) (-938.494) (-939.600) * (-935.317) [-935.848] (-935.515) (-936.762) -- 0:00:13
814000 -- (-939.121) (-936.748) [-939.632] (-941.092) * (-936.934) [-938.915] (-936.137) (-936.159) -- 0:00:13
814500 -- (-945.570) (-936.511) [-938.066] (-936.421) * (-937.168) (-938.277) (-935.207) [-937.585] -- 0:00:12
815000 -- (-936.255) (-935.634) [-937.921] (-939.511) * (-937.605) [-937.486] (-936.310) (-938.715) -- 0:00:12
Average standard deviation of split frequencies: 0.010182
815500 -- (-935.269) [-936.886] (-937.183) (-937.582) * (-934.818) (-937.537) [-936.110] (-937.102) -- 0:00:12
816000 -- (-937.256) (-937.146) (-935.986) [-937.832] * (-937.074) (-940.853) (-936.308) [-936.158] -- 0:00:12
816500 -- (-938.715) [-936.299] (-936.844) (-935.764) * [-937.133] (-936.187) (-938.081) (-936.309) -- 0:00:12
817000 -- [-938.639] (-935.310) (-941.094) (-935.098) * [-935.422] (-935.608) (-937.272) (-937.927) -- 0:00:12
817500 -- [-936.049] (-942.945) (-935.978) (-938.739) * (-939.913) (-937.280) (-936.667) [-940.097] -- 0:00:12
818000 -- (-936.281) (-935.742) [-937.062] (-941.512) * (-936.499) [-937.965] (-936.565) (-935.489) -- 0:00:12
818500 -- (-940.315) [-935.772] (-937.464) (-937.067) * (-937.464) (-936.992) [-938.339] (-935.624) -- 0:00:12
819000 -- (-938.577) (-936.788) (-937.550) [-936.793] * (-934.800) (-938.285) [-938.752] (-938.053) -- 0:00:12
819500 -- (-941.345) [-938.684] (-935.441) (-936.369) * (-934.800) (-936.428) (-941.119) [-937.917] -- 0:00:12
820000 -- (-937.181) (-941.763) (-939.521) [-937.333] * [-934.724] (-939.063) (-938.520) (-935.574) -- 0:00:12
Average standard deviation of split frequencies: 0.010411
820500 -- [-936.605] (-935.719) (-936.913) (-937.705) * [-935.910] (-942.919) (-937.351) (-935.075) -- 0:00:12
821000 -- (-936.934) (-936.613) [-938.734] (-938.714) * (-935.288) (-941.911) (-939.548) [-937.309] -- 0:00:12
821500 -- [-935.628] (-939.183) (-936.147) (-937.086) * (-939.253) (-936.723) (-936.322) [-936.938] -- 0:00:12
822000 -- (-938.437) (-936.799) (-938.575) [-935.839] * [-937.706] (-938.398) (-940.051) (-937.361) -- 0:00:12
822500 -- [-939.330] (-937.550) (-939.927) (-935.697) * (-937.035) (-940.265) [-938.283] (-939.393) -- 0:00:12
823000 -- (-937.059) [-935.271] (-938.422) (-935.500) * (-942.701) (-936.872) [-936.402] (-936.569) -- 0:00:12
823500 -- [-941.965] (-935.704) (-936.229) (-935.531) * (-935.481) [-940.281] (-940.004) (-938.273) -- 0:00:12
824000 -- [-936.515] (-937.364) (-938.287) (-934.830) * (-936.943) (-938.802) [-938.381] (-936.809) -- 0:00:12
824500 -- [-939.289] (-936.515) (-938.405) (-934.819) * [-935.925] (-937.931) (-937.434) (-941.435) -- 0:00:12
825000 -- (-936.621) (-938.739) (-936.362) [-934.828] * [-936.374] (-936.755) (-942.715) (-938.067) -- 0:00:12
Average standard deviation of split frequencies: 0.010166
825500 -- (-936.663) [-935.606] (-936.328) (-936.492) * (-935.987) (-935.528) [-938.165] (-939.168) -- 0:00:12
826000 -- [-935.645] (-936.590) (-936.722) (-937.435) * (-937.670) [-937.786] (-935.443) (-942.371) -- 0:00:12
826500 -- (-937.683) [-938.430] (-936.498) (-939.519) * [-936.832] (-936.206) (-936.168) (-939.944) -- 0:00:12
827000 -- (-936.515) (-938.056) (-937.402) [-937.034] * (-934.949) [-935.286] (-936.208) (-939.070) -- 0:00:12
827500 -- [-940.375] (-939.228) (-936.279) (-935.658) * (-935.577) [-935.937] (-937.867) (-936.995) -- 0:00:12
828000 -- (-937.029) (-936.384) (-937.384) [-937.458] * (-936.205) [-935.689] (-937.972) (-938.836) -- 0:00:12
828500 -- (-935.548) (-936.768) (-938.619) [-939.624] * [-936.483] (-935.256) (-936.769) (-937.564) -- 0:00:12
829000 -- [-936.143] (-936.610) (-937.251) (-936.643) * (-935.786) (-934.896) [-938.821] (-936.987) -- 0:00:11
829500 -- [-936.043] (-935.461) (-938.791) (-937.091) * (-937.143) (-935.564) (-937.221) [-939.617] -- 0:00:11
830000 -- [-936.798] (-935.045) (-936.791) (-937.707) * (-936.138) (-936.170) [-937.164] (-939.886) -- 0:00:11
Average standard deviation of split frequencies: 0.010144
830500 -- [-936.899] (-937.014) (-936.780) (-936.204) * (-935.750) (-935.491) (-939.196) [-939.018] -- 0:00:11
831000 -- (-936.210) (-938.721) (-936.870) [-937.367] * [-937.120] (-936.627) (-937.759) (-939.964) -- 0:00:11
831500 -- [-936.720] (-940.330) (-935.291) (-938.503) * (-936.031) (-938.603) [-936.630] (-936.941) -- 0:00:11
832000 -- (-939.107) (-937.305) [-935.242] (-935.406) * [-937.593] (-940.085) (-937.026) (-940.326) -- 0:00:11
832500 -- (-936.001) (-935.623) [-935.363] (-937.278) * (-937.503) (-938.466) (-936.311) [-937.163] -- 0:00:11
833000 -- (-938.601) (-935.499) [-937.604] (-939.642) * (-939.505) (-936.975) (-941.461) [-936.182] -- 0:00:11
833500 -- (-935.761) [-935.709] (-936.042) (-936.367) * (-940.147) (-937.626) [-936.436] (-935.786) -- 0:00:11
834000 -- (-935.107) [-937.734] (-937.095) (-936.542) * (-940.573) (-935.205) (-937.211) [-941.559] -- 0:00:11
834500 -- (-936.176) (-938.204) [-937.155] (-936.417) * [-938.990] (-936.910) (-935.136) (-940.591) -- 0:00:11
835000 -- (-937.574) [-937.479] (-935.390) (-937.715) * (-938.266) [-935.973] (-938.733) (-941.436) -- 0:00:11
Average standard deviation of split frequencies: 0.010185
835500 -- (-936.244) [-937.203] (-939.429) (-940.286) * (-941.297) [-935.797] (-936.517) (-935.937) -- 0:00:11
836000 -- (-935.948) (-939.246) (-937.031) [-936.254] * [-944.059] (-935.564) (-938.711) (-938.431) -- 0:00:11
836500 -- (-937.482) (-937.824) (-935.482) [-936.463] * (-938.052) (-937.532) (-935.619) [-934.958] -- 0:00:11
837000 -- (-938.763) (-936.108) [-938.713] (-937.273) * [-938.501] (-935.873) (-937.053) (-935.586) -- 0:00:11
837500 -- [-937.135] (-935.908) (-936.772) (-934.904) * (-935.127) (-935.660) (-935.095) [-935.573] -- 0:00:11
838000 -- [-939.109] (-939.115) (-939.165) (-936.746) * (-937.148) (-935.439) [-935.440] (-937.668) -- 0:00:11
838500 -- (-936.353) (-936.053) [-935.505] (-936.808) * (-938.851) [-935.470] (-935.418) (-936.136) -- 0:00:11
839000 -- (-937.782) [-936.047] (-936.059) (-936.476) * (-941.720) (-936.982) [-938.440] (-938.036) -- 0:00:11
839500 -- (-935.406) [-935.967] (-936.665) (-938.037) * (-938.376) [-936.906] (-936.405) (-938.502) -- 0:00:11
840000 -- [-935.223] (-936.981) (-937.263) (-936.379) * (-936.585) (-939.462) (-936.336) [-936.933] -- 0:00:11
Average standard deviation of split frequencies: 0.010199
840500 -- (-937.995) (-935.562) (-935.881) [-936.866] * (-939.091) (-936.290) [-936.690] (-935.536) -- 0:00:11
841000 -- (-936.828) [-936.389] (-936.402) (-940.605) * [-940.556] (-938.321) (-936.599) (-940.247) -- 0:00:11
841500 -- [-936.853] (-935.720) (-935.556) (-936.904) * (-935.935) [-936.981] (-938.856) (-937.748) -- 0:00:11
842000 -- (-938.113) [-936.243] (-935.715) (-938.677) * (-937.204) (-936.551) (-937.267) [-935.490] -- 0:00:11
842500 -- (-938.663) [-937.707] (-936.018) (-941.145) * (-935.593) [-935.672] (-938.056) (-944.695) -- 0:00:11
843000 -- (-935.872) (-935.403) (-936.744) [-936.094] * [-935.144] (-937.094) (-941.312) (-937.044) -- 0:00:10
843500 -- (-934.850) (-935.126) [-937.337] (-936.563) * [-937.096] (-935.667) (-938.953) (-940.027) -- 0:00:10
844000 -- (-934.900) (-937.919) [-935.534] (-934.951) * (-937.589) (-939.612) [-936.752] (-936.351) -- 0:00:10
844500 -- (-939.785) (-935.806) (-942.779) [-936.122] * [-936.427] (-936.799) (-935.397) (-938.902) -- 0:00:10
845000 -- [-940.300] (-937.500) (-937.590) (-935.400) * (-937.853) (-935.536) (-935.278) [-938.990] -- 0:00:10
Average standard deviation of split frequencies: 0.010517
845500 -- [-943.043] (-936.737) (-938.173) (-937.728) * (-937.567) (-935.267) [-936.619] (-943.459) -- 0:00:10
846000 -- (-940.728) [-936.087] (-935.645) (-940.084) * [-935.400] (-936.851) (-935.858) (-940.762) -- 0:00:10
