--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:56:54 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/12res/wbbL/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1241.92 -1245.23 2 -1241.97 -1245.85 -------------------------------------- TOTAL -1241.94 -1245.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890519 0.089031 0.332162 1.452637 0.859783 1391.94 1446.47 1.000 r(A<->C){all} 0.171190 0.019528 0.000107 0.451733 0.137919 94.35 205.14 1.002 r(A<->G){all} 0.169459 0.021934 0.000191 0.466578 0.128385 110.30 228.37 1.001 r(A<->T){all} 0.173563 0.021561 0.000047 0.469307 0.134254 146.68 173.33 1.001 r(C<->G){all} 0.160869 0.019865 0.000098 0.435774 0.120458 215.63 238.94 1.001 r(C<->T){all} 0.163870 0.018430 0.000046 0.428004 0.131090 191.37 251.23 1.000 r(G<->T){all} 0.161049 0.020339 0.000021 0.453306 0.117954 113.63 171.57 1.000 pi(A){all} 0.153014 0.000140 0.130570 0.175537 0.152780 1108.90 1259.47 1.000 pi(C){all} 0.285780 0.000220 0.257869 0.315427 0.285614 1103.71 1183.80 1.001 pi(G){all} 0.347100 0.000250 0.316094 0.378444 0.347319 1148.34 1213.79 1.000 pi(T){all} 0.214106 0.000172 0.188413 0.239409 0.213745 1038.56 1202.25 1.000 alpha{1,2} 0.424906 0.236395 0.000452 1.369378 0.258066 1294.21 1381.97 1.000 alpha{3} 0.458009 0.227401 0.000170 1.401651 0.305596 1320.31 1322.25 1.000 pinvar{all} 0.998389 0.000004 0.994851 0.999999 0.998976 1054.65 1150.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1216.240201 Model 2: PositiveSelection -1216.240134 Model 0: one-ratio -1216.240445 Model 7: beta -1216.240281 Model 8: beta&w>1 -1216.240134 Model 0 vs 1 4.8799999967741314E-4 Model 2 vs 1 1.3400000034380355E-4 Model 8 vs 7 2.9400000039458973E-4
>C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=308 C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA ************************************************** C1 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C2 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C3 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C4 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C5 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C6 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP ************************************************** C1 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C2 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C3 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C4 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C5 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C6 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG ************************************************** C1 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C2 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C3 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C4 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C5 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C6 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG ************************************************** C1 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C2 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C3 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C4 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C5 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C6 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA ************************************************** C1 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C2 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C3 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C4 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C5 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C6 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA ************************************************** C1 RQLAEGRR C2 RQLAEGRR C3 RQLAEGRR C4 RQLAEGRR C5 RQLAEGRR C6 RQLAEGRR ******** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] Relaxation Summary: [9240]--->[9240] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.504 Mb, Max= 30.866 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA ************************************************** C1 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C2 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C3 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C4 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C5 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C6 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP ************************************************** C1 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C2 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C3 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C4 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C5 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C6 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG ************************************************** C1 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C2 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C3 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C4 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C5 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C6 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG ************************************************** C1 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C2 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C3 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C4 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C5 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C6 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA ************************************************** C1 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C2 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C3 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C4 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C5 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C6 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA ************************************************** C1 RQLAEGRR C2 RQLAEGRR C3 RQLAEGRR C4 RQLAEGRR C5 RQLAEGRR C6 RQLAEGRR ******** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C2 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C3 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C4 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C5 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C6 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA ************************************************** C1 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C2 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C3 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C4 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C5 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C6 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA ************************************************** C1 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C2 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C3 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C4 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C5 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C6 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG ************************************************** C1 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C2 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C3 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C4 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C5 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C6 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG ************************************************** C1 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C2 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C3 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C4 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C5 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C6 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG ************************************************** C1 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C2 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C3 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C4 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C5 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C6 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT ************************************************** C1 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C2 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C3 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C4 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C5 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C6 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC ************************************************** C1 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C2 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C3 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C4 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C5 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C6 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG ************************************************** C1 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C2 