846500 -- [-936.099] (-937.148) (-936.982) (-943.048) * [-936.678] (-941.513) (-936.301) (-939.890) -- 0:00:10
847000 -- [-937.311] (-936.305) (-935.847) (-937.313) * (-937.192) (-937.029) [-937.741] (-937.709) -- 0:00:10
847500 -- (-935.966) [-935.473] (-938.173) (-935.774) * (-941.669) (-938.173) (-935.714) [-935.219] -- 0:00:10
848000 -- (-936.569) (-936.637) [-935.539] (-938.064) * [-942.384] (-939.034) (-935.715) (-936.069) -- 0:00:10
848500 -- (-935.776) (-938.306) [-935.490] (-937.000) * (-938.500) (-938.740) (-935.358) [-939.220] -- 0:00:10
849000 -- (-935.640) [-942.808] (-935.482) (-937.165) * (-936.670) (-936.971) [-938.163] (-935.739) -- 0:00:10
849500 -- [-935.055] (-937.783) (-935.756) (-936.803) * (-940.300) (-936.146) [-937.814] (-938.169) -- 0:00:10
850000 -- [-936.088] (-936.513) (-935.658) (-939.286) * [-936.775] (-937.264) (-937.145) (-938.833) -- 0:00:10
Average standard deviation of split frequencies: 0.010494
850500 -- [-937.171] (-939.645) (-936.801) (-936.939) * (-938.313) (-937.113) (-939.807) [-942.237] -- 0:00:10
851000 -- (-936.306) (-936.990) (-939.647) [-936.476] * (-935.327) [-938.472] (-936.073) (-943.125) -- 0:00:10
851500 -- (-936.149) (-938.050) (-936.940) [-936.864] * (-938.201) (-937.170) (-937.183) [-937.801] -- 0:00:10
852000 -- (-938.855) [-939.759] (-936.518) (-939.158) * (-936.572) (-940.840) [-939.267] (-938.187) -- 0:00:10
852500 -- (-936.445) (-938.152) (-937.287) [-935.266] * (-936.301) (-939.382) (-935.589) [-936.888] -- 0:00:10
853000 -- (-937.508) [-937.611] (-937.479) (-936.807) * (-936.820) (-938.800) [-937.527] (-937.928) -- 0:00:10
853500 -- (-935.994) (-935.820) [-934.884] (-937.059) * [-935.573] (-935.608) (-941.062) (-938.320) -- 0:00:10
854000 -- (-935.652) (-937.372) (-937.280) [-940.880] * (-936.381) (-937.300) [-937.135] (-935.505) -- 0:00:10
854500 -- [-935.652] (-938.634) (-935.894) (-938.274) * (-936.309) (-934.998) [-934.953] (-935.975) -- 0:00:10
855000 -- (-941.006) (-938.363) [-935.365] (-935.892) * [-936.166] (-936.807) (-935.581) (-937.091) -- 0:00:10
Average standard deviation of split frequencies: 0.010739
855500 -- [-937.198] (-937.308) (-937.857) (-936.845) * (-937.629) (-937.914) [-935.464] (-936.327) -- 0:00:10
856000 -- [-937.921] (-938.121) (-937.929) (-936.930) * [-938.036] (-939.697) (-935.546) (-936.497) -- 0:00:10
856500 -- [-937.485] (-937.410) (-939.601) (-941.193) * (-936.212) [-944.421] (-942.347) (-936.581) -- 0:00:10
857000 -- (-934.977) [-936.357] (-937.512) (-940.768) * (-937.471) (-939.264) (-939.993) [-938.417] -- 0:00:10
857500 -- (-939.503) (-936.065) (-938.864) [-937.615] * [-936.804] (-935.673) (-941.067) (-936.351) -- 0:00:09
858000 -- (-935.905) (-944.951) [-935.592] (-936.886) * (-936.519) [-934.903] (-937.655) (-935.733) -- 0:00:09
858500 -- (-936.046) (-937.410) [-937.089] (-937.836) * (-938.173) (-936.841) (-937.513) [-935.953] -- 0:00:09
859000 -- (-935.880) [-935.997] (-936.066) (-937.879) * (-937.179) [-937.679] (-936.188) (-936.132) -- 0:00:09
859500 -- (-937.855) (-937.773) (-938.166) [-936.087] * (-935.840) (-936.974) (-938.378) [-936.331] -- 0:00:09
860000 -- [-936.553] (-937.236) (-938.825) (-937.081) * (-935.991) [-938.866] (-935.164) (-940.636) -- 0:00:09
Average standard deviation of split frequencies: 0.010749
860500 -- (-940.318) (-936.104) (-935.661) [-937.158] * (-937.120) (-936.281) (-935.934) [-936.538] -- 0:00:09
861000 -- (-941.073) (-936.230) (-935.197) [-936.946] * [-936.479] (-936.929) (-939.087) (-935.914) -- 0:00:09
861500 -- (-935.578) (-935.189) (-936.383) [-936.810] * (-939.567) [-938.539] (-936.160) (-935.082) -- 0:00:09
862000 -- (-936.992) [-936.402] (-939.755) (-935.470) * (-937.684) (-937.133) (-935.238) [-935.082] -- 0:00:09
862500 -- (-939.015) (-941.220) (-939.988) [-938.734] * [-935.763] (-942.182) (-937.657) (-935.540) -- 0:00:09
863000 -- (-940.353) (-935.745) (-945.657) [-935.614] * (-937.787) [-937.278] (-941.858) (-937.958) -- 0:00:09
863500 -- (-936.007) (-936.783) (-937.222) [-935.905] * (-937.734) (-935.184) [-936.823] (-936.183) -- 0:00:09
864000 -- (-940.020) (-936.154) (-937.522) [-936.108] * (-935.734) [-935.894] (-937.519) (-935.984) -- 0:00:09
864500 -- (-936.653) (-937.371) [-935.390] (-935.961) * (-935.343) (-938.892) [-938.156] (-936.774) -- 0:00:09
865000 -- (-936.611) (-937.254) (-935.372) [-935.259] * (-937.233) [-938.363] (-942.048) (-936.680) -- 0:00:09
Average standard deviation of split frequencies: 0.010683
865500 -- (-938.922) [-936.749] (-938.524) (-935.117) * [-937.122] (-938.526) (-940.015) (-936.305) -- 0:00:09
866000 -- [-935.862] (-937.765) (-936.175) (-935.627) * [-936.418] (-937.351) (-940.435) (-936.082) -- 0:00:09
866500 -- (-935.718) (-942.653) (-946.747) [-936.256] * [-936.058] (-937.528) (-938.513) (-936.750) -- 0:00:09
867000 -- (-939.040) (-938.734) (-938.839) [-936.991] * (-938.880) (-935.713) [-935.472] (-938.896) -- 0:00:09
867500 -- (-939.228) (-939.801) [-934.748] (-936.799) * (-935.972) (-934.861) [-935.055] (-938.183) -- 0:00:09
868000 -- (-935.862) (-935.892) [-934.864] (-936.450) * (-935.909) (-939.617) (-937.431) [-936.934] -- 0:00:09
868500 -- (-936.198) [-936.362] (-934.840) (-936.805) * (-935.503) (-935.698) (-937.172) [-935.468] -- 0:00:09
869000 -- (-940.473) (-936.159) (-935.609) [-935.360] * (-937.795) [-936.047] (-937.433) (-935.363) -- 0:00:09
869500 -- (-937.811) (-936.031) (-937.354) [-935.942] * (-938.063) (-935.937) (-937.128) [-936.915] -- 0:00:09
870000 -- (-936.230) [-935.514] (-935.760) (-937.495) * (-939.496) [-938.998] (-937.380) (-935.661) -- 0:00:09
Average standard deviation of split frequencies: 0.010321
870500 -- (-935.912) (-938.131) [-936.560] (-940.055) * (-941.866) (-937.475) [-936.200] (-935.167) -- 0:00:09
871000 -- (-935.852) (-939.131) (-938.191) [-935.897] * (-937.930) (-936.090) [-935.946] (-937.963) -- 0:00:09
871500 -- (-936.946) [-935.907] (-935.894) (-941.569) * [-939.102] (-938.345) (-938.900) (-936.821) -- 0:00:08
872000 -- (-936.918) (-935.485) (-937.190) [-945.263] * (-936.353) (-938.029) (-938.050) [-940.505] -- 0:00:08
872500 -- (-936.946) (-935.699) (-935.268) [-937.050] * (-935.823) (-938.063) (-939.274) [-937.176] -- 0:00:08
873000 -- (-935.819) [-936.112] (-934.670) (-935.877) * (-937.415) (-934.978) [-935.958] (-938.041) -- 0:00:08
873500 -- [-935.641] (-937.825) (-936.625) (-938.395) * [-937.305] (-935.027) (-938.005) (-940.387) -- 0:00:08
874000 -- [-935.874] (-936.055) (-936.664) (-937.157) * (-938.344) (-935.494) (-939.669) [-939.734] -- 0:00:08
874500 -- (-937.374) (-936.503) (-939.312) [-937.500] * (-939.006) [-935.707] (-935.838) (-937.121) -- 0:00:08
875000 -- (-937.797) (-936.114) (-938.829) [-937.852] * [-939.016] (-937.133) (-935.078) (-936.289) -- 0:00:08
Average standard deviation of split frequencies: 0.010056
875500 -- (-941.025) [-935.196] (-938.263) (-936.982) * (-936.342) (-939.093) [-938.147] (-936.314) -- 0:00:08
876000 -- (-936.944) (-937.484) (-938.088) [-936.104] * (-938.511) (-936.544) (-936.626) [-937.310] -- 0:00:08
876500 -- (-937.415) (-937.456) [-936.130] (-936.385) * [-940.140] (-937.604) (-937.117) (-936.633) -- 0:00:08
877000 -- (-939.169) (-939.757) (-936.778) [-937.147] * (-938.325) (-943.006) [-936.138] (-939.296) -- 0:00:08
877500 -- (-936.757) (-936.662) [-935.153] (-938.558) * (-936.972) (-940.555) [-935.942] (-937.257) -- 0:00:08
878000 -- (-936.758) (-935.109) (-936.268) [-938.703] * (-936.864) [-938.472] (-937.800) (-936.398) -- 0:00:08
878500 -- (-935.929) (-936.396) [-937.271] (-936.169) * (-936.135) [-939.098] (-937.166) (-938.043) -- 0:00:08
879000 -- (-937.117) (-935.862) (-940.818) [-935.379] * (-935.370) [-938.545] (-938.627) (-937.326) -- 0:00:08
879500 -- (-939.910) (-936.899) (-937.499) [-935.900] * (-937.074) (-939.259) (-940.977) [-937.382] -- 0:00:08
880000 -- (-935.601) [-937.810] (-947.119) (-936.943) * [-936.971] (-939.584) (-936.948) (-937.587) -- 0:00:08
Average standard deviation of split frequencies: 0.009735
880500 -- (-938.123) (-937.722) (-939.199) [-938.484] * (-937.686) (-935.646) (-939.638) [-939.843] -- 0:00:08
881000 -- (-938.535) (-937.515) [-936.508] (-936.173) * (-936.770) [-938.974] (-937.338) (-939.715) -- 0:00:08
881500 -- (-936.846) (-938.071) [-938.882] (-934.680) * (-936.486) (-940.626) [-935.455] (-939.821) -- 0:00:08
882000 -- (-937.366) (-937.490) [-935.975] (-936.578) * (-936.141) (-936.330) (-936.864) [-936.232] -- 0:00:08
882500 -- (-937.487) (-936.431) [-935.904] (-939.106) * (-936.625) (-937.540) [-935.700] (-939.096) -- 0:00:08
883000 -- [-941.145] (-936.136) (-936.760) (-934.872) * (-936.958) [-937.153] (-936.345) (-936.785) -- 0:00:08
883500 -- (-937.952) (-937.348) [-940.327] (-936.775) * (-938.269) [-937.991] (-938.130) (-936.539) -- 0:00:08
884000 -- (-938.695) (-938.663) (-936.015) [-935.693] * (-940.055) [-938.625] (-938.153) (-936.543) -- 0:00:08
884500 -- (-938.914) [-937.326] (-941.746) (-936.438) * (-939.169) (-936.021) [-935.808] (-939.943) -- 0:00:08
885000 -- (-935.954) [-937.041] (-936.116) (-935.844) * (-937.815) (-936.281) [-935.574] (-939.818) -- 0:00:08
Average standard deviation of split frequencies: 0.009777
885500 -- (-945.318) (-943.707) [-936.076] (-938.522) * (-943.826) (-936.329) [-936.794] (-940.921) -- 0:00:08
886000 -- (-938.885) (-939.066) [-935.177] (-938.529) * (-935.984) (-936.056) (-935.075) [-936.830] -- 0:00:07
886500 -- [-939.759] (-938.345) (-935.372) (-936.127) * (-938.472) [-935.394] (-936.027) (-935.860) -- 0:00:07
887000 -- (-939.992) [-935.513] (-935.143) (-935.713) * (-936.811) (-936.101) (-935.389) [-937.468] -- 0:00:07
887500 -- (-937.330) (-936.342) (-939.811) [-936.633] * [-937.080] (-936.551) (-936.566) (-936.485) -- 0:00:07
888000 -- (-935.626) [-935.653] (-935.467) (-938.958) * (-936.163) (-937.130) (-936.406) [-936.993] -- 0:00:07
888500 -- (-935.536) (-935.946) [-935.040] (-937.969) * [-936.011] (-939.609) (-940.753) (-937.234) -- 0:00:07
889000 -- (-940.199) (-936.025) (-939.045) [-935.762] * (-938.229) (-935.977) [-941.896] (-942.434) -- 0:00:07
889500 -- [-937.609] (-936.720) (-937.057) (-938.356) * [-937.703] (-935.376) (-940.253) (-939.433) -- 0:00:07
890000 -- (-935.778) [-939.551] (-936.184) (-936.146) * (-937.850) (-940.666) (-938.139) [-938.299] -- 0:00:07
Average standard deviation of split frequencies: 0.009858
890500 -- (-935.572) (-936.723) [-936.649] (-938.419) * (-935.272) (-939.602) [-935.574] (-937.091) -- 0:00:07
891000 -- [-935.627] (-936.314) (-939.968) (-937.101) * (-935.348) [-938.330] (-936.443) (-939.236) -- 0:00:07
891500 -- (-942.503) (-937.357) (-938.839) [-937.950] * (-935.254) (-940.212) (-936.943) [-936.964] -- 0:00:07
892000 -- (-937.979) [-935.913] (-938.905) (-937.157) * (-937.832) (-938.508) [-935.486] (-934.675) -- 0:00:07
892500 -- (-936.558) (-939.215) [-940.461] (-937.513) * (-937.968) (-941.378) [-936.846] (-935.849) -- 0:00:07
893000 -- (-935.394) (-939.669) (-940.714) [-946.986] * (-936.192) (-939.614) (-938.902) [-936.590] -- 0:00:07
893500 -- (-935.506) (-937.380) [-936.585] (-941.560) * [-935.798] (-935.498) (-937.760) (-937.418) -- 0:00:07
894000 -- (-935.479) [-938.285] (-942.027) (-937.712) * (-938.259) [-935.991] (-939.406) (-936.698) -- 0:00:07
894500 -- (-938.636) (-938.904) (-939.435) [-936.104] * (-937.351) (-936.321) (-938.402) [-936.736] -- 0:00:07
895000 -- (-935.001) (-937.639) [-939.774] (-935.064) * [-936.031] (-935.749) (-938.135) (-936.629) -- 0:00:07
Average standard deviation of split frequencies: 0.009963
895500 -- [-935.842] (-938.426) (-936.341) (-939.475) * (-936.414) (-939.245) [-938.849] (-936.538) -- 0:00:07
896000 -- (-936.671) [-936.751] (-936.409) (-940.289) * [-937.383] (-936.490) (-942.288) (-936.491) -- 0:00:07
896500 -- [-936.093] (-936.294) (-938.033) (-937.257) * (-935.413) (-936.222) (-940.097) [-935.564] -- 0:00:07
897000 -- (-936.777) (-941.110) (-940.239) [-937.931] * (-940.728) [-935.687] (-939.999) (-936.220) -- 0:00:07
897500 -- (-939.928) (-939.228) [-935.796] (-935.884) * [-935.747] (-935.691) (-942.258) (-937.590) -- 0:00:07
898000 -- (-936.416) [-939.911] (-936.325) (-937.871) * [-935.661] (-936.204) (-939.118) (-936.479) -- 0:00:07
898500 -- [-936.815] (-939.074) (-938.395) (-934.891) * (-936.483) [-936.465] (-937.353) (-935.606) -- 0:00:07
899000 -- [-935.841] (-937.566) (-936.867) (-936.327) * (-937.016) [-936.380] (-937.095) (-941.673) -- 0:00:07
899500 -- [-935.196] (-937.209) (-937.724) (-936.619) * (-937.992) (-937.516) (-935.539) [-938.730] -- 0:00:07
900000 -- [-935.859] (-936.154) (-938.992) (-937.055) * [-935.941] (-935.851) (-936.492) (-940.270) -- 0:00:06
Average standard deviation of split frequencies: 0.009421
900500 -- (-936.343) (-935.643) (-939.929) [-940.683] * (-936.417) [-937.965] (-937.824) (-937.813) -- 0:00:06
901000 -- (-938.023) (-934.883) (-937.321) [-938.292] * (-937.855) (-935.211) [-936.890] (-939.191) -- 0:00:06
901500 -- (-937.547) (-935.027) [-937.995] (-936.716) * (-940.351) (-935.670) [-935.483] (-936.506) -- 0:00:06
902000 -- (-937.272) [-935.412] (-934.737) (-934.797) * (-935.484) [-935.306] (-936.511) (-936.560) -- 0:00:06
902500 -- (-937.676) (-936.301) [-938.429] (-934.810) * (-936.783) [-935.112] (-937.110) (-941.278) -- 0:00:06
903000 -- [-935.528] (-940.017) (-940.658) (-936.701) * (-935.766) [-934.851] (-936.642) (-937.158) -- 0:00:06
903500 -- [-938.667] (-938.630) (-940.096) (-937.042) * (-936.301) (-938.765) [-935.335] (-936.260) -- 0:00:06
904000 -- [-936.265] (-937.837) (-940.807) (-936.755) * (-938.591) (-938.066) [-935.626] (-937.222) -- 0:00:06
904500 -- (-935.533) [-938.836] (-937.196) (-935.229) * (-939.351) [-935.505] (-938.410) (-936.710) -- 0:00:06
905000 -- (-936.164) [-937.785] (-936.075) (-937.133) * (-937.828) (-936.548) [-935.757] (-939.843) -- 0:00:06
Average standard deviation of split frequencies: 0.009236
905500 -- [-936.624] (-939.861) (-936.908) (-937.040) * (-937.251) (-935.295) [-937.004] (-938.911) -- 0:00:06
906000 -- (-940.924) (-936.701) [-935.435] (-937.046) * [-935.077] (-938.909) (-937.414) (-937.264) -- 0:00:06
906500 -- (-938.911) (-935.851) [-936.478] (-938.472) * (-935.743) [-939.993] (-938.294) (-936.159) -- 0:00:06
907000 -- (-938.859) [-936.377] (-938.834) (-935.739) * [-936.019] (-935.381) (-938.139) (-939.116) -- 0:00:06
907500 -- [-938.282] (-935.881) (-937.739) (-936.893) * (-940.482) [-936.579] (-936.508) (-936.829) -- 0:00:06
908000 -- (-936.192) [-935.491] (-936.978) (-939.291) * [-939.411] (-937.583) (-940.076) (-936.851) -- 0:00:06
908500 -- (-936.352) (-936.375) (-935.415) [-939.297] * (-936.978) (-940.037) (-938.825) [-934.908] -- 0:00:06
909000 -- [-939.170] (-940.382) (-938.213) (-936.856) * (-940.566) [-937.081] (-936.274) (-936.392) -- 0:00:06
909500 -- (-937.535) (-937.109) [-935.957] (-935.034) * (-934.986) (-940.934) (-937.307) [-936.699] -- 0:00:06
910000 -- (-937.830) [-936.660] (-936.728) (-937.384) * (-935.800) (-937.433) [-936.034] (-937.926) -- 0:00:06
Average standard deviation of split frequencies: 0.009253
910500 -- [-935.770] (-939.117) (-936.060) (-937.473) * (-935.640) (-941.530) [-936.744] (-935.346) -- 0:00:06
911000 -- [-935.949] (-936.883) (-936.162) (-935.669) * (-938.966) [-936.075] (-937.496) (-936.521) -- 0:00:06
911500 -- (-935.001) (-936.745) [-937.182] (-935.648) * (-936.340) (-939.216) (-939.209) [-937.100] -- 0:00:06
912000 -- [-937.127] (-939.926) (-936.157) (-936.625) * (-937.374) (-937.577) (-935.406) [-935.782] -- 0:00:06
912500 -- [-939.067] (-940.672) (-938.222) (-935.915) * (-938.275) (-937.378) [-937.230] (-936.574) -- 0:00:06