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C3 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C4 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C5 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C6 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ************************************************** C1 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C2 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C3 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C4 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C5 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C6 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC ************************************************** C1 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C2 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C3 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C4 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C5 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C6 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT ************************************************** C1 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C2 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C3 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C4 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C5 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C6 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC ************************************************** C1 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C2 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C3 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C4 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C5 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C6 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG ************************************************** C1 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C2 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C3 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C4 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C5 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C6 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC ************************************************** C1 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C2 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C3 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C4 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C5 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C6 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG ************************************************** C1 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C2 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C3 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C4 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C5 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C6 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG ************************************************** C1 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C2 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C3 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C4 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C5 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C6 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT ************************************************** C1 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C2 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C3 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C4 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C5 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C6 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC ************************************************** C1 AGGCAACTGGCAGAAGGGCGACGT C2 AGGCAACTGGCAGAAGGGCGACGT C3 AGGCAACTGGCAGAAGGGCGACGT C4 AGGCAACTGGCAGAAGGGCGACGT C5 AGGCAACTGGCAGAAGGGCGACGT C6 AGGCAACTGGCAGAAGGGCGACGT ************************ >C1 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C2 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C3 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C4 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C5 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C6 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 924 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791302 Setting output file names to "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 932829207 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0570605940 Seed = 675030362 Swapseed = 1579791302 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2067.956291 -- -24.965149 Chain 2 -- -2067.956291 -- -24.965149 Chain 3 -- -2067.956291 -- -24.965149 Chain 4 -- -2067.956171 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2067.956291 -- -24.965149 Chain 2 -- -2067.956291 -- -24.965149 Chain 3 -- -2067.956291 -- -24.965149 Chain 4 -- -2067.956171 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2067.956] (-2067.956) (-2067.956) (-2067.956) * [-2067.956] (-2067.956) (-2067.956) (-2067.956) 500 -- (-1259.249) (-1256.077) [-1255.031] (-1285.195) * [-1256.004] (-1275.224) (-1296.255) (-1275.580) -- 0:00:00 1000 -- [-1255.267] (-1249.516) (-1256.235) (-1260.223) * (-1243.916) (-1257.793) [-1250.253] (-1250.487) -- 0:00:00 1500 -- (-1253.027) (-1252.350) [-1248.576] (-1250.024) * (-1252.421) (-1255.727) (-1255.102) [-1256.054] -- 0:00:00 2000 -- (-1249.115) (-1251.577) [-1243.649] (-1250.415) * (-1249.212) (-1260.673) (-1258.618) [-1250.684] -- 0:00:00 2500 -- [-1247.367] (-1253.110) (-1248.512) (-1248.333) * [-1253.919] (-1258.573) (-1251.045) (-1250.115) -- 0:00:00 3000 -- [-1249.686] (-1252.805) (-1248.539) (-1250.214) * [-1252.720] (-1251.798) (-1256.173) (-1247.620) -- 0:00:00 3500 -- (-1258.858) (-1254.527) (-1251.022) [-1250.872] * [-1249.635] (-1255.539) (-1257.615) (-1252.281) -- 0:00:00 4000 -- (-1250.873) [-1252.432] (-1251.881) (-1258.012) * [-1251.744] (-1249.562) (-1253.124) (-1255.726) -- 0:00:00 4500 -- (-1252.039) [-1254.351] (-1269.435) (-1250.229) * (-1255.170) (-1249.754) [-1249.146] (-1251.154) -- 0:00:00 5000 -- (-1253.225) [-1255.255] (-1252.323) (-1252.821) * (-1251.925) (-1248.381) [-1248.199] (-1251.960) -- 0:00:00 Average standard deviation of split frequencies: 0.119422 5500 -- (-1248.533) [-1252.559] (-1241.502) (-1252.067) * (-1263.117) (-1244.669) (-1251.884) [-1254.573] -- 0:00:00 6000 -- [-1251.103] (-1259.944) (-1242.528) (-1267.300) * (-1255.754) (-1250.969) (-1256.484) [-1253.446] -- 0:02:45 6500 -- [-1248.440] (-1254.478) (-1243.706) (-1252.045) * (-1255.922) (-1258.412) [-1250.805] (-1253.749) -- 0:02:32 7000 -- [-1260.942] (-1251.463) (-1243.349) (-1257.334) * [-1253.571] (-1248.923) (-1251.264) (-1255.062) -- 0:02:21 7500 -- (-1247.855) [-1248.597] (-1243.834) (-1253.999) * [-1255.168] (-1247.133) (-1257.121) (-1249.707) -- 0:02:12 8000 -- [-1243.935] (-1248.745) (-1244.361) (-1246.386) * (-1248.608) [-1247.312] (-1248.768) (-1255.279) -- 0:02:04 8500 -- [-1250.725] (-1248.657) (-1243.275) (-1254.795) * (-1249.988) [-1251.727] (-1246.331) (-1260.430) -- 0:01:56 9000 -- (-1250.579) (-1257.117) (-1241.116) [-1250.416] * (-1260.289) [-1250.370] (-1254.942) (-1259.894) -- 0:01:50 9500 -- (-1248.414) (-1252.657) [-1241.778] (-1267.848) * (-1254.211) (-1250.698) [-1248.789] (-1253.732) -- 0:01:44 10000 -- (-1252.097) (-1260.749) (-1244.294) [-1247.804] * (-1251.599) (-1259.463) [-1249.712] (-1255.990) -- 0:01:39 Average standard deviation of split frequencies: 0.077340 10500 -- [-1251.784] (-1250.075) (-1245.167) (-1249.816) * (-1252.370) (-1259.660) [-1251.217] (-1254.745) -- 0:01:34 11000 -- (-1251.810) [-1250.624] (-1243.430) (-1253.542) * (-1246.977) [-1248.964] (-1258.445) (-1262.001) -- 0:01:29 11500 -- (-1256.146) (-1252.936) [-1243.630] (-1256.943) * (-1254.414) [-1246.355] (-1249.928) (-1244.840) -- 0:01:25 12000 -- [-1247.918] (-1254.284) (-1241.691) (-1252.146) * [-1249.192] (-1250.574) (-1257.050) (-1243.113) -- 0:01:22 12500 -- [-1247.240] (-1256.383) (-1241.690) (-1257.018) * [-1246.780] (-1251.848) (-1253.967) (-1242.151) -- 0:01:19 13000 -- [-1258.531] (-1250.302) (-1243.581) (-1252.665) * (-1251.521) [-1257.543] (-1248.653) (-1246.391) -- 0:01:15 13500 -- (-1255.706) (-1244.716) (-1243.915) [-1246.122] * (-1260.411) (-1256.005) [-1250.531] (-1245.606) -- 0:01:13 14000 -- [-1252.303] (-1249.065) (-1243.163) (-1255.043) * (-1254.602) [-1248.287] (-1251.726) (-1241.735) -- 0:01:10 14500 -- (-1249.108) [-1255.858] (-1247.728) (-1256.979) * (-1241.603) [-1246.217] (-1251.411) (-1241.895) -- 0:01:07 15000 -- (-1251.142) (-1252.016) (-1244.376) [-1253.157] * (-1242.597) [-1247.520] (-1255.564) (-1242.007) -- 0:01:05 Average standard deviation of split frequencies: 0.079723 15500 -- (-1248.157) (-1257.636) (-1242.385) [-1254.193] * (-1241.350) (-1249.677) (-1246.552) [-1243.004] -- 0:01:03 16000 -- [-1244.576] (-1248.747) (-1240.980) (-1249.631) * (-1242.627) (-1250.093) (-1257.050) [-1242.952] -- 0:01:01 16500 -- (-1249.568) (-1249.735) [-1240.870] (-1248.078) * (-1241.463) [-1261.711] (-1253.321) (-1243.542) -- 0:00:59 17000 -- (-1253.069) [-1257.404] (-1245.691) (-1247.600) * (-1241.936) [-1248.161] (-1255.591) (-1242.965) -- 0:00:57 17500 -- (-1260.345) (-1256.187) (-1244.569) [-1249.127] * (-1241.943) (-1262.669) (-1251.552) [-1244.627] -- 0:00:56 18000 -- (-1252.438) (-1252.299) (-1244.785) [-1253.149] * [-1242.268] (-1249.695) (-1247.627) (-1244.625) -- 0:00:54 18500 -- (-1249.367) (-1254.511) [-1240.977] (-1249.826) * (-1241.669) (-1251.627) [-1249.811] (-1243.317) -- 0:00:53 19000 -- [-1245.373] (-1248.847) (-1240.871) (-1256.109) * [-1240.707] (-1257.175) (-1251.457) (-1241.922) -- 0:00:51 19500 -- (-1253.283) [-1256.793] (-1241.317) (-1251.848) * (-1243.102) (-1256.961) [-1251.041] (-1242.331) -- 0:00:50 20000 -- [-1248.195] (-1253.749) (-1241.358) (-1249.099) * (-1242.477) (-1252.103) [-1248.805] (-1242.851) -- 0:01:38 Average standard deviation of split frequencies: 0.060379 20500 -- (-1254.386) [-1248.552] (-1241.704) (-1248.241) * (-1240.315) (-1253.175) (-1249.815) [-1242.253] -- 0:01:35 21000 -- (-1252.673) (-1252.537) (-1241.325) [-1255.976] * (-1241.586) (-1247.127) [-1249.264] (-1240.890) -- 0:01:33 21500 -- (-1254.280) (-1247.407) [-1242.302] (-1251.933) * [-1242.723] (-1248.419) (-1261.978) (-1241.798) -- 0:01:31 22000 -- (-1256.218) (-1246.829) (-1241.326) [-1249.818] * (-1241.263) (-1247.654) (-1255.003) [-1241.502] -- 0:01:28 22500 -- (-1260.415) (-1248.653) [-1241.232] (-1258.744) * (-1241.256) (-1247.510) [-1252.156] (-1244.312) -- 0:01:26 23000 -- (-1245.524) (-1244.107) (-1243.249) [-1247.578] * (-1243.367) (-1250.316) (-1248.337) [-1243.220] -- 0:01:24 23500 -- (-1250.608) [-1242.019] (-1242.193) (-1263.836) * (-1244.218) (-1252.929) (-1250.751) [-1243.219] -- 0:01:23 24000 -- (-1256.036) [-1242.433] (-1241.417) (-1247.313) * [-1242.105] (-1249.618) (-1250.852) (-1243.019) -- 0:01:21 24500 -- (-1254.522) (-1241.981) [-1244.129] (-1248.238) * (-1242.541) (-1243.248) [-1247.390] (-1243.608) -- 0:01:19 25000 -- (-1253.894) (-1243.070) (-1241.234) [-1250.545] * [-1241.776] (-1245.431) (-1252.289) (-1243.664) -- 0:01:18 Average standard deviation of split frequencies: 0.053569 25500 -- [-1256.086] (-1243.807) (-1240.678) (-1252.478) * [-1242.758] (-1243.546) (-1248.479) (-1241.630) -- 0:01:16 26000 -- (-1258.879) (-1244.937) [-1241.448] (-1247.832) * (-1241.804) (-1246.006) [-1254.098] (-1243.338) -- 0:01:14 26500 -- (-1252.170) [-1241.274] (-1244.010) (-1260.928) * [-1241.659] (-1244.701) (-1251.943) (-1244.435) -- 0:01:13 27000 -- (-1255.487) (-1243.919) (-1246.072) [-1249.961] * (-1241.892) (-1244.482) (-1251.144) [-1245.528] -- 0:01:12 27500 -- (-1262.857) (-1246.106) [-1246.116] (-1252.064) * (-1242.330) (-1243.610) [-1253.160] (-1244.268) -- 0:01:10 28000 -- (-1252.879) (-1243.405) (-1246.570) [-1252.869] * (-1241.815) (-1244.207) (-1250.661) [-1243.882] -- 0:01:09 28500 -- (-1251.287) [-1241.375] (-1245.494) (-1259.684) * (-1242.045) [-1242.989] (-1253.597) (-1243.202) -- 0:01:08 29000 -- [-1247.925] (-1241.305) (-1244.068) (-1256.434) * [-1242.250] (-1240.940) (-1258.379) (-1244.151) -- 0:01:06 29500 -- [-1256.127] (-1242.191) (-1243.264) (-1256.497) * (-1241.028) [-1242.282] (-1253.803) (-1243.261) -- 0:01:05 30000 -- (-1248.410) [-1241.275] (-1241.202) (-1252.126) * [-1240.818] (-1244.964) (-1252.358) (-1244.553) -- 0:01:04 Average standard deviation of split frequencies: 0.054900 30500 -- (-1247.186) (-1242.717) [-1241.049] (-1245.323) * (-1242.106) (-1240.692) (-1255.705) [-1241.835] -- 0:01:03 31000 -- (-1252.174) [-1243.292] (-1240.842) (-1247.585) * (-1240.985) (-1240.507) (-1258.463) [-1242.183] -- 0:01:02 31500 -- (-1256.443) (-1242.496) (-1241.789) [-1246.149] * (-1240.620) (-1241.398) [-1247.339] (-1246.184) -- 0:01:01 32000 -- (-1256.043) (-1245.615) (-1241.744) [-1247.021] * (-1240.369) (-1242.995) [-1255.854] (-1242.039) -- 0:01:00 32500 -- (-1250.938) (-1244.298) (-1244.033) [-1245.609] * (-1244.521) (-1247.493) [-1252.013] (-1243.779) -- 0:00:59 33000 -- (-1247.926) (-1242.665) (-1244.061) [-1247.222] * (-1242.424) [-1244.636] (-1256.547) (-1244.061) -- 0:00:58 33500 -- (-1253.014) (-1246.831) (-1242.835) [-1247.112] * (-1241.761) [-1243.711] (-1251.238) (-1241.914) -- 0:00:57 34000 -- [-1248.930] (-1245.312) (-1246.594) (-1252.189) * (-1242.275) (-1241.774) [-1248.262] (-1242.539) -- 0:01:25 34500 -- (-1255.686) (-1246.204) (-1242.926) [-1246.329] * (-1242.863) (-1241.752) [-1251.002] (-1241.790) -- 0:01:23 35000 -- [-1248.565] (-1244.739) (-1242.972) (-1248.501) * (-1242.832) (-1240.661) (-1253.821) [-1240.612] -- 0:01:22 Average standard deviation of split frequencies: 0.053757 35500 -- (-1252.313) (-1243.979) [-1242.389] (-1256.288) * (-1242.979) (-1242.000) [-1254.540] (-1242.652) -- 0:01:21 36000 -- (-1251.523) (-1245.468) [-1243.532] (-1253.595) * (-1241.966) (-1241.651) (-1250.652) [-1241.869] -- 0:01:20 36500 -- (-1250.438) (-1242.910) (-1243.463) [-1248.529] * (-1241.961) (-1242.111) (-1252.743) [-1242.214] -- 0:01:19 37000 -- (-1251.399) [-1242.085] (-1242.064) (-1254.662) * [-1245.456] (-1242.451) (-1250.826) (-1242.294) -- 0:01:18 37500 -- (-1254.367) (-1241.640) [-1241.168] (-1252.912) * (-1242.505) (-1243.000) [-1249.666] (-1242.049) -- 0:01:17 38000 -- [-1251.084] (-1241.954) (-1242.681) (-1253.950) * (-1248.199) (-1241.222) [-1248.399] (-1241.012) -- 0:01:15 38500 -- (-1247.773) [-1242.793] (-1244.485) (-1258.124) * (-1246.733) (-1241.048) [-1249.508] (-1244.618) -- 0:01:14 39000 -- (-1247.565) (-1246.804) [-1241.187] (-1250.484) * (-1249.740) (-1244.457) [-1246.390] (-1240.560) -- 0:01:13 39500 -- (-1246.955) [-1244.174] (-1240.898) (-1253.400) * (-1241.615) (-1240.831) [-1257.174] (-1240.574) -- 0:01:12 40000 -- [-1248.239] (-1242.654) (-1241.109) (-1256.447) * (-1241.775) [-1243.721] (-1254.225) (-1243.165) -- 0:01:12 Average standard deviation of split frequencies: 0.043148 40500 -- (-1260.309) (-1242.653) (-1243.386) [-1249.612] * [-1244.044] (-1243.913) (-1259.589) (-1243.066) -- 0:01:11 41000 -- [-1249.347] (-1243.947) (-1243.149) (-1250.295) * (-1248.529) (-1243.091) (-1249.086) [-1240.711] -- 0:01:10 41500 -- (-1253.966) [-1243.164] (-1245.128) (-1250.734) * (-1242.796) [-1242.490] (-1245.527) (-1242.782) -- 0:01:09 42000 -- [-1248.819] (-1241.310) (-1245.005) (-1249.623) * [-1242.792] (-1242.763) (-1242.594) (-1243.859) -- 0:01:08 42500 -- (-1254.736) (-1241.955) (-1244.130) [-1249.165] * (-1243.605) (-1243.952) [-1241.830] (-1243.309) -- 0:01:07 43000 -- (-1250.377) (-1241.564) (-1245.017) [-1251.315] * [-1242.630] (-1245.027) (-1241.653) (-1243.519) -- 0:01:06 43500 -- (-1269.248) (-1243.457) [-1242.011] (-1250.472) * (-1242.664) (-1242.059) (-1242.322) [-1243.719] -- 0:01:05 44000 -- (-1250.230) (-1242.445) (-1241.649) [-1249.891] * (-1241.453) [-1242.590] (-1242.606) (-1245.528) -- 0:01:05 44500 -- (-1252.831) (-1245.619) (-1241.301) [-1251.698] * [-1245.040] (-1242.854) (-1244.746) (-1243.171) -- 0:01:04 45000 -- (-1248.477) [-1242.489] (-1243.141) (-1255.048) * (-1244.311) [-1242.614] (-1243.942) (-1247.328) -- 0:01:03 Average standard deviation of split frequencies: 0.038552 45500 -- (-1255.293) (-1242.773) (-1242.012) [-1247.299] * [-1249.241] (-1241.927) (-1244.644) (-1240.565) -- 0:01:02 46000 -- (-1253.568) (-1241.321) [-1241.631] (-1251.743) * (-1246.073) (-1243.632) [-1246.773] (-1241.354) -- 0:01:02 46500 -- (-1254.114) [-1241.056] (-1241.877) (-1255.115) * (-1242.118) (-1243.387) (-1246.263) [-1241.105] -- 0:01:01 47000 -- (-1263.159) [-1242.656] (-1242.675) (-1250.277) * (-1242.081) (-1243.521) (-1250.248) [-1242.886] -- 0:01:00 47500 -- (-1246.657) (-1245.683) (-1242.703) [-1244.325] * (-1243.087) [-1241.976] (-1245.685) (-1242.932) -- 0:01:00 48000 -- [-1245.067] (-1244.106) (-1242.925) (-1245.197) * [-1244.119] (-1243.138) (-1243.496) (-1242.310) -- 0:01:19 48500 -- (-1242.952) [-1242.824] (-1243.458) (-1245.417) * (-1246.016) [-1241.496] (-1241.729) (-1241.860) -- 0:01:18 49000 -- (-1244.150) (-1242.757) [-1242.815] (-1244.111) * (-1247.822) (-1242.166) [-1240.791] (-1242.120) -- 0:01:17 49500 -- [-1244.949] (-1240.849) (-1242.395) (-1240.739) * (-1243.258) (-1243.968) (-1242.115) [-1243.630] -- 0:01:16 50000 -- [-1243.501] (-1242.143) (-1242.028) (-1242.569) * (-1244.015) (-1246.144) (-1242.839) [-1242.541] -- 0:01:16 Average standard deviation of split frequencies: 0.042090 50500 -- (-1242.130) (-1242.144) [-1241.701] (-1241.754) * (-1247.467) (-1244.318) [-1242.783] (-1242.765) -- 0:01:15 51000 -- (-1242.478) (-1241.763) (-1243.248) [-1240.317] * (-1242.994) (-1243.040) [-1242.843] (-1242.201) -- 0:01:14 51500 -- (-1243.875) [-1242.728] (-1244.953) (-1242.726) * (-1247.652) (-1240.749) [-1242.676] (-1241.940) -- 0:01:13 52000 -- (-1240.910) (-1245.491) (-1243.241) [-1240.415] * (-1247.250) [-1243.673] (-1246.111) (-1245.837) -- 0:01:12 52500 -- (-1243.574) (-1242.001) (-1243.097) [-1241.974] * (-1247.697) (-1242.881) [-1243.418] (-1241.679) -- 0:01:12 53000 -- (-1240.294) (-1241.513) (-1243.527) [-1241.285] * [-1241.160] (-1241.894) (-1242.587) (-1243.111) -- 0:01:11 53500 -- [-1240.304] (-1242.959) (-1244.006) (-1241.220) * (-1242.432) (-1244.012) (-1241.749) [-1241.202] -- 0:01:10 54000 -- (-1242.059) (-1243.114) [-1245.096] (-1240.779) * (-1241.108) (-1242.388) (-1243.538) [-1240.848] -- 0:01:10 54500 -- [-1241.890] (-1243.931) (-1245.129) (-1240.520) * (-1241.827) (-1241.809) (-1241.947) [-1240.909] -- 0:01:09 55000 -- (-1241.265) (-1245.579) (-1242.314) [-1240.603] * [-1241.722] (-1243.305) (-1241.263) (-1240.903) -- 0:01:08 Average standard deviation of split