913000 -- (-938.405) (-937.104) [-939.169] (-936.596) * (-936.622) (-936.866) (-937.630) [-935.529] -- 0:00:06
913500 -- [-937.547] (-937.274) (-939.343) (-935.464) * [-937.892] (-937.540) (-938.309) (-936.088) -- 0:00:06
914000 -- (-941.307) [-938.125] (-935.997) (-936.572) * [-935.992] (-938.632) (-936.737) (-935.390) -- 0:00:06
914500 -- (-935.807) (-938.387) [-936.701] (-939.606) * (-940.152) [-939.726] (-939.569) (-935.645) -- 0:00:05
915000 -- (-938.571) (-939.484) [-934.764] (-936.528) * [-936.069] (-938.025) (-939.380) (-940.495) -- 0:00:05
Average standard deviation of split frequencies: 0.009006
915500 -- [-938.673] (-938.736) (-934.835) (-937.530) * [-935.423] (-935.580) (-941.659) (-936.564) -- 0:00:05
916000 -- (-935.663) (-937.465) (-934.940) [-937.489] * [-935.549] (-936.017) (-939.295) (-934.923) -- 0:00:05
916500 -- (-940.306) (-937.374) (-934.857) [-939.259] * (-937.884) (-937.914) (-936.631) [-934.913] -- 0:00:05
917000 -- [-937.237] (-936.996) (-935.312) (-936.504) * (-935.950) [-934.658] (-937.066) (-935.290) -- 0:00:05
917500 -- [-935.926] (-935.994) (-941.029) (-937.265) * (-936.038) [-936.267] (-937.815) (-935.986) -- 0:00:05
918000 -- (-935.481) (-936.801) (-939.394) [-938.743] * (-937.512) (-935.505) (-937.428) [-935.736] -- 0:00:05
918500 -- (-937.712) (-936.446) (-937.342) [-937.463] * (-939.492) (-937.236) [-937.479] (-936.579) -- 0:00:05
919000 -- (-937.332) (-938.003) (-942.942) [-935.203] * (-938.306) (-937.177) (-936.508) [-935.035] -- 0:00:05
919500 -- (-935.686) (-937.847) [-937.043] (-939.635) * [-937.411] (-935.962) (-937.893) (-936.715) -- 0:00:05
920000 -- (-937.590) (-935.220) (-937.001) [-936.513] * [-941.947] (-936.309) (-939.042) (-934.996) -- 0:00:05
Average standard deviation of split frequencies: 0.008736
920500 -- (-935.407) (-937.247) (-936.989) [-936.743] * (-939.526) (-937.136) (-939.973) [-936.301] -- 0:00:05
921000 -- (-937.144) (-937.740) (-937.219) [-938.449] * (-938.361) (-936.417) (-938.440) [-936.733] -- 0:00:05
921500 -- (-935.140) (-937.380) [-936.279] (-935.415) * (-935.988) (-937.622) (-937.938) [-936.017] -- 0:00:05
922000 -- [-935.351] (-936.926) (-945.794) (-936.136) * (-935.973) (-941.348) [-942.367] (-935.810) -- 0:00:05
922500 -- (-934.667) (-935.969) [-937.974] (-937.870) * (-937.833) (-936.195) (-938.165) [-937.620] -- 0:00:05
923000 -- (-935.352) (-938.727) (-936.945) [-935.207] * (-940.997) [-936.597] (-937.128) (-937.936) -- 0:00:05
923500 -- [-940.108] (-936.836) (-938.203) (-935.394) * (-935.997) [-937.165] (-937.367) (-937.575) -- 0:00:05
924000 -- (-938.707) (-937.525) (-937.335) [-936.456] * (-937.475) [-938.350] (-941.518) (-937.879) -- 0:00:05
924500 -- [-937.701] (-937.744) (-938.323) (-937.532) * [-939.208] (-938.953) (-936.970) (-936.733) -- 0:00:05
925000 -- (-936.148) [-935.975] (-938.627) (-936.732) * (-939.690) (-936.594) [-939.294] (-938.499) -- 0:00:05
Average standard deviation of split frequencies: 0.008368
925500 -- [-936.585] (-934.963) (-938.527) (-940.124) * [-937.315] (-937.399) (-937.839) (-938.715) -- 0:00:05
926000 -- (-936.343) [-937.619] (-936.581) (-935.829) * [-936.043] (-939.027) (-937.272) (-939.058) -- 0:00:05
926500 -- (-938.824) (-938.557) [-935.900] (-937.187) * (-936.841) (-943.564) [-935.861] (-943.042) -- 0:00:05
927000 -- (-938.911) [-937.805] (-941.739) (-937.076) * (-937.315) (-937.469) [-937.420] (-936.563) -- 0:00:05
927500 -- [-935.308] (-940.618) (-936.750) (-938.891) * (-936.812) (-936.318) [-936.680] (-938.462) -- 0:00:05
928000 -- (-935.205) [-936.822] (-937.743) (-938.923) * (-935.532) [-937.682] (-938.809) (-937.101) -- 0:00:05
928500 -- (-939.219) [-936.816] (-936.362) (-940.332) * [-936.224] (-937.840) (-937.287) (-934.987) -- 0:00:05
929000 -- (-935.602) (-936.516) [-936.523] (-936.011) * (-938.692) [-938.707] (-941.439) (-935.562) -- 0:00:04
929500 -- (-935.801) (-936.974) (-939.308) [-936.332] * (-938.075) (-935.859) (-938.207) [-937.684] -- 0:00:04
930000 -- [-936.230] (-935.333) (-935.812) (-936.164) * [-936.505] (-941.379) (-938.637) (-935.414) -- 0:00:04
Average standard deviation of split frequencies: 0.008136
930500 -- (-934.790) [-935.418] (-936.308) (-941.921) * (-935.172) (-935.655) [-936.860] (-935.707) -- 0:00:04
931000 -- [-937.639] (-934.976) (-941.344) (-942.586) * (-937.895) (-936.665) [-936.331] (-938.054) -- 0:00:04
931500 -- (-936.568) (-936.005) (-940.988) [-936.597] * (-938.493) [-936.744] (-938.219) (-939.562) -- 0:00:04
932000 -- (-937.118) (-935.469) [-936.996] (-935.978) * [-936.500] (-938.632) (-935.889) (-936.664) -- 0:00:04
932500 -- (-941.834) (-934.890) [-936.640] (-936.336) * [-938.741] (-939.868) (-942.605) (-935.346) -- 0:00:04
933000 -- (-941.243) [-934.876] (-938.782) (-936.415) * (-943.296) (-938.590) [-941.140] (-937.965) -- 0:00:04
933500 -- (-939.186) [-937.617] (-937.699) (-937.408) * (-936.024) [-935.032] (-943.616) (-936.888) -- 0:00:04
934000 -- [-937.310] (-937.941) (-935.890) (-935.525) * (-940.395) [-934.862] (-938.084) (-939.532) -- 0:00:04
934500 -- (-937.637) [-939.689] (-937.578) (-936.991) * (-936.352) (-935.942) [-935.345] (-938.322) -- 0:00:04
935000 -- (-936.831) (-938.121) [-935.008] (-935.506) * (-937.173) [-934.844] (-935.965) (-937.369) -- 0:00:04
Average standard deviation of split frequencies: 0.008247
935500 -- (-935.538) (-939.091) [-939.691] (-937.935) * [-938.127] (-937.244) (-937.805) (-935.799) -- 0:00:04
936000 -- (-935.192) (-938.269) [-936.604] (-935.618) * (-936.483) (-936.821) [-936.809] (-936.166) -- 0:00:04
936500 -- (-935.624) (-937.846) (-940.767) [-936.524] * [-941.107] (-936.713) (-936.781) (-935.031) -- 0:00:04
937000 -- [-935.694] (-938.686) (-939.118) (-937.900) * (-936.253) [-935.979] (-935.541) (-935.962) -- 0:00:04
937500 -- (-936.262) (-935.789) [-939.939] (-934.840) * (-937.111) (-936.156) (-935.978) [-939.585] -- 0:00:04
938000 -- [-935.938] (-935.456) (-936.729) (-937.288) * (-936.551) (-943.042) [-936.023] (-940.249) -- 0:00:04
938500 -- [-935.065] (-937.248) (-935.795) (-935.590) * (-936.027) [-936.573] (-937.940) (-941.099) -- 0:00:04
939000 -- [-935.897] (-937.979) (-937.144) (-935.832) * (-939.417) [-937.747] (-936.212) (-936.644) -- 0:00:04
939500 -- [-935.119] (-934.969) (-939.199) (-936.810) * [-934.985] (-941.486) (-934.893) (-938.682) -- 0:00:04
940000 -- (-937.322) (-937.062) (-937.548) [-935.539] * (-935.941) (-940.246) [-934.897] (-937.225) -- 0:00:04
Average standard deviation of split frequencies: 0.008237
940500 -- (-939.890) (-936.262) [-936.562] (-942.736) * [-936.508] (-943.198) (-935.152) (-936.342) -- 0:00:04
941000 -- [-935.489] (-937.315) (-942.941) (-939.421) * (-936.960) (-936.143) (-935.157) [-936.974] -- 0:00:04
941500 -- (-939.242) [-937.573] (-944.754) (-935.853) * (-938.098) (-937.419) (-936.526) [-935.374] -- 0:00:04
942000 -- [-935.302] (-937.190) (-938.696) (-943.226) * (-935.649) (-937.660) [-939.978] (-935.837) -- 0:00:04
942500 -- (-935.753) (-936.160) [-936.056] (-940.375) * (-937.350) [-937.113] (-938.020) (-936.569) -- 0:00:04
943000 -- (-935.812) [-936.437] (-939.030) (-940.546) * (-936.515) [-937.135] (-938.190) (-935.972) -- 0:00:03
943500 -- (-935.813) (-936.630) (-939.069) [-935.741] * [-935.964] (-938.666) (-939.144) (-936.274) -- 0:00:03
944000 -- (-934.902) [-936.201] (-935.170) (-936.240) * (-936.715) [-940.196] (-939.511) (-936.913) -- 0:00:03
944500 -- (-936.663) (-936.954) [-935.127] (-936.472) * (-938.177) (-937.422) (-937.194) [-936.492] -- 0:00:03
945000 -- [-935.979] (-940.338) (-938.538) (-936.667) * [-937.317] (-939.185) (-939.770) (-937.457) -- 0:00:03
Average standard deviation of split frequencies: 0.008253
945500 -- (-935.079) (-940.312) (-936.355) [-941.333] * (-937.151) (-939.494) (-938.157) [-935.642] -- 0:00:03
946000 -- [-938.057] (-939.172) (-936.632) (-936.901) * [-935.135] (-936.514) (-938.196) (-935.427) -- 0:00:03
946500 -- (-935.849) (-938.663) [-936.327] (-936.358) * [-936.845] (-938.020) (-940.506) (-937.705) -- 0:00:03
947000 -- (-939.256) [-940.324] (-937.507) (-942.227) * (-939.185) (-940.230) [-938.285] (-936.200) -- 0:00:03
947500 -- (-937.747) (-939.707) [-936.822] (-941.581) * (-936.406) [-935.880] (-938.929) (-936.808) -- 0:00:03
948000 -- (-939.809) (-943.121) [-936.446] (-941.617) * (-939.494) [-939.354] (-936.844) (-936.910) -- 0:00:03
948500 -- [-936.685] (-941.416) (-935.119) (-940.653) * [-939.053] (-942.248) (-936.116) (-937.570) -- 0:00:03
949000 -- [-935.920] (-941.631) (-936.369) (-939.732) * (-939.115) (-937.443) (-935.037) [-936.954] -- 0:00:03
949500 -- (-935.937) (-938.966) (-934.647) [-938.170] * (-943.948) (-935.560) (-937.337) [-935.216] -- 0:00:03
950000 -- (-936.237) [-935.690] (-939.434) (-936.257) * (-937.838) (-935.639) (-938.703) [-936.240] -- 0:00:03
Average standard deviation of split frequencies: 0.008132
950500 -- (-937.279) [-936.376] (-935.116) (-939.349) * (-937.862) (-936.253) (-938.741) [-937.801] -- 0:00:03
951000 -- (-935.021) (-936.945) [-937.387] (-940.376) * [-940.591] (-936.083) (-937.175) (-936.179) -- 0:00:03
951500 -- [-936.227] (-936.685) (-937.521) (-935.504) * (-935.490) [-937.063] (-938.550) (-940.015) -- 0:00:03
952000 -- (-935.632) (-936.589) [-938.750] (-936.341) * (-935.644) (-938.067) (-938.065) [-939.932] -- 0:00:03
952500 -- [-935.702] (-936.710) (-935.758) (-938.179) * (-937.466) (-938.092) [-936.562] (-935.828) -- 0:00:03
953000 -- (-937.359) (-935.573) (-936.698) [-935.528] * (-936.782) (-940.268) [-935.860] (-935.355) -- 0:00:03
953500 -- (-936.783) [-935.424] (-935.836) (-935.631) * (-935.136) (-939.358) [-934.685] (-936.276) -- 0:00:03
954000 -- (-937.023) [-939.975] (-935.569) (-937.638) * (-935.139) [-934.971] (-937.394) (-936.077) -- 0:00:03
954500 -- (-939.537) [-935.344] (-937.506) (-936.433) * (-936.319) [-936.254] (-936.259) (-941.072) -- 0:00:03
955000 -- (-940.977) (-935.547) (-938.552) [-935.639] * (-935.559) (-939.022) [-938.969] (-938.194) -- 0:00:03
Average standard deviation of split frequencies: 0.008691
955500 -- (-938.770) (-935.548) [-936.185] (-937.144) * (-936.773) (-937.911) (-936.586) [-936.532] -- 0:00:03
956000 -- [-938.804] (-937.949) (-935.570) (-939.068) * (-938.629) (-936.691) [-938.467] (-937.957) -- 0:00:03
956500 -- (-939.170) (-939.821) [-935.577] (-936.450) * (-940.786) (-938.713) (-937.293) [-940.041] -- 0:00:03
957000 -- (-936.110) (-942.240) (-935.271) [-936.048] * [-938.258] (-935.862) (-936.775) (-938.185) -- 0:00:03
957500 -- (-936.897) (-939.858) [-935.140] (-938.506) * (-939.162) [-936.494] (-936.833) (-937.550) -- 0:00:02
958000 -- (-936.796) [-935.425] (-935.447) (-936.232) * (-939.424) [-937.261] (-936.275) (-935.738) -- 0:00:02
958500 -- (-939.163) (-936.994) (-938.572) [-935.651] * (-938.738) [-935.437] (-939.285) (-936.001) -- 0:00:02
959000 -- (-940.665) (-938.969) (-937.675) [-936.681] * (-936.452) (-935.126) [-937.561] (-936.314) -- 0:00:02
959500 -- (-939.730) (-938.626) (-936.442) [-935.976] * (-936.190) (-941.365) (-938.138) [-941.549] -- 0:00:02
960000 -- (-936.481) (-936.249) (-939.050) [-937.259] * (-940.060) [-937.518] (-937.448) (-937.866) -- 0:00:02
Average standard deviation of split frequencies: 0.008342
960500 -- (-936.755) [-936.818] (-938.748) (-937.217) * [-935.439] (-937.583) (-936.057) (-939.641) -- 0:00:02
961000 -- [-935.671] (-937.973) (-935.783) (-935.372) * (-935.060) (-937.324) [-937.667] (-936.718) -- 0:00:02
961500 -- (-938.605) (-936.169) (-940.317) [-935.546] * [-936.549] (-940.875) (-938.896) (-936.444) -- 0:00:02
962000 -- (-935.323) (-935.864) (-940.345) [-935.501] * [-935.092] (-940.381) (-938.598) (-939.405) -- 0:00:02
962500 -- (-941.116) (-935.033) (-936.680) [-937.610] * (-935.996) [-936.333] (-940.415) (-935.801) -- 0:00:02
963000 -- (-939.240) (-935.046) [-936.361] (-938.009) * (-937.521) [-937.767] (-940.437) (-936.016) -- 0:00:02
963500 -- (-937.665) [-935.324] (-936.274) (-941.254) * [-935.084] (-935.587) (-938.284) (-936.613) -- 0:00:02
964000 -- (-935.939) (-937.986) (-935.424) [-937.399] * (-937.511) [-937.025] (-936.797) (-935.996) -- 0:00:02
964500 -- (-936.437) (-939.545) [-935.819] (-939.671) * (-938.038) (-936.610) [-935.734] (-935.389) -- 0:00:02
965000 -- [-936.666] (-935.923) (-936.793) (-939.140) * (-937.572) (-940.077) (-935.677) [-936.938] -- 0:00:02
Average standard deviation of split frequencies: 0.008459
965500 -- (-935.316) [-937.443] (-936.279) (-937.903) * (-936.306) (-935.607) [-937.528] (-938.066) -- 0:00:02
966000 -- (-937.261) (-936.101) [-935.764] (-938.674) * (-937.738) (-937.527) [-935.527] (-935.685) -- 0:00:02
966500 -- [-935.315] (-937.693) (-939.049) (-938.785) * (-937.101) (-935.639) [-937.678] (-934.811) -- 0:00:02
967000 -- [-935.140] (-936.783) (-936.448) (-936.118) * (-936.706) (-936.698) [-935.418] (-937.425) -- 0:00:02
967500 -- (-937.896) (-937.172) [-934.892] (-937.956) * (-938.383) (-934.999) [-936.152] (-936.071) -- 0:00:02
968000 -- (-937.442) (-935.779) [-935.466] (-938.142) * [-936.826] (-937.338) (-942.605) (-938.066) -- 0:00:02
968500 -- (-939.298) (-937.857) [-936.934] (-937.217) * (-936.272) (-938.795) (-940.624) [-939.091] -- 0:00:02
969000 -- (-939.338) [-934.699] (-938.443) (-937.384) * (-936.984) (-940.551) [-934.936] (-936.132) -- 0:00:02
969500 -- [-939.746] (-934.743) (-936.968) (-939.912) * (-937.152) [-937.350] (-935.067) (-934.926) -- 0:00:02
970000 -- (-937.979) (-936.370) [-936.345] (-936.243) * [-938.482] (-935.235) (-938.147) (-934.901) -- 0:00:02
Average standard deviation of split frequencies: 0.008547
970500 -- (-936.003) (-938.727) [-935.957] (-937.263) * (-937.032) (-935.330) (-935.924) [-937.036] -- 0:00:02
971000 -- (-936.221) [-935.706] (-935.749) (-936.748) * (-935.072) (-937.847) (-935.661) [-936.175] -- 0:00:02
971500 -- (-937.831) [-935.323] (-937.283) (-940.803) * (-938.996) (-937.321) [-941.385] (-936.496) -- 0:00:01
972000 -- [-936.482] (-935.471) (-936.232) (-937.377) * (-937.850) (-937.469) (-935.334) [-935.243] -- 0:00:01
972500 -- [-937.983] (-938.893) (-939.505) (-938.374) * (-935.622) [-940.849] (-938.504) (-935.397) -- 0:00:01
973000 -- (-937.941) (-935.568) (-939.148) [-937.066] * (-937.839) [-936.050] (-937.412) (-936.482) -- 0:00:01
973500 -- (-943.850) [-935.597] (-937.178) (-935.387) * (-938.158) (-936.885) (-941.269) [-936.297] -- 0:00:01
974000 -- [-938.182] (-938.559) (-935.289) (-935.315) * (-937.147) [-934.772] (-938.069) (-934.835) -- 0:00:01
974500 -- (-936.782) (-936.601) [-936.214] (-938.662) * (-936.140) (-939.514) (-939.064) [-936.427] -- 0:00:01
975000 -- (-936.504) [-937.367] (-935.905) (-934.754) * [-938.677] (-939.608) (-934.655) (-936.270) -- 0:00:01
Average standard deviation of split frequencies: 0.008436
975500 -- (-937.616) (-937.050) [-936.357] (-936.638) * (-936.675) (-937.610) [-934.851] (-937.174) -- 0:00:01
976000 -- [-939.891] (-937.795) (-938.274) (-937.445) * [-936.375] (-935.278) (-937.950) (-937.289) -- 0:00:01
976500 -- [-936.030] (-936.801) (-937.639) (-936.942) * (-940.676) (-936.054) (-937.777) [-936.134] -- 0:00:01
977000 -- (-937.843) [-935.589] (-936.233) (-935.695) * (-942.703) (-935.476) (-941.272) [-937.641] -- 0:00:01
977500 -- (-938.384) (-936.864) (-938.536) [-937.013] * (-946.611) [-936.474] (-936.087) (-937.307) -- 0:00:01
978000 -- (-936.043) (-936.566) (-937.384) [-937.449] * [-940.207] (-935.010) (-936.599) (-940.540) -- 0:00:01
978500 -- (-938.139) (-938.532) (-936.621) [-938.057] * (-936.131) (-936.540) (-935.876) [-935.856] -- 0:00:01
979000 -- (-938.417) (-937.681) [-935.144] (-937.413) * [-936.577] (-935.770) (-935.153) (-935.653) -- 0:00:01