frequencies: 0.038883 55500 -- (-1241.160) (-1245.483) [-1241.712] (-1243.789) * (-1243.539) (-1243.941) (-1244.103) [-1241.444] -- 0:01:08 56000 -- (-1245.763) (-1242.046) [-1241.927] (-1240.903) * (-1244.794) (-1243.452) [-1243.974] (-1245.314) -- 0:01:07 56500 -- [-1243.282] (-1244.579) (-1242.976) (-1241.265) * [-1243.670] (-1243.447) (-1241.755) (-1243.384) -- 0:01:06 57000 -- [-1241.838] (-1242.124) (-1242.208) (-1241.366) * (-1241.069) [-1242.783] (-1240.562) (-1245.962) -- 0:01:06 57500 -- [-1243.688] (-1243.446) (-1244.715) (-1241.621) * [-1241.723] (-1241.070) (-1244.808) (-1243.782) -- 0:01:05 58000 -- (-1242.932) (-1242.022) (-1242.134) [-1241.790] * (-1240.872) [-1241.914] (-1242.250) (-1243.007) -- 0:01:04 58500 -- (-1241.474) (-1241.346) [-1241.920] (-1243.392) * (-1241.913) [-1242.904] (-1241.040) (-1244.521) -- 0:01:04 59000 -- (-1244.931) [-1240.771] (-1242.758) (-1241.777) * (-1246.472) (-1241.474) [-1240.915] (-1242.010) -- 0:01:03 59500 -- (-1242.510) (-1242.996) [-1241.589] (-1241.006) * (-1246.691) [-1241.423] (-1240.462) (-1240.396) -- 0:01:03 60000 -- (-1242.694) [-1242.461] (-1245.120) (-1244.935) * (-1246.984) [-1241.902] (-1245.652) (-1241.698) -- 0:01:02 Average standard deviation of split frequencies: 0.037372 60500 -- (-1242.722) (-1244.851) (-1243.430) [-1243.438] * (-1242.585) (-1242.445) [-1241.448] (-1240.968) -- 0:01:02 61000 -- [-1242.646] (-1243.979) (-1242.217) (-1243.502) * (-1244.872) [-1240.976] (-1241.448) (-1242.740) -- 0:01:01 61500 -- [-1243.105] (-1242.221) (-1243.378) (-1246.324) * (-1243.824) [-1241.393] (-1241.594) (-1242.900) -- 0:01:01 62000 -- (-1244.934) [-1242.253] (-1243.388) (-1246.936) * (-1242.846) (-1243.853) (-1243.700) [-1240.932] -- 0:01:00 62500 -- (-1249.384) (-1243.062) [-1241.988] (-1245.255) * (-1242.448) (-1245.692) (-1241.625) [-1240.642] -- 0:01:00 63000 -- (-1243.439) (-1246.076) (-1243.979) [-1244.678] * (-1242.223) (-1246.293) (-1242.372) [-1241.115] -- 0:00:59 63500 -- (-1242.742) [-1242.004] (-1243.412) (-1241.975) * [-1241.731] (-1244.793) (-1242.850) (-1244.853) -- 0:01:13 64000 -- (-1244.176) (-1242.006) [-1242.403] (-1241.914) * (-1243.741) [-1244.603] (-1242.870) (-1243.323) -- 0:01:13 64500 -- (-1241.808) [-1242.533] (-1242.200) (-1242.718) * [-1241.534] (-1244.812) (-1242.791) (-1243.226) -- 0:01:12 65000 -- [-1241.809] (-1242.073) (-1248.343) (-1243.318) * (-1242.085) (-1247.953) [-1241.244] (-1243.738) -- 0:01:11 Average standard deviation of split frequencies: 0.036053 65500 -- [-1243.010] (-1242.131) (-1241.585) (-1243.636) * (-1241.723) [-1242.229] (-1244.326) (-1245.923) -- 0:01:11 66000 -- [-1243.453] (-1241.751) (-1241.264) (-1243.112) * (-1246.490) [-1245.627] (-1243.691) (-1244.504) -- 0:01:10 66500 -- (-1242.933) [-1241.682] (-1241.275) (-1243.686) * (-1243.570) (-1243.051) (-1244.467) [-1242.451] -- 0:01:10 67000 -- (-1243.221) (-1245.903) [-1241.084] (-1241.244) * (-1241.979) (-1247.934) (-1247.834) [-1242.558] -- 0:01:09 67500 -- [-1241.550] (-1243.892) (-1240.679) (-1244.409) * (-1242.776) (-1246.358) (-1243.393) [-1244.257] -- 0:01:09 68000 -- (-1242.688) (-1242.947) [-1241.185] (-1241.748) * (-1244.305) (-1249.874) (-1243.332) [-1243.718] -- 0:01:08 68500 -- (-1241.469) (-1241.051) [-1240.318] (-1241.912) * (-1244.181) (-1245.899) (-1242.890) [-1242.782] -- 0:01:07 69000 -- (-1244.790) [-1244.870] (-1241.373) (-1242.884) * (-1244.041) (-1242.420) [-1240.617] (-1242.559) -- 0:01:07 69500 -- (-1244.068) (-1242.098) [-1240.570] (-1245.916) * (-1244.955) (-1242.482) (-1240.617) [-1244.432] -- 0:01:06 70000 -- (-1243.384) [-1242.304] (-1244.050) (-1242.639) * [-1242.923] (-1242.387) (-1240.617) (-1244.937) -- 0:01:06 Average standard deviation of split frequencies: 0.040343 70500 -- (-1242.090) (-1240.655) [-1243.851] (-1244.254) * (-1243.768) (-1241.971) (-1242.609) [-1245.415] -- 0:01:05 71000 -- (-1242.060) (-1241.521) (-1244.056) [-1242.737] * (-1243.031) (-1241.482) [-1242.820] (-1247.033) -- 0:01:05 71500 -- (-1242.547) [-1242.391] (-1242.968) (-1242.884) * (-1246.774) [-1241.929] (-1240.929) (-1244.520) -- 0:01:04 72000 -- [-1245.891] (-1241.105) (-1242.721) (-1243.483) * (-1241.255) (-1242.057) [-1240.763] (-1243.290) -- 0:01:04 72500 -- (-1243.991) (-1241.019) (-1244.371) [-1244.594] * (-1241.967) [-1242.256] (-1242.028) (-1242.809) -- 0:01:03 73000 -- [-1243.126] (-1240.720) (-1247.227) (-1240.907) * [-1241.504] (-1241.604) (-1242.451) (-1240.728) -- 0:01:03 73500 -- [-1246.083] (-1241.035) (-1245.640) (-1240.318) * [-1241.259] (-1242.222) (-1244.650) (-1241.426) -- 0:01:03 74000 -- (-1242.260) [-1240.903] (-1243.258) (-1241.312) * (-1243.613) (-1242.914) (-1240.619) [-1241.452] -- 0:01:02 74500 -- (-1241.405) [-1242.690] (-1243.894) (-1241.088) * (-1243.204) [-1240.844] (-1246.115) (-1242.361) -- 0:01:02 75000 -- (-1241.017) (-1242.708) (-1244.762) [-1242.239] * (-1240.826) (-1241.787) (-1244.287) [-1241.098] -- 0:01:01 Average standard deviation of split frequencies: 0.035739 75500 -- (-1241.321) [-1242.554] (-1244.471) (-1241.830) * [-1240.920] (-1241.051) (-1243.200) (-1241.109) -- 0:01:01 76000 -- (-1241.769) (-1241.664) (-1244.557) [-1242.604] * [-1241.143] (-1240.579) (-1242.951) (-1241.976) -- 0:01:00 76500 -- (-1243.844) [-1241.456] (-1243.304) (-1243.855) * (-1242.939) [-1242.503] (-1245.902) (-1243.014) -- 0:01:00 77000 -- (-1243.469) [-1242.129] (-1242.895) (-1241.651) * (-1244.072) (-1241.235) (-1244.189) [-1241.564] -- 0:00:59 77500 -- (-1241.456) (-1244.076) (-1242.400) [-1242.620] * (-1244.090) (-1242.575) (-1243.719) [-1243.330] -- 0:00:59 78000 -- (-1241.792) (-1245.308) (-1244.518) [-1241.621] * [-1243.094] (-1242.003) (-1241.451) (-1243.018) -- 0:00:59 78500 -- [-1240.934] (-1240.959) (-1242.253) (-1242.563) * [-1244.477] (-1241.799) (-1241.602) (-1243.258) -- 0:00:58 79000 -- (-1245.621) [-1244.007] (-1242.663) (-1242.190) * (-1244.621) (-1242.773) [-1242.208] (-1244.940) -- 0:00:58 79500 -- (-1243.256) (-1242.771) [-1242.343] (-1243.329) * (-1243.255) (-1241.146) (-1241.396) [-1245.330] -- 0:01:09 80000 -- [-1243.704] (-1244.549) (-1241.574) (-1245.354) * (-1242.536) (-1241.154) (-1243.219) [-1246.017] -- 0:01:09 Average standard deviation of split frequencies: 0.035063 80500 -- [-1244.631] (-1245.311) (-1246.329) (-1246.952) * (-1253.094) [-1241.694] (-1241.894) (-1245.071) -- 0:01:08 81000 -- (-1246.029) (-1241.899) [-1241.703] (-1249.474) * (-1251.614) [-1243.320] (-1241.204) (-1242.282) -- 0:01:08 81500 -- (-1243.728) (-1244.753) (-1245.477) [-1242.001] * (-1244.057) (-1242.163) [-1242.193] (-1241.554) -- 0:01:07 82000 -- (-1245.320) [-1241.641] (-1242.620) (-1242.503) * (-1245.099) (-1244.707) (-1245.927) [-1241.624] -- 0:01:07 82500 -- [-1241.667] (-1241.853) (-1244.014) (-1242.504) * (-1243.945) (-1241.832) (-1246.832) [-1241.604] -- 0:01:06 83000 -- [-1241.562] (-1241.782) (-1242.703) (-1244.253) * (-1244.531) (-1241.832) (-1241.495) [-1242.161] -- 0:01:06 83500 -- (-1241.391) (-1242.814) [-1240.900] (-1243.893) * (-1243.729) (-1242.011) (-1241.210) [-1240.557] -- 0:01:05 84000 -- (-1241.327) (-1244.787) [-1244.062] (-1242.761) * [-1242.867] (-1244.399) (-1241.128) (-1244.145) -- 0:01:05 84500 -- (-1243.065) (-1242.495) [-1243.043] (-1243.476) * [-1243.734] (-1242.438) (-1241.343) (-1242.218) -- 0:01:05 85000 -- [-1241.284] (-1243.057) (-1245.816) (-1242.723) * (-1241.151) [-1242.819] (-1242.737) (-1243.092) -- 0:01:04 Average standard deviation of split frequencies: 0.031584 85500 -- (-1242.505) [-1243.912] (-1246.941) (-1242.387) * (-1243.146) [-1245.072] (-1242.387) (-1241.481) -- 0:01:04 86000 -- (-1244.067) (-1243.504) [-1240.722] (-1242.238) * [-1240.958] (-1242.824) (-1243.198) (-1241.034) -- 0:01:03 86500 -- (-1242.222) [-1241.304] (-1241.507) (-1242.304) * (-1241.685) [-1242.781] (-1241.996) (-1245.018) -- 0:01:03 87000 -- (-1242.420) (-1244.272) (-1248.692) [-1242.501] * (-1241.852) (-1247.360) (-1243.245) [-1243.719] -- 0:01:02 87500 -- [-1244.119] (-1243.061) (-1246.584) (-1240.967) * (-1240.921) (-1243.069) [-1243.757] (-1246.582) -- 0:01:02 88000 -- (-1243.787) (-1243.508) (-1242.930) [-1247.025] * (-1242.859) [-1242.817] (-1249.434) (-1246.961) -- 0:01:02 88500 -- (-1243.957) (-1243.095) (-1243.192) [-1242.150] * [-1240.411] (-1243.749) (-1248.518) (-1244.311) -- 0:01:01 89000 -- (-1242.442) (-1241.493) (-1244.396) [-1241.887] * (-1240.398) (-1244.023) (-1244.867) [-1242.398] -- 0:01:01 89500 -- (-1242.754) [-1246.745] (-1240.863) (-1242.308) * (-1241.651) [-1243.726] (-1245.147) (-1245.660) -- 0:01:01 90000 -- [-1242.602] (-1241.639) (-1245.853) (-1240.347) * (-1241.669) [-1243.475] (-1243.300) (-1242.088) -- 0:01:00 Average standard deviation of split frequencies: 0.027730 90500 -- (-1241.899) (-1241.517) [-1243.771] (-1243.593) * [-1241.029] (-1242.000) (-1244.931) (-1241.963) -- 0:01:00 91000 -- [-1241.272] (-1242.118) (-1244.668) (-1242.416) * (-1242.529) (-1241.198) [-1244.106] (-1244.372) -- 0:00:59 91500 -- (-1245.291) [-1241.223] (-1244.492) (-1244.031) * [-1243.033] (-1241.943) (-1241.410) (-1243.509) -- 0:00:59 92000 -- (-1242.628) (-1247.484) (-1241.886) [-1242.086] * (-1242.117) (-1243.818) [-1241.969] (-1245.907) -- 0:00:59 92500 -- [-1242.633] (-1244.032) (-1241.365) (-1243.303) * (-1241.807) (-1243.462) [-1242.255] (-1244.463) -- 0:00:58 93000 -- (-1241.742) (-1242.018) [-1241.352] (-1243.298) * [-1241.714] (-1243.308) (-1241.251) (-1242.142) -- 