979500 -- (-940.082) [-939.660] (-938.242) (-939.287) * (-939.935) [-936.705] (-936.294) (-935.014) -- 0:00:01
980000 -- [-935.690] (-937.415) (-937.504) (-942.266) * (-937.041) [-935.246] (-938.279) (-935.012) -- 0:00:01
Average standard deviation of split frequencies: 0.008108
980500 -- (-935.283) [-941.611] (-935.178) (-937.143) * (-938.246) [-936.656] (-936.286) (-935.020) -- 0:00:01
981000 -- [-936.715] (-936.529) (-936.985) (-935.341) * (-940.077) [-938.477] (-942.019) (-936.096) -- 0:00:01
981500 -- [-934.946] (-940.837) (-936.457) (-936.948) * [-935.435] (-939.681) (-935.878) (-938.023) -- 0:00:01
982000 -- (-939.055) (-937.591) [-939.570] (-937.551) * (-936.799) (-936.490) [-936.686] (-938.014) -- 0:00:01
982500 -- [-943.689] (-935.850) (-936.975) (-935.679) * [-938.101] (-936.393) (-943.443) (-936.737) -- 0:00:01
983000 -- (-940.401) (-936.209) (-936.445) [-937.704] * (-938.788) (-937.581) [-940.260] (-937.884) -- 0:00:01
983500 -- [-936.967] (-939.219) (-936.592) (-941.219) * (-938.942) (-936.956) [-939.566] (-939.239) -- 0:00:01
984000 -- [-936.227] (-935.522) (-936.487) (-935.781) * (-938.214) [-937.957] (-948.536) (-937.780) -- 0:00:01
984500 -- (-935.272) (-937.553) (-936.502) [-935.686] * (-935.886) (-935.696) [-942.164] (-935.251) -- 0:00:01
985000 -- (-937.331) (-938.107) (-937.729) [-937.965] * [-936.166] (-936.991) (-937.709) (-937.208) -- 0:00:01
Average standard deviation of split frequencies: 0.008000
985500 -- [-935.720] (-936.000) (-935.576) (-941.531) * [-936.856] (-938.963) (-939.843) (-937.500) -- 0:00:01
986000 -- [-935.083] (-936.084) (-936.058) (-938.342) * (-937.473) [-937.043] (-937.026) (-935.810) -- 0:00:00
986500 -- (-935.081) (-939.895) [-935.889] (-943.606) * [-935.403] (-937.311) (-938.347) (-944.475) -- 0:00:00
987000 -- (-935.160) [-935.848] (-938.067) (-937.404) * (-936.564) (-948.588) [-941.086] (-937.178) -- 0:00:00
987500 -- [-935.597] (-935.046) (-940.065) (-938.393) * (-937.716) (-947.114) [-941.798] (-939.231) -- 0:00:00
988000 -- (-936.094) (-939.112) (-935.229) [-940.259] * (-939.845) [-939.389] (-935.922) (-936.587) -- 0:00:00
988500 -- (-936.413) [-935.379] (-936.534) (-936.516) * (-935.476) [-939.538] (-936.392) (-938.009) -- 0:00:00
989000 -- (-936.703) [-936.773] (-937.549) (-936.432) * [-935.792] (-938.105) (-938.334) (-936.972) -- 0:00:00
989500 -- (-937.456) (-940.173) (-939.556) [-939.999] * (-936.772) (-939.636) (-938.024) [-935.350] -- 0:00:00
990000 -- (-935.191) (-935.984) [-938.452] (-937.673) * (-935.226) (-937.143) [-937.202] (-938.029) -- 0:00:00
Average standard deviation of split frequencies: 0.007867
990500 -- (-936.547) (-937.109) [-937.370] (-936.811) * [-937.780] (-938.809) (-936.435) (-937.483) -- 0:00:00
991000 -- [-937.398] (-939.770) (-936.760) (-936.447) * (-936.447) (-939.403) [-934.778] (-936.078) -- 0:00:00
991500 -- (-938.385) (-935.924) (-936.128) [-935.359] * [-935.664] (-940.028) (-936.906) (-936.069) -- 0:00:00
992000 -- (-939.247) [-934.784] (-935.838) (-936.752) * (-936.294) (-936.357) (-938.032) [-938.432] -- 0:00:00
992500 -- (-941.268) [-935.719] (-938.005) (-936.798) * (-935.591) [-937.324] (-936.441) (-937.116) -- 0:00:00
993000 -- (-941.442) (-937.478) [-935.454] (-937.537) * (-937.425) (-935.876) (-935.496) [-936.856] -- 0:00:00
993500 -- (-939.196) (-935.141) [-935.810] (-940.262) * (-937.423) [-937.345] (-938.393) (-936.556) -- 0:00:00
994000 -- (-936.024) (-938.792) (-938.017) [-936.058] * (-940.641) (-938.506) [-935.600] (-937.048) -- 0:00:00
994500 -- (-937.114) (-937.745) (-941.472) [-936.648] * (-937.285) (-939.174) (-937.826) [-937.275] -- 0:00:00
995000 -- (-935.635) (-938.786) (-936.823) [-935.240] * (-936.093) (-937.491) (-938.496) [-937.256] -- 0:00:00
Average standard deviation of split frequencies: 0.008109
995500 -- [-939.653] (-940.248) (-940.009) (-935.799) * (-935.943) [-935.718] (-937.281) (-938.341) -- 0:00:00
996000 -- (-936.567) (-939.257) (-936.787) [-935.224] * [-937.788] (-940.968) (-937.167) (-934.876) -- 0:00:00
996500 -- (-935.779) (-936.786) [-935.610] (-937.708) * (-937.988) [-935.639] (-935.588) (-935.938) -- 0:00:00
997000 -- (-934.955) (-937.487) (-936.462) [-935.937] * (-938.543) (-934.886) (-935.971) [-935.735] -- 0:00:00
997500 -- (-936.631) (-936.271) (-936.488) [-934.785] * [-936.433] (-934.987) (-936.433) (-937.003) -- 0:00:00
998000 -- (-937.887) [-935.770] (-937.427) (-934.650) * (-936.783) [-935.483] (-937.970) (-937.405) -- 0:00:00
998500 -- (-937.038) (-934.837) [-935.663] (-935.065) * [-937.139] (-938.838) (-937.503) (-936.046) -- 0:00:00
999000 -- [-936.045] (-935.310) (-936.839) (-937.806) * (-936.475) (-943.730) [-937.478] (-938.035) -- 0:00:00
999500 -- (-938.243) (-935.388) (-936.077) [-937.945] * (-936.000) (-941.868) [-939.321] (-936.507) -- 0:00:00
1000000 -- (-936.766) [-937.064] (-934.891) (-935.980) * (-936.709) (-936.667) (-938.261) [-935.884] -- 0:00:00
Average standard deviation of split frequencies: 0.008134
Analysis completed in 1 mins 9 seconds
Analysis used 67.90 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -934.58
Likelihood of best state for "cold" chain of run 2 was -934.58
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.5 % ( 28 %) Dirichlet(Pi{all})
30.1 % ( 19 %) Slider(Pi{all})
78.9 % ( 54 %) Multiplier(Alpha{1,2})
77.2 % ( 58 %) Multiplier(Alpha{3})
21.0 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 81 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.0 % ( 22 %) Dirichlet(Pi{all})
29.7 % ( 25 %) Slider(Pi{all})
78.2 % ( 54 %) Multiplier(Alpha{1,2})
77.8 % ( 50 %) Multiplier(Alpha{3})
22.3 % ( 31 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167252 0.82 0.67
3 | 166677 166454 0.84
4 | 166468 166589 166560
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166382 0.82 0.67
3 | 167190 166656 0.84
4 | 166782 166464 166526
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -936.33
| 1 2 2 11 |
| 1 1 2 1 |
| 1 1 1 1 1 1|
| 1 1 2 2 1 * 2 1 11 |
|21 2 1 * 22 |
| 2 1 2 2 1 12 * 1 1 2 2 |
| 1 2 2 2 * 11 1 2 11 2 2 |
| 22 22 111 2 2 2 1 22 2|
| 1 2 1 1 * 2 2 2 1 1 |
| 1 222 21 2 1 2 1 |
| 1 1 2 2 2 2 1 2 21 |
| 1 1 2 21 2 2 |
| 2 1 2 |
|1 |
| 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -937.87
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -936.25 -941.56
2 -936.29 -939.34
--------------------------------------
TOTAL -936.27 -940.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894337 0.093994 0.343823 1.502132 0.856627 1265.47 1383.24 1.000
r(A<->C){all} 0.167668 0.017802 0.000172 0.432698 0.136693 330.68 333.98 1.000
r(A<->G){all} 0.169997 0.019383 0.000070 0.448636 0.138848 208.42 254.67 1.001
r(A<->T){all} 0.166832 0.020117 0.000001 0.465003 0.129799 224.14 224.78 1.000
r(C<->G){all} 0.163194 0.018826 0.000121 0.441638 0.125641 93.55 149.21 1.000
r(C<->T){all} 0.168178 0.019607 0.000029 0.438373 0.132504 125.17 160.62 1.000
r(G<->T){all} 0.164131 0.018985 0.000019 0.445684 0.131380 86.96 163.90 1.001
pi(A){all} 0.180243 0.000212 0.154225 0.211525 0.180145 1218.66 1302.70 1.000
pi(C){all} 0.295315 0.000297 0.260919 0.328154 0.295094 1061.57 1161.00 1.000
pi(G){all} 0.327406 0.000309 0.293183 0.361009 0.327255 1190.46 1209.40 1.000
pi(T){all} 0.197036 0.000226 0.168622 0.227569 0.196895 1312.31 1406.65 1.000
alpha{1,2} 0.436647 0.253948 0.000108 1.435460 0.249488 936.43 1092.44 1.000
alpha{3} 0.466784 0.242837 0.000185 1.439263 0.306308 1199.55 1350.28 1.000
pinvar{all} 0.997874 0.000006 0.993046 0.999999 0.998708 1309.33 1310.54 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- .***.*
9 -- ...*.*
10 -- ..*.*.
11 -- .*...*
12 -- .*.*..
13 -- ....**
14 -- .*..*.
15 -- ..**..
16 -- .****.
17 -- ...**.
18 -- ..****
19 -- ..*..*
20 -- .**...
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.000471 0.153231 0.153897 2
8 446 0.148568 0.014133 0.138574 0.158561 2
9 446 0.148568 0.009422 0.141905 0.155230 2
10 444 0.147901 0.003769 0.145237 0.150566 2
11 444 0.147901 0.006595 0.143238 0.152565 2
12 440 0.146569 0.010364 0.139241 0.153897 2
13 433 0.144237 0.006124 0.139907 0.148568 2
14 432 0.143904 0.014133 0.133911 0.153897 2
15 429 0.142905 0.013662 0.133245 0.152565 2
16 426 0.141905 0.011306 0.133911 0.149900 2
17 423 0.140906 0.008009 0.135243 0.146569 2
18 415 0.138241 0.003298 0.135909 0.140573 2
19 410 0.136576 0.003769 0.133911 0.139241 2
20 401 0.133578 0.006124 0.129247 0.137908 2
21 387 0.128914 0.010835 0.121252 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098704 0.009753 0.000064 0.296671 0.068510 1.000 2
length{all}[2] 0.099547 0.010357 0.000050 0.301658 0.068568 1.000 2
length{all}[3] 0.097377 0.009649 0.000027 0.282386 0.067816 1.000 2
length{all}[4] 0.100958 0.010746 0.000001 0.316215 0.069409 1.000 2
length{all}[5] 0.102275 0.010537 0.000061 0.313695 0.071334 1.000 2
length{all}[6] 0.096467 0.009887 0.000006 0.295505 0.064509 1.000 2
length{all}[7] 0.095333 0.009124 0.000192 0.294655 0.067262 0.998 2
length{all}[8] 0.095588 0.008899 0.000177 0.280900 0.067707 0.998 2
length{all}[9] 0.094909 0.008652 0.000116 0.308363 0.066928 1.006 2
length{all}[10] 0.100572 0.012125 0.000427 0.296292 0.071795 1.000 2
length{all}[11] 0.102739 0.010551 0.000011 0.314873 0.072982 0.998 2
length{all}[12] 0.104443 0.010837 0.000039 0.328526 0.071822 1.003 2
length{all}[13] 0.101317 0.010899 0.000177 0.299285 0.065617 0.998 2
length{all}[14] 0.107868 0.012492 0.000067 0.316464 0.073503 0.999 2
length{all}[15] 0.104370 0.012658 0.000025 0.334875 0.072202 0.998 2
length{all}[16] 0.095269 0.009053 0.000067 0.281430 0.064400 0.998 2
length{all}[17] 0.105125 0.009441 0.000177 0.299614 0.076205 0.999 2
length{all}[18] 0.099078 0.012377 0.000349 0.344213 0.058453 0.998 2
length{all}[19] 0.098085 0.009703 0.000282 0.298481 0.065187 0.998 2
length{all}[20] 0.104364 0.011370 0.000069 0.319904 0.073580 1.000 2
length{all}[21] 0.093293 0.007665 0.000138 0.262167 0.068824 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008134
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 690
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 230 / 230 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 230 / 230 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034607 0.081455 0.052537 0.010280 0.060112 0.062878 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -982.023604
Iterating by ming2
Initial: fx= 982.023604
x= 0.03461 0.08146 0.05254 0.01028 0.06011 0.06288 0.30000 1.30000
1 h-m-p 0.0000 0.0000 553.0046 ++ 968.189990 m 0.0000 13 | 1/8
2 h-m-p 0.0007 0.0115 30.7197 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 505.0198 ++ 940.725765 m 0.0001 44 | 2/8
4 h-m-p 0.0022 0.0184 21.5819 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 453.1832 ++ 924.382055 m 0.0001 76 | 3/8
6 h-m-p 0.0024 0.0538 13.2327 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 393.4495 ++ 919.175707 m 0.0000 108 | 4/8
8 h-m-p 0.0011 0.3513 9.5359 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 321.4534 ++ 917.906302 m 0.0000 139 | 5/8
10 h-m-p 0.0021 1.0496 6.5809 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 227.0363 ++ 913.633803 m 0.0001 171 | 6/8
12 h-m-p 0.1257 8.0000 0.0000 --C 913.633803 0 0.0020 184 | 6/8
13 h-m-p 0.2488 8.0000 0.0000 -----------C 913.633803 0 0.0000 208
Out..
lnL = -913.633803
209 lfun, 209 eigenQcodon, 1254 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038386 0.077710 0.075057 0.099028 0.062059 0.072983 0.299983 0.834425 0.112508
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 16.933622
np = 9
lnL0 = -1004.055191
Iterating by ming2
Initial: fx= 1004.055191
x= 0.03839 0.07771 0.07506 0.09903 0.06206 0.07298 0.29998 0.83443 0.11251
1 h-m-p 0.0000 0.0002 489.6514 +++ 957.099488 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 535.2701 ++ 931.068779 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 594.8432 ++ 921.394980 m 0.0001 39 | 3/9
4 h-m-p 0.0027 0.0408 11.3463 ------------.. | 3/9
5 h-m-p 0.0000 0.0000 446.7366 ++ 920.647261 m 0.0000 73 | 4/9
6 h-m-p 0.0003 0.0630 4.6641 ----------.. | 4/9
7 h-m-p 0.0000 0.0000 387.3216 ++ 919.332293 m 0.0000 105 | 5/9
8 h-m-p 0.0006 0.0668 4.4102 -----------.. | 5/9
9 h-m-p 0.0000 0.0000 316.9913 ++ 918.207883 m 0.0000 138 | 6/9
10 h-m-p 0.0006 0.0732 4.0433 -----------.. | 6/9
11 h-m-p 0.0000 0.0001 224.0311 ++ 913.633824 m 0.0001 171 | 7/9
12 h-m-p 0.0935 8.0000 0.0001 ++++ 913.633824 m 8.0000 185 | 7/9
13 h-m-p 0.0031 1.5747 0.4953 +++++ 913.633805 m 1.5747 202 | 8/9
14 h-m-p 1.6000 8.0000 0.0010 --------C 913.633805 0 0.0000 224 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
16 h-m-p 0.0160 8.0000 0.0000 ------------- | 8/9
17 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -913.633805
297 lfun, 891 eigenQcodon, 3564 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095717 0.103997 0.091221 0.058606 0.045151 0.073793 0.337752 1.330730 0.108621 0.451984 1.306227
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.636248
np = 11
lnL0 = -1016.854205
Iterating by ming2
Initial: fx= 1016.854205
x= 0.09572 0.10400 0.09122 0.05861 0.04515 0.07379 0.33775 1.33073 0.10862 0.45198 1.30623
1 h-m-p 0.0000 0.0002 522.6634 +++ 958.370229 m 0.0002 28 | 1/11
2 h-m-p 0.0000 0.0002 291.4115 ++ 943.156288 m 0.0002 53 | 2/11
3 h-m-p 0.0000 0.0000 9531.3649 ++ 929.077450 m 0.0000 77 | 3/11
4 h-m-p 0.0000 0.0001 1885.0709 ++ 917.240309 m 0.0001 100 | 4/11
5 h-m-p 0.0000 0.0001 1167.2305 ++ 915.251268 m 0.0001 122 | 5/11
6 h-m-p 0.0000 0.0001 2274.0768 ++ 914.393051 m 0.0001 143 | 6/11
7 h-m-p 0.0020 0.0215 21.9874 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 227.5688 ++ 913.633815 m 0.0000 192 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 913.633815 m 8.0000 214 | 6/11
10 h-m-p 0.0004 0.2150 4.3782 +++++ 913.633811 m 0.2150 235 | 6/11
11 h-m-p -0.0000 -0.0000 1.2297
h-m-p: -0.00000000e+00 -0.00000000e+00 1.22973103e+00 913.633811
.. | 6/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 913.633811 m 8.0000 273 | 6/11
13 h-m-p 0.0006 0.3067 1.2427 +++++ 913.633805 m 0.3067 295 | 7/11
14 h-m-p 1.6000 8.0000 0.0310 ++ 913.633805 m 8.0000 314 | 7/11
15 h-m-p 0.2638 1.3190 0.6496 ++ 913.633805 m 1.3190 332 | 8/11
16 h-m-p 1.6000 8.0000 0.2417 ++ 913.633804 m 8.0000 350 | 8/11
17 h-m-p 1.6000 8.0000 0.2274 C 913.633804 0 1.6000 367 | 8/11
18 h-m-p 1.6000 8.0000 0.0202 Y 913.633804 0 1.0710 384 | 8/11
19 h-m-p 1.6000 8.0000 0.0039 Y 913.633804 0 0.4000 401 | 8/11
20 h-m-p 1.6000 8.0000 0.0004 +Y 913.633804 0 6.4000 419 | 8/11
21 h-m-p 1.6000 8.0000 0.0014 -------C 913.633804 0 0.0000 443 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 -Y 913.633804 0 0.0010 461 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 -N 913.633804 0 0.0010 479
Out..
lnL = -913.633804
480 lfun, 1920 eigenQcodon, 8640 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -913.638050 S = -913.629655 -0.003210
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:04
did 20 / 58 patterns 0:04
did 30 / 58 patterns 0:04
did 40 / 58 patterns 0:04
did 50 / 58 patterns 0:04
did 58 / 58 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078851 0.085970 0.073796 0.063973 0.063637 0.076045 0.000100 1.031175 1.429223
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.430004
np = 9
lnL0 = -1010.411820
Iterating by ming2
Initial: fx= 1010.411820
x= 0.07885 0.08597 0.07380 0.06397 0.06364 0.07605 0.00011 1.03118 1.42922
1 h-m-p 0.0000 0.0000 514.5478 ++ 1009.809001 m 0.0000 23 | 1/9
2 h-m-p 0.0000 0.0176 58.7342 +++++ 971.750266 m 0.0176 47 | 2/9
3 h-m-p 0.0002 0.0011 73.8477 ++ 966.280178 m 0.0011 67 | 3/9
4 h-m-p 0.0001 0.0004 99.1532 ++ 946.862913 m 0.0004 86 | 4/9
5 h-m-p 0.0009 0.0045 24.3595 ++ 939.813195 m 0.0045 104 | 5/9
6 h-m-p 0.0000 0.0000 104.9055 ++ 938.982208 m 0.0000 121 | 6/9
7 h-m-p 0.0001 0.0072 13.0733 ----------.. | 6/9
8 h-m-p 0.0000 0.0002 304.4500 +++ 916.528821 m 0.0002 161 | 7/9
9 h-m-p 0.0505 8.0000 0.9988 --------------.. | 7/9
10 h-m-p 0.0000 0.0001 225.2952 ++ 913.633812 m 0.0001 202 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 913.633812 0 1.6000 216 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 ++Y 913.633812 0 0.2560 231 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 Y 913.633812 0 0.4000 245
Out..
lnL = -913.633812
246 lfun, 2706 eigenQcodon, 14760 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109546 0.079259 0.057886 0.027052 0.097815 0.034630 0.000100 0.900000 0.201468 1.415581 1.300017
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 20.269031
np = 11
lnL0 = -996.542907
Iterating by ming2
Initial: fx= 996.542907
x= 0.10955 0.07926 0.05789 0.02705 0.09782 0.03463 0.00011 0.90000 0.20147 1.41558 1.30002
1 h-m-p 0.0000 0.0000 456.5562 ++ 996.279128 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0003 432.3212 +++ 965.272571 m 0.0003 53 | 2/11
3 h-m-p 0.0000 0.0001 450.6021 ++ 957.341538 m 0.0001 77 | 3/11
4 h-m-p 0.0002 0.0014 130.0735 ++ 940.985728 m 0.0014 100 | 4/11
5 h-m-p 0.0001 0.0007 228.2833 ++ 925.443812 m 0.0007 122 | 5/11
6 h-m-p 0.0001 0.0005 123.3939 ++ 922.853852 m 0.0005 143 | 6/11
7 h-m-p 0.0000 0.0000 23759.2240 ++ 916.983711 m 0.0000 163 | 7/11
8 h-m-p 0.0037 0.0377 19.6442 ++ 913.633806 m 0.0377 182 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 --------C 913.633806 0 0.0000 208
Out..