0:00:58 93500 -- (-1242.574) (-1244.093) [-1241.379] (-1241.867) * (-1244.718) (-1242.111) [-1240.701] (-1243.214) -- 0:00:58 94000 -- (-1242.557) (-1242.024) [-1242.084] (-1246.333) * (-1245.037) (-1242.532) (-1241.892) [-1241.511] -- 0:01:07 94500 -- (-1241.597) [-1244.328] (-1241.435) (-1243.217) * (-1244.974) (-1244.261) (-1241.811) [-1241.663] -- 0:01:07 95000 -- (-1242.808) (-1243.449) (-1243.349) [-1244.248] * [-1249.591] (-1241.933) (-1242.195) (-1244.937) -- 0:01:06 Average standard deviation of split frequencies: 0.025043 95500 -- (-1241.433) [-1243.218] (-1241.889) (-1241.389) * (-1244.945) [-1242.800] (-1241.078) (-1245.874) -- 0:01:06 96000 -- (-1241.802) (-1240.885) [-1242.407] (-1241.487) * [-1244.015] (-1241.701) (-1241.259) (-1244.310) -- 0:01:05 96500 -- (-1241.856) (-1240.974) (-1244.436) [-1241.368] * [-1244.067] (-1241.368) (-1247.340) (-1245.077) -- 0:01:05 97000 -- (-1242.473) (-1244.268) (-1245.978) [-1241.614] * [-1246.726] (-1241.753) (-1247.700) (-1241.534) -- 0:01:05 97500 -- (-1243.285) (-1243.406) [-1244.214] (-1241.711) * (-1246.192) (-1243.685) (-1242.208) [-1240.715] -- 0:01:04 98000 -- (-1242.631) (-1245.642) (-1248.280) [-1242.646] * [-1245.396] (-1243.159) (-1245.535) (-1240.905) -- 0:01:04 98500 -- (-1243.016) [-1242.220] (-1242.567) (-1243.850) * (-1242.359) [-1242.870] (-1244.033) (-1242.382) -- 0:01:04 99000 -- (-1241.588) (-1242.546) [-1244.186] (-1242.040) * (-1240.798) (-1242.229) (-1243.920) [-1242.609] -- 0:01:03 99500 -- (-1241.304) (-1240.554) [-1242.623] (-1244.247) * [-1240.935] (-1243.096) (-1241.765) (-1242.900) -- 0:01:03 100000 -- [-1243.968] (-1242.256) (-1241.177) (-1242.447) * [-1240.972] (-1243.146) (-1247.123) (-1241.040) -- 0:01:02 Average standard deviation of split frequencies: 0.027111 100500 -- (-1241.755) (-1244.753) [-1242.452] (-1241.755) * (-1248.362) (-1241.721) [-1243.398] (-1241.690) -- 0:01:02 101000 -- (-1245.002) [-1242.382] (-1240.854) (-1241.740) * (-1245.169) [-1242.173] (-1245.426) (-1246.589) -- 0:01:02 101500 -- [-1241.375] (-1241.037) (-1242.572) (-1241.912) * (-1241.885) [-1244.032] (-1242.905) (-1241.513) -- 0:01:01 102000 -- [-1241.764] (-1247.611) (-1242.223) (-1246.803) * [-1241.871] (-1242.532) (-1245.460) (-1241.240) -- 0:01:01 102500 -- (-1242.879) (-1248.489) [-1240.772] (-1243.759) * (-1241.913) [-1243.096] (-1246.319) (-1241.410) -- 0:01:01 103000 -- [-1242.597] (-1247.474) (-1243.865) (-1243.577) * (-1242.973) [-1242.141] (-1249.595) (-1243.833) -- 0:01:00 103500 -- (-1242.437) (-1247.948) (-1241.720) [-1245.343] * [-1244.290] (-1240.616) (-1245.800) (-1243.240) -- 0:01:00 104000 -- (-1244.168) [-1241.621] (-1241.929) (-1241.830) * (-1242.200) (-1240.805) [-1246.029] (-1243.240) -- 0:01:00 104500 -- [-1242.308] (-1242.529) (-1241.880) (-1240.477) * [-1244.782] (-1243.779) (-1245.794) (-1244.541) -- 0:00:59 105000 -- (-1241.053) (-1241.869) [-1243.373] (-1240.883) * [-1242.851] (-1244.296) (-1247.842) (-1242.050) -- 0:00:59 Average standard deviation of split frequencies: 0.025624 105500 -- (-1241.851) [-1241.454] (-1241.924) (-1241.088) * (-1247.207) (-1241.189) [-1243.305] (-1241.080) -- 0:00:59 106000 -- (-1242.503) [-1241.107] (-1242.409) (-1241.088) * [-1244.979] (-1241.489) (-1243.748) (-1241.862) -- 0:00:59 106500 -- [-1243.511] (-1240.716) (-1243.115) (-1242.758) * (-1243.690) (-1242.947) (-1244.301) [-1243.471] -- 0:00:58 107000 -- [-1243.515] (-1243.005) (-1241.484) (-1241.465) * [-1242.431] (-1244.173) (-1242.544) (-1244.651) -- 0:01:06 107500 -- (-1243.850) (-1241.820) (-1241.811) [-1243.963] * (-1243.165) (-1244.921) (-1242.537) [-1241.198] -- 0:01:06 108000 -- (-1246.019) (-1240.708) [-1243.627] (-1243.418) * (-1241.898) (-1248.601) [-1242.346] (-1242.236) -- 0:01:06 108500 -- [-1244.524] (-1242.503) (-1242.043) (-1241.280) * (-1243.222) (-1243.134) (-1241.583) [-1244.522] -- 0:01:05 109000 -- [-1245.025] (-1243.121) (-1245.023) (-1243.293) * (-1244.374) (-1243.236) (-1241.785) [-1241.548] -- 0:01:05 109500 -- (-1246.806) (-1241.260) [-1241.241] (-1245.581) * (-1241.121) (-1246.673) [-1241.769] (-1244.899) -- 0:01:05 110000 -- (-1245.207) [-1241.272] (-1241.111) (-1245.671) * [-1243.626] (-1245.873) (-1242.279) (-1248.231) -- 0:01:04 Average standard deviation of split frequencies: 0.026679 110500 -- (-1245.231) (-1242.984) [-1243.651] (-1245.070) * (-1243.346) (-1246.291) [-1241.678] (-1244.474) -- 0:01:04 111000 -- (-1243.592) [-1243.286] (-1241.427) (-1246.200) * (-1242.740) [-1241.278] (-1240.525) (-1246.308) -- 0:01:04 111500 -- (-1243.417) (-1242.475) [-1241.469] (-1247.725) * (-1247.523) [-1241.279] (-1240.496) (-1246.527) -- 0:01:03 112000 -- (-1241.231) (-1244.733) [-1246.882] (-1245.006) * [-1245.399] (-1249.314) (-1243.699) (-1246.757) -- 0:01:03 112500 -- (-1241.770) (-1243.442) (-1243.566) [-1241.723] * [-1244.819] (-1244.010) (-1243.200) (-1245.190) -- 0:01:03 113000 -- [-1242.005] (-1242.496) (-1241.766) (-1241.879) * (-1244.552) (-1243.533) [-1240.904] (-1243.901) -- 0:01:02 113500 -- (-1246.401) (-1240.750) [-1242.312] (-1242.111) * (-1244.996) [-1243.791] (-1241.079) (-1245.298) -- 0:01:02 114000 -- (-1248.872) (-1241.421) (-1242.030) [-1244.200] * (-1240.987) (-1250.542) (-1244.616) [-1241.910] -- 0:01:02 114500 -- (-1245.008) [-1240.988] (-1241.701) (-1246.223) * (-1241.135) [-1246.815] (-1244.750) (-1246.462) -- 0:01:01 115000 -- (-1243.927) (-1240.988) [-1242.659] (-1244.917) * (-1241.516) [-1243.229] (-1246.369) (-1244.011) -- 0:01:01 Average standard deviation of split frequencies: 0.024157 115500 -- (-1241.170) (-1240.454) [-1240.776] (-1242.858) * (-1241.516) [-1243.520] (-1243.954) (-1241.824) -- 0:01:01 116000 -- (-1240.875) (-1242.520) (-1241.097) [-1241.742] * [-1241.381] (-1241.199) (-1244.603) (-1241.722) -- 0:01:00 116500 -- (-1250.272) (-1242.379) [-1240.965] (-1243.165) * (-1245.043) (-1242.565) [-1243.378] (-1242.500) -- 0:01:00 117000 -- (-1246.527) (-1245.089) (-1241.308) [-1244.060] * (-1242.056) (-1244.982) (-1243.494) [-1243.061] -- 0:01:00 117500 -- (-1247.202) (-1245.089) [-1241.015] (-1244.985) * (-1241.230) [-1245.407] (-1241.495) (-1243.985) -- 0:01:00 118000 -- (-1250.904) [-1246.871] (-1241.422) (-1244.188) * (-1243.745) [-1244.131] (-1241.877) (-1243.126) -- 0:00:59 118500 -- (-1244.449) (-1243.474) [-1245.679] (-1242.572) * (-1242.904) (-1243.109) [-1240.248] (-1242.558) -- 0:00:59 119000 -- (-1250.577) (-1242.910) [-1242.820] (-1243.499) * (-1242.058) (-1241.560) (-1241.550) [-1242.600] -- 0:00:59 119500 -- (-1242.692) (-1243.658) (-1241.408) [-1241.894] * (-1242.925) (-1245.657) [-1243.659] (-1242.724) -- 0:00:58 120000 -- [-1241.495] (-1243.811) (-1240.796) (-1241.494) * (-1242.127) [-1242.786] (-1243.020) (-1243.354) -- 0:00:58 Average standard deviation of split frequencies: 0.024742 120500 -- (-1242.207) (-1243.597) [-1240.799] (-1241.991) * (-1242.426) (-1240.892) [-1242.280] (-1240.699) -- 0:00:58 121000 -- (-1241.667) (-1243.392) (-1240.483) [-1243.430] * (-1241.959) (-1243.408) (-1240.936) [-1242.353] -- 0:00:58 121500 -- [-1241.658] (-1243.295) (-1242.402) (-1242.339) * (-1242.512) (-1247.883) [-1244.678] (-1241.186) -- 0:00:57 122000 -- [-1241.541] (-1242.490) (-1240.780) (-1243.036) * [-1244.077] (-1243.503) (-1241.873) (-1241.045) -- 0:00:57 122500 -- (-1242.316) (-1241.516) (-1241.543) [-1241.978] * (-1248.104) (-1245.484) [-1242.920] (-1242.366) -- 0:01:04 123000 -- [-1241.865] (-1243.297) (-1247.097) (-1241.885) * (-1245.804) (-1245.850) [-1241.027] (-1241.769) -- 0:01:04 123500 -- (-1245.447) (-1244.854) (-1247.065) [-1240.531] * (-1243.215) [-1241.543] (-1242.388) (-1240.675) -- 0:01:03 124000 -- (-1244.893) (-1241.579) (-1241.306) [-1242.544] * (-1241.939) (-1241.555) (-1243.205) [-1241.835] -- 0:01:03 124500 -- [-1243.453] (-1241.691) (-1241.226) (-1243.894) * (-1242.071) [-1241.248] (-1243.358) (-1241.924) -- 0:01:03 125000 -- (-1243.489) (-1244.401) (-1240.891) [-1243.376] * (-1244.847) (-1241.750) [-1243.373] (-1243.296) -- 0:01:03 Average standard deviation of split frequencies: 0.023383 125500 -- [-1245.132] (-1245.274) (-1240.438) (-1242.083) * (-1242.696) (-1241.962) (-1241.961) [-1241.605] -- 0:01:02 126000 -- (-1247.024) [-1245.535] (-1241.232) (-1242.083) * (-1244.538) (-1241.364) [-1244.244] (-1241.774) -- 0:01:02 126500 -- (-1244.494) (-1241.432) (-1241.817) [-1241.166] * (-1244.401) (-1242.663) [-1240.613] (-1244.960) -- 0:01:02 127000 -- (-1243.434) (-1242.474) [-1241.176] (-1241.662) * (-1247.952) (-1244.836) (-1240.337) [-1243.957] -- 0:01:01 127500 -- (-1243.931) [-1243.436] (-1240.889) (-1240.877) * (-1242.225) [-1241.556] (-1240.608) (-1241.700) -- 0:01:01 128000 -- (-1241.504) [-1242.238] (-1244.618) (-1245.524) * (-1243.691) [-1241.667] (-1242.297) (-1241.298) -- 0:01:01 128500 -- (-1241.222) [-1241.350] (-1242.958) (-1242.986) * (-1244.224) [-1242.150] (-1241.702) (-1242.970) -- 0:01:01 129000 -- (-1241.393) [-1243.182] (-1243.768) (-1243.196) * [-1244.173] (-1242.553) (-1244.118) (-1244.710) -- 0:01:00 129500 -- (-1241.271) [-1241.545] (-1244.133) (-1243.061) * (-1242.193) (-1242.873) [-1241.880] (-1243.457) -- 0:01:00 130000 -- [-1240.694] (-1242.739) (-1244.474) (-1241.770) * (-1244.584) (-1241.550) (-1240.768) [-1244.816] -- 0:01:00 Average standard deviation of split frequencies: 0.022785 130500 -- (-1240.953) (-1248.073) (-1243.188) [-1242.082] * (-1244.915) (-1240.912) (-1242.076) [-1242.244] -- 0:00:59 131000 -- (-1242.904) (-1244.095) [-1242.548] (-1246.181) * (-1244.264) (-1243.015) [-1241.496] (-1242.135) -- 0:00:59 131500 -- (-1242.257) [-1244.586] (-1243.084) (-1242.602) * [-1247.621] (-1243.046) (-1241.520) (-1241.448) -- 0:00:59 132000 -- (-1247.355) (-1246.007) [-1241.660] (-1245.466) * (-1248.049) [-1243.164] (-1241.825) (-1241.811) -- 0:00:59 132500 -- (-1247.717) (-1249.117) [-1242.119] (-1244.782) * (-1245.950) [-1243.042] (-1240.955) (-1242.234) -- 0:00:58 133000 -- [-1243.026] (-1242.639) (-1244.043) (-1246.618) * (-1247.729) (-1241.576) (-1242.172) [-1243.011] -- 0:00:58 133500 -- [-1243.231] (-1243.980) (-1242.282) (-1242.320) * (-1247.641) [-1245.178] (-1241.102) (-1242.877) -- 0:00:58 134000 -- (-1241.863) (-1242.070) (-1245.288) [-1245.060] * (-1243.209) (-1244.683) [-1241.808] (-1245.256) -- 0:00:58 134500 -- (-1243.886) [-1244.895] (-1243.671) (-1245.306) * (-1245.038) (-1242.992) [-1242.771] (-1241.785) -- 0:00:57 135000 -- (-1242.029) (-1245.158) [-1245.040] (-1245.930) * (-1243.679) (-1243.030) (-1243.999) [-1244.235] -- 0:00:57 Average standard deviation of split frequencies: 0.023899 135500 -- (-1242.517) (-1242.503) [-1242.708] (-1243.541) * (-1245.618) (-1244.974) [-1241.332] (-1243.160) -- 0:00:57 136000 -- [-1240.965] (-1242.947) (-1241.152) (-1244.317) * (-1244.854) (-1243.851) [-1244.297] (-1244.800) -- 0:00:57 136500 -- (-1246.814) (-1242.367) (-1243.269) [-1242.562] * (-1246.233) (-1242.695) [-1241.547] (-1242.656) -- 0:00:56 137000 -- (-1244.794) (-1245.044) [-1244.388] (-1244.429) * [-1242.821] (-1242.329) (-1242.376) (-1242.882) -- 0:00:56 137500 -- (-1242.950) (-1243.074) [-1242.881] (-1246.058) * (-1243.494) (-1243.447) (-1241.534) [-1241.473] -- 0:00:56 138000 -- [-1241.308] (-1242.466) (-1242.991) (-1243.453) * [-1244.009] (-1242.332) (-1242.328) (-1241.881) -- 0:00:56 138500 -- (-1241.572) (-1243.071) (-1243.171) [-1242.531] * (-1243.172) (-1246.678) [-1242.527] (-1244.485) -- 0:01:02 139000 -- (-1241.987) [-1242.772] (-1244.250) (-1242.767) * (-1242.601) (-1244.244) (-1242.049) [-1242.203] -- 0:01:01 139500 -- (-1244.056) (-1243.269) [-1242.967] (-1244.561) * (-1241.111) (-1241.013) (-1240.831) [-1241.760] -- 0:01:01 140000 -- (-1243.584) [-1245.728] (-1241.751) (-1243.374) * (-1243.475) (-1242.365) (-1241.854) [-1241.274] -- 0:01:01 Average standard deviation of split frequencies: 0.021342 140500 -- (-1243.303) [-1240.896] (-1241.658) (-1241.684) * (-1244.494) (-1244.434) (-1243.426) [-1242.303] -- 0:01:01 141000 -- (-1243.261) (-1241.260) (-1241.708) [-1245.316] * [-1241.216] (-1244.434) (-1244.168) (-1242.983) -- 0:01:00 141500 -- (-1242.410) (-1243.151) (-1243.324) [-1243.870] * (-1243.777) (-1244.651) (-1245.050) [-1242.452] -- 0:01:00 142000 -- (-1243.449) [-1241.846] (-1244.891) (-1247.107) * [-1243.843] (-1244.654) (-1242.170) (-1247.247) -- 0:01:00 142500 -- (-1244.527) [-1241.214] (-1242.273) (-1242.217) * [-1240.560] (-1242.276) (-1245.289) (-1242.754) -- 0:01:00 143000 -- (-1243.687) [-1242.623] (-1241.980) (-1244.873) * (-1242.267) (-1242.230) (-1243.318) [-1242.722] -- 0:00:59 143500 -- (-1241.701) (-1242.931) (-1242.332) [-1243.950] * [-1241.364] (-1242.770) (-1242.824) (-1242.488) -- 0:00:59 144000 -- [-1241.295] (-1247.522) (-1241.300) (-1241.777) * [-1241.526] (-1241.718) (-1243.639) (-1241.447) -- 0:00:59 144500 -- [-1241.355] (-1249.686) (-1242.680) (-1244.817) * (-1246.122) (-1242.732) (-1247.079) [-1243.150] -- 0:00:59 145000 -- (-1242.569) (-1242.655) (-1243.137) [-1243.524] * (-1244.868) (-1240.877) [-1241.751] (-1241.048) -- 0:00:58 Average standard deviation of split frequencies: 0.021922 145500 -- [-1243.033] (-1242.790) (-1241.802) (-1242.506) * (-1242.146) (-1241.161) (-1247.930) [-1241.739] -- 0:00:58 146000 -- [-1241.231] (-1241.399) (-1241.245) (-1241.851) * (-1241.158) (-1241.075) (-1241.551) [-1245.914] -- 0:00:58 146500 -- (-1241.174) (-1240.947) (-1248.608) [-1246.570] * [-1241.975] (-1242.977) (-1240.829) (-1243.237) -- 0:00:58 147000 -- (-1242.502) (-1241.202) (-1242.496) [-1243.453] * (-1242.154) (-1244.272) [-1241.334] (-1244.315) -- 0:00:58 147500 -- (-1241.992) (-1241.144) (-1242.611) [-1243.410] * (-1241.754) (-1243.997) [-1240.781] (-1243.840) -- 0:00:57 148000 -- (-1242.414) [-1241.712] (-1241.544) (-1242.980) * (-1242.859) (-1243.305) (-1241.412) [-1240.867] -- 0:00:57 148500 -- (-1241.213) (-1241.257) (-1241.019) [-1244.292] * (-1246.556) (-1244.210) (-1242.558) [-1242.683] -- 0:00:57 149000 -- [-1242.750] (-1241.979) (-1242.527) (-1242.994) * (-1244.318) (-1245.422) [-1241.854] (-1242.108) -- 0:00:57 149500 -- (-1243.392) (-1241.164) (-1243.066) [-1244.747] * (-1241.948) (-1244.483) (-1241.030) [-1242.278] -- 0:00:56 150000 -- [-1243.122] (-1244.335) (-1243.066) (-1243.686) * (-1243.851) (-1243.331) [-1241.474] (-1243.494) -- 0:00:56 Average standard deviation of split frequencies: 0.021243 150500 -- (-1243.173) (-1243.589) (-1242.776) [-1243.237] * (-1241.161) (-1242.512) (-1243.038) [-1242.039] -- 0:00:56 151000 -- (-1243.610) (-1241.377) [-1243.597] (-1243.212) * [-1243.279] (-1243.784) (-1242.198) (-1242.627) -- 0:00:56 151500 -- (-1244.331) (-1242.195) [-1242.799] (-1243.927) * (-1240.683) (-1244.122) [-1243.085] (-1241.836) -- 0:00:56 152000 -- (-1243.267) (-1244.845) [-1242.270] (-1242.098) * (-1242.840) (-1242.049) [-1242.456] (-1245.306) -- 0:00:55 152500 -- (-1243.036) (-1240.857) (-1240.380) [-1241.651] * [-1243.746] (-1242.562) (-1241.608) (-1242.292) -- 0:00:55 153000 -- (-1244.554) (-1241.240) (-1241.786) [-1240.667] * (-1244.932) (-1243.547) (-1242.101) [-1242.484] -- 0:00:55 153500 -- (-1245.575) [-1240.776] (-1241.093) (-1241.302) * (-1243.921) [-1243.234] (-1242.281) (-1244.823) -- 0:00:55 154000 -- (-1246.261) [-1242.992] (-1242.499) (-1244.746) * (-1243.381) [-1242.989] (-1244.573) (-1248.272) -- 0:00:54 154500 -- (-1244.474) (-1245.711) [-1242.732] (-1245.145) * (-1240.997) (-1241.730) [-1242.053] (-1241.442) -- 0:00:54 155000 -- (-1246.375) (-1242.085) (-1243.727) [-1242.828] * (-1241.414) [-1244.905] (-1242.053) (-1241.998) -- 0:00:59 Average standard deviation of split frequencies: 0.022425 155500 -- (-1245.257) [-1242.691] (-1241.451) (-1244.023) * [-1240.938] (-1248.544) (-1243.276) (-1241.539) -- 0:00:59 156000 -- (-1241.692) (-1242.035) [-1241.260] (-1242.591) * (-1241.890) [-1242.559] (-1242.695) (-1241.368) -- 0:00:59 156500 -- (-1245.818) (-1241.671) (-1244.736) [-1241.094] * (-1243.553) (-1242.617) [-1240.636] (-1244.010) -- 0:00:59 157000 -- (-1247.162) (-1240.747) (-1244.144) [-1241.157] * (-1244.555) [-1242.638] (-1246.368) (-1246.771) -- 0:00:59 157500 -- (-1243.418) (-1240.894) [-1246.655] (-1242.605) * (-1245.038) (-1241.919) [-1244.068] (-1245.292) -- 0:00:58 158000 -- (-1241.460) [-1242.935] (-1241.370) (-1242.605) * [-1240.992] (-1245.434) (-1243.947) (-1246.025) -- 0:00:58 158500 -- (-1242.027) [-1242.540] (-1241.468) (-1241.147) * (-1241.219) [-1243.703] (-1243.337) (-1245.026) -- 0:00:58 159000 -- (-1242.028) (-1242.139) (-1241.840) [-1241.371] * [-1241.704] (-1242.755) (-1246.207) (-1246.185) -- 0:00:58 159500 -- [-1241.819] (-1246.919) (-1242.016) (-1243.051) * (-1242.029) (-1245.105) [-1244.363] (-1244.780) -- 0:00:57 160000 -- (-1242.596) [-1244.829] (-1244.551) (-1249.560) * (-1241.364) (-1241.060) [-1245.822] (-1242.493) -- 0:00:57 Average standard deviation of split frequencies: 0.023318 160500 -- [-1243.684] (-1243.369) (-1245.383) (-1243.713) * (-1242.303) (-1241.901) (-1245.505) [-1241.056] -- 0:00:57 161000 -- (-1240.514) (-1241.306) [-1243.230] (-1243.120) * (-1241.311) (-1244.589) (-1247.453) [-1240.412] -- 0:00:57 161500 -- (-1242.949) (-1241.656) (-1241.080) [-1244.817] * [-1241.447] (-1244.054) (-1243.943) (-1241.479) -- 0:00:57 162000 -- [-1241.742] (-1241.399) (-1241.863) (-1243.914) * [-1241.447] (-1245.776) (-1243.002) (-1241.045) -- 0:00:56 162500 -- (-1241.729) (-1241.930) [-1241.992] (-1248.945) * (-1242.643) (-1241.999) (-1242.077) [-1244.104] -- 0:00:56 163000 -- (-1242.770) (-1244.227) [-1240.820] (-1242.910) * [-1242.758] (-1242.307) (-1243.064) (-1242.621) -- 0:00:56 163500 -- [-1242.940] (-1241.348) (-1240.571) (-1242.334) * [-1241.262] (-1241.581) (-1240.727) (-1240.864) -- 0:00:56 164000 -- (-1242.062) (-1242.708) [-1243.920] (-1243.814) * (-1241.536) [-1240.359] (-1240.705) (-1243.720) -- 0:00:56 164500 -- (-1241.447) (-1242.465) (-1243.363) [-1241.870] * [-1242.980] (-1242.043) (-1241.131) (-1243.148) -- 0:00:55 165000 -- (-1242.144) (-1242.676) [-1241.681] (-1243.730) * (-1245.062) (-1242.844) (-1240.793) [-1241.982] -- 0:00:55 Average standard deviation of split frequencies: 0.023428 165500 -- (-1240.909) (-1244.239) [-1241.900] (-1242.096) * [-1245.824] (-1241.975) (-1245.922) (-1241.833) -- 0:00:55 166000 -- (-1241.303) (-1244.036) [-1242.050] (-1242.701) * [-1245.839] (-1242.547) (-1243.868) (-1241.666) -- 0:00:55 166500 -- [-1241.308] (-1244.052) (-1241.776) (-1243.458) * [-1243.486] (-1244.021) (-1242.625) (-1241.990) -- 0:00:55 167000 -- [-1242.906] (-1245.114) (-1241.673) (-1241.500) * (-1246.754) [-1242.847] (-1251.738) (-1242.067) -- 0:00:54 167500 -- [-1242.031] (-1243.108) (-1241.676) (-1243.282) * (-1240.605) (-1242.246) [-1242.892] (-1241.857) -- 0:00:54 168000 -- (-1241.421) [-1242.455] (-1247.911) (-1243.179) * (-1242.053) (-1243.121) [-1242.521] (-1242.031) -- 