lnL = -913.633806
209 lfun, 2508 eigenQcodon, 13794 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -913.649239 S = -913.630587 -0.008200
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:12
did 20 / 58 patterns 0:12
did 30 / 58 patterns 0:12
did 40 / 58 patterns 0:12
did 50 / 58 patterns 0:12
did 58 / 58 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=230
NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
NC_002677_1_NP_302480_2_1352_ubiE VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG
**************************************************
NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
NC_002677_1_NP_302480_2_1352_ubiE PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD
**************************************************
NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
NC_002677_1_NP_302480_2_1352_ubiE ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST
**************************************************
NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
NC_002677_1_NP_302480_2_1352_ubiE PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC
**************************************************
NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 QLSRTGWASPRWRNLTGGIVALHAADKPVR
NC_002677_1_NP_302480_2_1352_ubiE QLSRTGWASPRWRNLTGGIVALHAADKPVR
NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 QLSRTGWASPRWRNLTGGIVALHAADKPVR
NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 QLSRTGWASPRWRNLTGGIVALHAADKPVR
NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 QLSRTGWASPRWRNLTGGIVALHAADKPVR
NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 QLSRTGWASPRWRNLTGGIVALHAADKPVR
******************************
>NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG >NC_002677_1_NP_302480_2_1352_ubiE GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG >NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG >NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG >NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG >NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 GTGAGTCGCGCTGCCCTGGACAAGGACCCCCGGGATGTCGTAGCGATGTT CGACGACGTCGCCCACCGATACGATCTGACCAACACTGTGCTGTCGCTGG GTCAAGATCGGTACTGGCGACGAGCCACGCGGTCGGCGCTGCGGATTGGG CCCGGGCAGAAAGTGCTGGACCTGGCCGCAGGCACGGCGGTGTCCACAGC GGAACTGAGTAAATCCGGCGCCTGGTGTGTGGCTGCGGATTTTTCGGTCA GGATGCTAGCAACCGGCGGTGCGCGAAAGGTACCTAAGGTGGCCGCAGAT GCCACCCAACTTCCCTTTAGCGATGGTGTATTCGATGCAGTCACTATCAG TTTCGGGTTGCGCAATATCGCCGACTATCAGGCGGCGCTGCGCGAGATGG CCCGCGTCACCCGGCCCGGCGGTCAATTAGTAGTGTGCGAGTTCTCCACA CCCACCAATGCGCTGGTCGCCAATGTCTACACGGAATACCTGATGCGGGC ACTGCCGCAAGTGGCGCGACTGGTGTCTAGTAATCCCGATGCCTACATCT ACTTGGCGGAGTCCATCAGAGCCTGGCCCGATCAGGTTACGCTGGCCTGC CAGCTGTCGCGGACCGGTTGGGCGTCGCCGCGCTGGCGTAACCTCACCGG CGGAATTGTGGCTTTGCATGCAGCAGATAAGCCGGTGCGG
>NC_011896_1_WP_010908800_1_2428_MLBR_RS11555 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC QLSRTGWASPRWRNLTGGIVALHAADKPVR >NC_002677_1_NP_302480_2_1352_ubiE VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC QLSRTGWASPRWRNLTGGIVALHAADKPVR >NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC QLSRTGWASPRWRNLTGGIVALHAADKPVR >NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC QLSRTGWASPRWRNLTGGIVALHAADKPVR >NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC QLSRTGWASPRWRNLTGGIVALHAADKPVR >NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805 VSRAALDKDPRDVVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIG PGQKVLDLAAGTAVSTAELSKSGAWCVAADFSVRMLATGGARKVPKVAAD ATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFST PTNALVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLAC QLSRTGWASPRWRNLTGGIVALHAADKPVR
#NEXUS
[ID: 0991278926]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908800_1_2428_MLBR_RS11555
NC_002677_1_NP_302480_2_1352_ubiE
NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650
NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410
NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465
NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908800_1_2428_MLBR_RS11555,
2 NC_002677_1_NP_302480_2_1352_ubiE,
3 NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650,
4 NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410,
5 NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465,
6 NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06851026,2:0.0685678,3:0.06781635,4:0.06940934,5:0.07133392,6:0.06450912);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06851026,2:0.0685678,3:0.06781635,4:0.06940934,5:0.07133392,6:0.06450912);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -936.25 -941.56
2 -936.29 -939.34
--------------------------------------
TOTAL -936.27 -940.97
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ubiE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894337 0.093994 0.343823 1.502132 0.856627 1265.47 1383.24 1.000
r(A<->C){all} 0.167668 0.017802 0.000172 0.432698 0.136693 330.68 333.98 1.000
r(A<->G){all} 0.169997 0.019383 0.000070 0.448636 0.138848 208.42 254.67 1.001
r(A<->T){all} 0.166832 0.020117 0.000001 0.465003 0.129799 224.14 224.78 1.000
r(C<->G){all} 0.163194 0.018826 0.000121 0.441638 0.125641 93.55 149.21 1.000
r(C<->T){all} 0.168178 0.019607 0.000029 0.438373 0.132504 125.17 160.62 1.000
r(G<->T){all} 0.164131 0.018985 0.000019 0.445684 0.131380 86.96 163.90 1.001
pi(A){all} 0.180243 0.000212 0.154225 0.211525 0.180145 1218.66 1302.70 1.000
pi(C){all} 0.295315 0.000297 0.260919 0.328154 0.295094 1061.57 1161.00 1.000
pi(G){all} 0.327406 0.000309 0.293183 0.361009 0.327255 1190.46 1209.40 1.000
pi(T){all} 0.197036 0.000226 0.168622 0.227569 0.196895 1312.31 1406.65 1.000
alpha{1,2} 0.436647 0.253948 0.000108 1.435460 0.249488 936.43 1092.44 1.000
alpha{3} 0.466784 0.242837 0.000185 1.439263 0.306308 1199.55 1350.28 1.000
pinvar{all} 0.997874 0.000006 0.993046 0.999999 0.998708 1309.33 1310.54 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/ubiE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 230
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 4 4 4 4 4 4 | TAC 6 6 6 6 6 6 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 7 7 7 7 7 7 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 4 4 4 4 4 4 | CGA 5 5 5 5 5 5
CTG 15 15 15 15 15 15 | CCG 3 3 3 3 3 3 | CAG 4 4 4 4 4 4 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 4 4 4 4 4 4 | Ser AGT 4 4 4 4 4 4
ATC 4 4 4 4 4 4 | ACC 7 7 7 7 7 7 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 4 4 4 4 4 4 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 3 3 3 3 3 3 | Asp GAT 10 10 10 10 10 10 | Gly GGT 5 5 5 5 5 5
GTC 7 7 7 7 7 7 | GCC 13 13 13 13 13 13 | GAC 6 6 6 6 6 6 | GGC 5 5 5 5 5 5
GTA 4 4 4 4 4 4 | GCA 7 7 7 7 7 7 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 11 11 11 11 11 11 | GCG 12 12 12 12 12 12 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908800_1_2428_MLBR_RS11555
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
#2: NC_002677_1_NP_302480_2_1352_ubiE
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
#3: NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
#4: NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
#5: NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
#6: NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 24 | TCC 24 | TAC 36 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 30 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 6
CTC 6 | CCC 42 | CAC 6 | CGC 30
CTA 6 | CCA 0 | Gln Q CAA 24 | CGA 30
CTG 90 | CCG 18 | CAG 24 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 24 | Ser S AGT 24
ATC 24 | ACC 42 | AAC 12 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 24 | ACG 24 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 18 | Asp D GAT 60 | Gly G GGT 30
GTC 42 | GCC 78 | GAC 36 | GGC 30
GTA 24 | GCA 42 | Glu E GAA 12 | GGA 6
GTG 66 | GCG 72 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15217 C:0.25217 A:0.19130 G:0.40435
position 2: T:0.26522 C:0.30870 A:0.21739 G:0.20870
position 3: T:0.17391 C:0.32609 A:0.13043 G:0.36957
Average T:0.19710 C:0.29565 A:0.17971 G:0.32754
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -913.633803 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299983 1.300017
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908800_1_2428_MLBR_RS11555: 0.000004, NC_002677_1_NP_302480_2_1352_ubiE: 0.000004, NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650: 0.000004, NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410: 0.000004, NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465: 0.000004, NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29998
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 513.0 177.0 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 513.0 177.0 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 513.0 177.0 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 513.0 177.0 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 513.0 177.0 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 513.0 177.0 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 9): -913.633805 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.337752 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908800_1_2428_MLBR_RS11555: 0.000004, NC_002677_1_NP_302480_2_1352_ubiE: 0.000004, NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650: 0.000004, NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410: 0.000004, NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465: 0.000004, NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.33775
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 512.6 177.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 512.6 177.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 512.6 177.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 512.6 177.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 512.6 177.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 512.6 177.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -913.633804 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.029853 0.836925 1.000000 2.939924
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908800_1_2428_MLBR_RS11555: 0.000004, NC_002677_1_NP_302480_2_1352_ubiE: 0.000004, NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650: 0.000004, NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410: 0.000004, NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465: 0.000004, NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.02985 0.83693 0.13322
w: 1.00000 1.00000 2.93992
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.3 172.7 1.2584 0.0000 0.0000 0.0 0.0
7..2 0.000 517.3 172.7 1.2584 0.0000 0.0000 0.0 0.0
7..3 0.000 517.3 172.7 1.2584 0.0000 0.0000 0.0 0.0
7..4 0.000 517.3 172.7 1.2584 0.0000 0.0000 0.0 0.0
7..5 0.000 517.3 172.7 1.2584 0.0000 0.0000 0.0 0.0
7..6 0.000 517.3 172.7 1.2584 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908800_1_2428_MLBR_RS11555)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908800_1_2428_MLBR_RS11555)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -913.633812 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.470993
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908800_1_2428_MLBR_RS11555: 0.000004, NC_002677_1_NP_302480_2_1352_ubiE: 0.000004, NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650: 0.000004, NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410: 0.000004, NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465: 0.000004, NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.47099
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 517.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 517.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 517.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 517.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 517.3 172.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -913.633806 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.739242 0.005000 1.619659 2.299575
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908800_1_2428_MLBR_RS11555: 0.000004, NC_002677_1_NP_302480_2_1352_ubiE: 0.000004, NZ_LVXE01000002_1_WP_010908800_1_834_A3216_RS01650: 0.000004, NZ_LYPH01000022_1_WP_010908800_1_924_A8144_RS04410: 0.000004, NZ_CP029543_1_WP_010908800_1_2448_DIJ64_RS12465: 0.000004, NZ_AP014567_1_WP_010908800_1_2516_JK2ML_RS12805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.73924 p = 0.00500 q = 1.61966
(p1 = 0.26076) w = 2.29957
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07392 0.07392 0.07392 0.07392 0.07392 0.07392 0.07392 0.07392 0.07392 0.07392 0.26076
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.29957
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 517.3 172.7 0.5996 0.0000 0.0000 0.0 0.0
7..2 0.000 517.3 172.7 0.5996 0.0000 0.0000 0.0 0.0
7..3 0.000 517.3 172.7 0.5996 0.0000 0.0000 0.0 0.0
7..4 0.000 517.3 172.7 0.5996 0.0000 0.0000 0.0 0.0
7..5 0.000 517.3 172.7 0.5996 0.0000 0.0000 0.0 0.0
7..6 0.000 517.3 172.7 0.5996 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908800_1_2428_MLBR_RS11555)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908800_1_2428_MLBR_RS11555)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:12
Model 1: NearlyNeutral -913.633805 Model 2: PositiveSelection -913.633804 Model 0: one-ratio -913.633803 Model 7: beta -913.633812 Model 8: beta&w>1 -913.633806 Model 0 vs 1 4.000000217274646E-6 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 1.1999999969702912E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