0:00:54 168500 -- (-1241.648) [-1243.185] (-1241.835) (-1241.910) * [-1243.470] (-1242.024) (-1241.663) (-1241.176) -- 0:00:54 169000 -- (-1245.720) [-1242.550] (-1243.733) (-1242.555) * (-1243.166) (-1241.835) [-1240.403] (-1241.905) -- 0:00:54 169500 -- [-1245.712] (-1241.471) (-1242.733) (-1244.075) * (-1249.368) (-1242.602) [-1241.348] (-1241.520) -- 0:00:53 170000 -- (-1244.752) (-1245.247) [-1243.943] (-1244.293) * (-1245.370) (-1241.253) [-1241.358] (-1246.183) -- 0:00:53 Average standard deviation of split frequencies: 0.025005 170500 -- (-1242.218) (-1242.155) (-1241.324) [-1244.417] * (-1243.364) (-1241.316) [-1241.432] (-1245.472) -- 0:00:53 171000 -- (-1242.125) (-1242.186) [-1241.776] (-1243.238) * (-1241.553) [-1242.421] (-1241.370) (-1242.934) -- 0:00:58 171500 -- [-1241.868] (-1242.323) (-1245.156) (-1243.648) * (-1241.494) (-1243.857) (-1240.669) [-1245.461] -- 0:00:57 172000 -- (-1241.474) [-1241.787] (-1243.498) (-1242.294) * (-1242.575) [-1243.901] (-1240.633) (-1242.518) -- 0:00:57 172500 -- [-1241.475] (-1244.256) (-1241.256) (-1242.767) * [-1241.169] (-1244.405) (-1242.209) (-1243.135) -- 0:00:57 173000 -- [-1241.093] (-1247.729) (-1242.611) (-1244.962) * (-1243.396) (-1242.123) [-1241.618] (-1242.746) -- 0:00:57 173500 -- [-1240.296] (-1245.174) (-1243.027) (-1242.945) * (-1242.706) (-1243.317) (-1242.836) [-1241.125] -- 0:00:57 174000 -- (-1241.217) [-1241.647] (-1245.473) (-1242.901) * (-1241.831) [-1241.162] (-1246.859) (-1246.007) -- 0:00:56 174500 -- (-1242.174) (-1242.435) [-1243.309] (-1242.945) * (-1243.254) [-1241.048] (-1243.986) (-1242.471) -- 0:00:56 175000 -- (-1241.450) [-1242.629] (-1241.179) (-1242.504) * (-1243.293) (-1241.990) [-1244.754] (-1241.695) -- 0:00:56 Average standard deviation of split frequencies: 0.025516 175500 -- (-1241.470) (-1242.502) (-1241.312) [-1241.497] * [-1241.106] (-1243.892) (-1244.831) (-1242.248) -- 0:00:56 176000 -- (-1242.217) (-1247.358) (-1245.580) [-1241.444] * (-1241.753) (-1245.780) [-1243.264] (-1243.311) -- 0:00:56 176500 -- [-1241.920] (-1243.507) (-1242.489) (-1241.353) * [-1241.282] (-1244.689) (-1243.650) (-1244.436) -- 0:00:55 177000 -- [-1244.163] (-1244.690) (-1242.012) (-1240.846) * (-1243.430) (-1242.786) [-1249.411] (-1243.713) -- 0:00:55 177500 -- (-1245.670) [-1241.412] (-1242.231) (-1242.040) * (-1243.612) [-1243.216] (-1245.688) (-1246.082) -- 0:00:55 178000 -- [-1245.607] (-1241.627) (-1240.639) (-1240.574) * (-1244.374) (-1242.269) (-1240.480) [-1241.536] -- 0:00:55 178500 -- (-1246.496) (-1240.813) (-1242.099) [-1240.753] * (-1244.177) (-1244.245) [-1242.699] (-1241.625) -- 0:00:55 179000 -- (-1246.842) [-1244.637] (-1241.143) (-1240.487) * (-1244.349) (-1242.256) (-1243.777) [-1241.043] -- 0:00:55 179500 -- (-1247.598) [-1246.560] (-1243.759) (-1241.023) * (-1246.672) [-1241.216] (-1242.034) (-1241.470) -- 0:00:54 180000 -- (-1241.831) (-1246.037) [-1241.316] (-1242.152) * (-1242.699) [-1242.362] (-1241.573) (-1243.010) -- 0:00:54 Average standard deviation of split frequencies: 0.023346 180500 -- (-1242.745) [-1241.649] (-1246.707) (-1241.886) * [-1242.492] (-1242.927) (-1244.685) (-1243.885) -- 0:00:54 181000 -- [-1241.350] (-1244.127) (-1245.724) (-1241.664) * (-1244.224) (-1242.083) (-1241.139) [-1241.573] -- 0:00:54 181500 -- [-1241.836] (-1245.073) (-1244.722) (-1244.388) * (-1244.536) [-1242.682] (-1241.102) (-1243.337) -- 0:00:54 182000 -- [-1240.844] (-1245.191) (-1240.576) (-1245.610) * (-1244.348) (-1245.362) [-1241.132] (-1244.949) -- 0:00:53 182500 -- (-1242.100) (-1242.895) [-1242.098] (-1246.934) * [-1241.880] (-1244.584) (-1243.409) (-1251.931) -- 0:00:53 183000 -- [-1248.345] (-1241.137) (-1241.212) (-1244.347) * [-1244.608] (-1243.671) (-1243.247) (-1244.772) -- 0:00:53 183500 -- (-1243.329) (-1241.006) [-1244.080] (-1244.548) * (-1243.681) [-1246.177] (-1244.322) (-1244.038) -- 0:00:53 184000 -- (-1241.326) (-1240.951) (-1243.253) [-1242.788] * (-1244.932) (-1249.817) (-1244.868) [-1241.167] -- 0:00:53 184500 -- (-1243.022) [-1244.446] (-1243.169) (-1245.471) * [-1245.206] (-1244.008) (-1245.252) (-1245.359) -- 0:00:53 185000 -- (-1241.430) (-1243.872) (-1240.913) [-1242.727] * (-1246.962) (-1241.466) (-1241.702) [-1245.780] -- 0:00:52 Average standard deviation of split frequencies: 0.024544 185500 -- (-1240.996) (-1243.376) [-1240.369] (-1245.643) * (-1245.801) [-1243.710] (-1244.396) (-1244.142) -- 0:00:52 186000 -- (-1241.127) [-1241.146] (-1240.760) (-1242.570) * (-1248.754) (-1243.230) (-1246.009) [-1242.612] -- 0:00:56 186500 -- (-1242.234) (-1241.721) [-1240.688] (-1244.118) * (-1244.150) [-1240.863] (-1244.734) (-1242.476) -- 0:00:56 187000 -- (-1242.275) (-1243.532) (-1241.132) [-1242.037] * (-1241.041) (-1242.183) (-1241.419) [-1242.521] -- 0:00:56 187500 -- (-1241.049) [-1240.599] (-1243.161) (-1241.248) * (-1240.785) (-1245.725) (-1244.805) [-1241.317] -- 0:00:56 188000 -- (-1241.265) [-1242.280] (-1240.515) (-1241.841) * (-1241.847) [-1243.135] (-1244.756) (-1243.737) -- 0:00:56 188500 -- (-1241.509) (-1242.318) [-1240.333] (-1242.706) * (-1244.105) (-1253.732) (-1245.560) [-1242.867] -- 0:00:55 189000 -- (-1241.228) (-1241.904) (-1243.664) [-1243.747] * (-1242.837) (-1245.880) (-1243.485) [-1242.141] -- 0:00:55 189500 -- (-1242.336) [-1242.185] (-1240.633) (-1244.096) * (-1244.013) (-1246.040) [-1248.107] (-1241.500) -- 0:00:55 190000 -- [-1241.806] (-1246.524) (-1241.597) (-1243.318) * (-1248.205) (-1243.907) (-1244.953) [-1242.279] -- 0:00:55 Average standard deviation of split frequencies: 0.022642 190500 -- (-1243.966) [-1248.547] (-1248.817) (-1243.684) * (-1245.033) (-1243.438) [-1244.175] (-1242.054) -- 0:00:55 191000 -- (-1243.746) (-1246.672) (-1242.559) [-1241.415] * (-1242.703) (-1240.696) (-1243.518) [-1241.773] -- 0:00:55 191500 -- [-1241.464] (-1243.123) (-1244.608) (-1241.751) * (-1241.753) [-1241.229] (-1244.771) (-1241.064) -- 0:00:54 192000 -- [-1240.911] (-1240.461) (-1246.426) (-1241.920) * (-1241.811) [-1241.604] (-1246.939) (-1241.833) -- 0:00:54 192500 -- [-1240.794] (-1241.477) (-1244.334) (-1243.689) * [-1242.175] (-1242.918) (-1247.445) (-1241.301) -- 0:00:54 193000 -- (-1242.506) (-1241.075) [-1242.925] (-1242.416) * (-1242.616) [-1242.427] (-1242.120) (-1240.873) -- 0:00:54 193500 -- (-1240.911) [-1243.581] (-1245.490) (-1240.617) * (-1241.657) [-1241.626] (-1243.066) (-1240.814) -- 0:00:54 194000 -- (-1241.441) [-1241.249] (-1242.415) (-1240.470) * (-1241.506) (-1243.487) [-1243.107] (-1240.517) -- 0:00:54 194500 -- (-1241.466) [-1240.978] (-1245.854) (-1241.125) * (-1246.312) [-1243.980] (-1244.785) (-1241.245) -- 0:00:53 195000 -- [-1242.063] (-1244.442) (-1247.829) (-1241.573) * (-1248.694) [-1241.071] (-1241.887) (-1241.245) -- 0:00:53 Average standard deviation of split frequencies: 0.024684 195500 -- [-1241.448] (-1241.375) (-1246.202) (-1244.281) * (-1243.801) (-1243.882) [-1241.584] (-1243.964) -- 0:00:53 196000 -- (-1242.560) [-1243.332] (-1243.634) (-1245.579) * (-1244.595) (-1243.593) [-1242.119] (-1242.304) -- 0:00:53 196500 -- (-1245.001) (-1244.008) [-1242.879] (-1241.438) * (-1241.547) [-1244.311] (-1242.351) (-1243.363) -- 0:00:53 197000 -- [-1241.062] (-1245.688) (-1242.022) (-1243.141) * (-1242.924) [-1241.468] (-1243.009) (-1243.510) -- 0:00:52 197500 -- [-1241.555] (-1241.541) (-1242.979) (-1241.236) * (-1243.239) (-1242.489) (-1241.103) [-1240.879] -- 0:00:52 198000 -- (-1242.889) (-1242.133) [-1242.630] (-1240.646) * (-1242.735) (-1246.805) (-1242.063) [-1245.184] -- 0:00:52 198500 -- [-1242.086] (-1241.420) (-1244.333) (-1245.910) * [-1242.281] (-1242.983) (-1244.170) (-1240.841) -- 0:00:52 199000 -- (-1243.059) [-1241.313] (-1241.586) (-1244.915) * (-1242.649) [-1242.301] (-1241.453) (-1241.255) -- 0:00:52 199500 -- (-1241.560) (-1244.396) (-1242.792) [-1244.519] * [-1242.865] (-1241.374) (-1244.578) (-1242.725) -- 0:00:52 200000 -- (-1243.105) [-1243.065] (-1242.668) (-1242.697) * (-1245.648) (-1241.034) (-1243.283) [-1242.799] -- 0:00:51 Average standard deviation of split frequencies: 0.025470 200500 -- (-1244.244) (-1244.401) [-1241.579] (-1245.071) * (-1244.410) (-1244.538) [-1243.652] (-1243.752) -- 0:00:51 201000 -- (-1242.813) [-1243.807] (-1247.093) (-1243.241) * (-1242.275) (-1244.390) [-1243.111] (-1242.617) -- 0:00:51 201500 -- (-1243.649) [-1241.105] (-1243.107) (-1243.470) * (-1242.253) (-1242.513) (-1240.446) [-1241.936] -- 0:00:55 202000 -- (-1245.683) (-1241.400) (-1243.298) [-1244.780] * (-1246.327) (-1241.381) (-1241.507) [-1242.229] -- 0:00:55 202500 -- (-1243.080) (-1241.191) (-1241.609) [-1246.548] * [-1243.497] (-1241.364) (-1242.841) (-1241.347) -- 0:00:55 203000 -- [-1242.694] (-1240.832) (-1244.055) (-1243.993) * (-1244.541) (-1243.590) (-1242.885) [-1240.507] -- 0:00:54 203500 -- (-1241.087) (-1240.862) [-1243.300] (-1243.033) * (-1242.376) (-1242.150) [-1242.077] (-1241.451) -- 0:00:54 204000 -- (-1241.169) (-1241.439) [-1240.608] (-1248.630) * [-1240.670] (-1242.349) (-1242.540) (-1240.891) -- 0:00:54 204500 -- (-1241.547) (-1242.056) (-1240.608) [-1244.664] * (-1240.519) [-1242.402] (-1241.141) (-1241.132) -- 0:00:54 205000 -- [-1242.183] (-1244.831) (-1241.351) (-1242.343) * [-1241.981] (-1242.290) (-1241.722) (-1241.991) -- 0:00:54 Average standard deviation of split frequencies: 0.024931 205500 -- (-1240.876) (-1242.439) (-1241.477) [-1240.920] * [-1241.774] (-1242.615) (-1244.112) (-1241.047) -- 0:00:54 206000 -- [-1242.750] (-1243.470) (-1244.314) (-1240.774) * (-1241.165) (-1242.037) (-1244.429) [-1241.576] -- 0:00:53 206500 -- (-1244.362) (-1241.359) (-1243.518) [-1243.639] * (-1244.659) (-1241.795) (-1243.434) [-1242.472] -- 0:00:53 207000 -- [-1244.062] (-1241.336) (-1242.462) (-1242.818) * (-1245.607) (-1241.448) [-1242.937] (-1251.725) -- 0:00:53 207500 -- [-1241.922] (-1240.819) (-1242.812) (-1241.453) * [-1241.278] (-1240.834) (-1242.554) (-1246.811) -- 0:00:53 208000 -- (-1242.117) [-1240.484] (-1242.247) (-1241.461) * (-1241.266) (-1242.121) (-1246.404) [-1243.792] -- 0:00:53 208500 -- [-1242.455] (-1244.494) (-1244.414) (-1242.147) * (-1241.865) (-1244.560) (-1249.060) [-1245.372] -- 0:00:53 209000 -- (-1242.543) [-1241.669] (-1244.641) (-1242.176) * [-1244.063] (-1242.287) (-1246.720) (-1244.323) -- 0:00:52 209500 -- (-1246.171) (-1242.977) (-1243.338) [-1242.044] * [-1245.810] (-1246.783) (-1242.437) (-1241.189) -- 0:00:52 210000 -- (-1248.360) (-1245.696) [-1241.775] (-1242.034) * (-1242.418) (-1241.445) (-1248.439) [-1242.891] -- 0:00:52 Average standard deviation of split frequencies: 0.024143 210500 -- (-1242.943) (-1242.296) (-1242.200) [-1245.155] * (-1242.757) (-1244.239) [-1243.102] (-1243.405) -- 0:00:52 211000 -- (-1241.604) [-1244.243] (-1241.146) (-1248.568) * (-1242.859) (-1249.203) [-1242.104] (-1243.715) -- 0:00:52 211500 -- (-1247.258) [-1241.814] (-1244.537) (-1248.378) * [-1242.358] (-1243.647) (-1244.783) (-1242.785) -- 0:00:52 212000 -- [-1242.134] (-1243.524) (-1241.427) (-1247.750) * (-1242.469) [-1245.406] (-1243.482) (-1242.874) -- 0:00:52 212500 -- (-1242.117) (-1249.279) (-1241.023) [-1241.040] * [-1242.249] (-1243.181) (-1243.233) (-1242.318) -- 0:00:51 213000 -- (-1242.613) (-1248.613) (-1241.023) [-1241.207] * (-1242.881) [-1242.125] (-1243.610) (-1241.963) -- 0:00:51 213500 -- (-1243.013) (-1241.133) [-1241.025] (-1242.835) * (-1242.979) (-1244.548) [-1243.234] (-1244.159) -- 0:00:51 214000 -- (-1242.111) (-1241.393) (-1241.019) [-1240.913] * (-1244.896) [-1245.320] (-1243.081) (-1241.385) -- 0:00:51 214500 -- (-1241.860) (-1241.409) (-1245.413) [-1240.883] * (-1242.967) (-1243.106) (-1245.402) [-1242.287] -- 0:00:51 215000 -- [-1243.168] (-1242.043) (-1247.774) (-1240.638) * [-1241.923] (-1245.731) (-1246.231) (-1241.181) -- 0:00:51 Average standard deviation of split frequencies: 0.023037 215500 -- (-1246.401) (-1242.812) [-1242.654] (-1240.621) * (-1242.011) (-1243.039) (-1249.329) [-1240.762] -- 0:00:50 216000 -- (-1241.674) [-1241.707] (-1243.607) (-1241.646) * (-1241.677) [-1242.738] (-1245.617) (-1240.762) -- 0:00:50 216500 -- (-1244.551) [-1242.749] (-1241.559) (-1243.033) * [-1243.324] (-1242.397) (-1244.219) (-1241.348) -- 0:00:50 217000 -- (-1247.084) [-1246.442] (-1243.502) (-1241.936) * (-1243.717) [-1243.280] (-1242.246) (-1242.004) -- 0:00:50 217500 -- (-1246.237) (-1242.642) [-1242.422] (-1242.544) * (-1240.985) [-1243.141] (-1242.271) (-1241.395) -- 0:00:50 218000 -- (-1242.050) [-1240.827] (-1247.861) (-1242.040) * (-1241.339) [-1243.169] (-1242.105) (-1242.111) -- 0:00:53 218500 -- (-1242.049) (-1241.276) (-1240.323) [-1243.382] * (-1241.661) (-1242.912) (-1245.924) [-1242.239] -- 0:00:53 219000 -- (-1241.808) [-1243.378] (-1242.352) (-1243.634) * (-1242.229) (-1242.428) (-1246.516) [-1242.967] -- 0:00:53 219500 -- (-1243.071) [-1240.856] (-1242.289) (-1242.784) * [-1243.682] (-1244.858) (-1243.365) (-1240.757) -- 0:00:53 220000 -- (-1245.910) (-1241.968) [-1241.659] (-1242.172) * (-1244.469) (-1242.552) (-1244.093) [-1241.530] -- 0:00:53 Average standard deviation of split frequencies: 0.023625 220500 -- (-1245.478) (-1246.189) (-1243.647) [-1244.136] * (-1244.279) (-1243.219) (-1245.649) [-1244.283] -- 0:00:53 221000 -- (-1247.450) [-1247.848] (-1243.083) (-1242.268) * (-1243.708) [-1241.807] (-1247.405) (-1242.900) -- 0:00:52 221500 -- (-1243.336) (-1246.049) [-1241.447] (-1242.621) * [-1241.386] (-1243.970) (-1247.025) (-1243.826) -- 0:00:52 222000 -- [-1241.070] (-1244.277) (-1243.468) (-1241.685) * [-1240.978] (-1245.635) (-1240.974) (-1242.592) -- 0:00:52 222500 -- (-1244.133) (-1245.641) [-1244.427] (-1241.299) * (-1242.583) (-1249.207) [-1241.447] (-1242.902) -- 0:00:52 223000 -- (-1241.441) (-1245.349) (-1240.577) [-1243.461] * (-1240.726) (-1244.530) [-1241.434] (-1246.740) -- 0:00:52 223500 -- (-1242.970) (-1243.275) [-1241.448] (-1243.207) * (-1242.557) (-1243.818) (-1245.024) [-1246.039] -- 0:00:52 224000 -- (-1243.649) (-1243.802) [-1241.861] (-1242.706) * (-1240.831) (-1244.674) [-1244.433] (-1243.370) -- 0:00:51 224500 -- (-1245.594) (-1243.328) [-1242.242] (-1241.669) * (-1241.833) (-1243.681) (-1244.997) [-1244.430] -- 0:00:51 225000 -- [-1245.863] (-1243.288) (-1240.783) (-1243.256) * (-1241.264) (-1246.569) (-1244.594) [-1243.555] -- 0:00:51 Average standard deviation of split frequencies: 0.023292 225500 -- (-1249.791) (-1243.006) (-1241.179) [-1243.734] * (-1246.444) (-1244.810) (-1243.682) [-1245.110] -- 0:00:51 226000 -- [-1249.545] (-1243.241) (-1241.023) (-1242.556) * (-1244.036) (-1249.173) [-1241.133] (-1247.674) -- 0:00:51 226500 -- (-1244.291) [-1242.989] (-1240.862) (-1242.457) * (-1243.625) [-1245.694] (-1241.985) (-1246.982) -- 0:00:51 227000 -- (-1244.804) [-1243.000] (-1241.806) (-1244.067) * (-1242.455) (-1244.010) (-1243.684) [-1242.861] -- 0:00:51 227500 -- [-1242.642] (-1249.872) (-1241.571) (-1243.755) * (-1242.750) [-1243.181] (-1245.173) (-1246.821) -- 0:00:50 228000 -- [-1245.914] (-1246.605) (-1242.122) (-1242.798) * (-1242.444) [-1243.011] (-1243.005) (-1243.790) -- 0:00:50 228500 -- (-1243.319) (-1241.853) [-1240.824] (-1242.866) * (-1242.913) (-1243.912) (-1244.473) [-1243.673] -- 0:00:50 229000 -- (-1244.651) (-1242.667) (-1250.262) [-1242.142] * [-1242.533] (-1241.095) (-1246.193) (-1245.559) -- 0:00:50 229500 -- (-1244.346) [-1243.417] (-1241.353) (-1241.463) * (-1240.553) (-1242.271) [-1241.632] (-1246.911) -- 0:00:50 230000 -- (-1243.026) [-1245.261] (-1241.351) (-1241.352) * (-1243.414) (-1242.129) (-1242.439) [-1240.684] -- 0:00:50 Average standard deviation of split frequencies: 0.024070 230500 -- (-1241.618) (-1243.400) [-1241.411] (-1242.369) * [-1243.399] (-1244.152) (-1242.786) (-1244.353) -- 0:00:50 231000 -- (-1243.062) [-1241.442] (-1245.492) (-1242.854) * (-1241.229) (-1242.260) (-1246.045) [-1243.575] -- 0:00:49 231500 -- (-1244.335) (-1244.213) (-1241.242) [-1247.419] * (-1243.292) (-1241.897) [-1241.007] (-1242.051) -- 0:00:49 232000 -- (-1242.985) (-1242.722) (-1241.331) [-1241.392] * (-1242.640) [-1242.783] (-1244.475) (-1244.036) -- 0:00:49 232500 -- (-1243.653) (-1242.617) (-1242.960) [-1245.774] * (-1241.542) [-1241.167] (-1243.786) (-1243.599) -- 0:00:49 233000 -- (-1243.809) (-1245.551) [-1243.229] (-1243.168) * (-1241.604) [-1241.885] (-1242.865) (-1241.674) -- 0:00:49 233500 -- [-1242.173] (-1243.156) (-1243.057) (-1242.884) * (-1242.473) (-1241.540) (-1242.504) [-1246.444] -- 0:00:49 234000 -- (-1243.632) (-1244.101) [-1243.843] (-1241.330) * (-1242.046) (-1242.741) [-1242.194] (-1245.243) -- 0:00:52 234500 -- (-1241.200) (-1243.384) (-1242.591) [-1244.748] * [-1243.788] (-1243.962) (-1242.952) (-1242.564) -- 0:00:52 235000 -- [-1242.049] (-1243.583) (-1241.208) (-1245.122) * (-1244.454) [-1244.786] (-1242.308) (-1242.783) -- 0:00:52 Average standard deviation of split frequencies: 0.023970 235500 -- (-1243.907) (-1243.732) [-1244.089] (-1244.089) * [-1242.728] (-1243.362) (-1241.324) (-1244.680) -- 0:00:51 236000 -- [-1241.391] (-1241.925) (-1240.706) (-1245.840) * (-1243.284) (-1242.408) [-1243.514] (-1241.944) -- 0:00:51 236500 -- (-1241.528) (-1244.919) [-1241.819] (-1242.826) * (-1242.475) (-1242.614) [-1243.282] (-1242.916) -- 0:00:51 237000 -- (-1241.521) [-1242.396] (-1241.963) (-1242.375) * (-1245.574) [-1240.738] (-1242.605) (-1243.273) -- 0:00:51 237500 -- [-1242.631] (-1243.653) (-1241.801) (-1242.768) * (-1244.363) [-1242.392] (-1245.160) (-1241.897) -- 0:00:51 238000 -- (-1242.094) [-1241.612] (-1245.256) (-1242.129) * (-1244.319) (-1241.228) [-1241.627] (-1241.051) -- 0:00:51 238500 -- (-1242.269) (-1242.340) (-1245.252) [-1243.523] * (-1243.759) [-1243.698] (-1240.617) (-1241.249) -- 0:00:51 239000 -- (-1243.630) (-1248.969) (-1241.481) [-1243.198] * (-1243.522) (-1242.698) [-1247.850] (-1242.214) -- 0:00:50 239500 -- (-1243.313) (-1244.148) (-1241.463) [-1242.104] * (-1241.210) [-1240.659] (-1250.430) (-1242.449) -- 0:00:50 240000 -- (-1246.172) (-1241.951) (-1241.627) [-1241.655] * [-1242.069] (-1241.220) (-1245.045) (-1245.732) -- 0:00:50 Average standard deviation of split frequencies: 0.023159 240500 -- [-1249.270] (-1241.214) (-1241.474) (-1243.266) * [-1242.478] (-1241.519) (-1245.027) (-1245.239) -- 0:00:50 241000 -- (-1247.999) (-1241.721) (-1244.146) [-1242.333] * (-1246.774) [-1243.477] (-1245.035) (-1244.358) -- 0:00:50 241500 -- (-1245.829) (-1240.926) [-1243.706] (-1243.703) * (-1247.656) [-1241.377] (-1242.140) (-1242.984) -- 0:00:50 242000 -- (-1241.746) (-1245.320) (-1243.581) [-1244.464] * [-1243.279] (-1241.341) (-1241.566) (-1241.898) -- 0:00:50 242500 -- [-1242.108] (-1242.974) (-1240.908) (-1242.935) * [-1245.187] (-1242.999) (-1240.909) (-1241.587) -- 0:00:49 243000 -- [-1241.579] (-1240.889) (-1244.468) (-1240.377) * (-1247.503) (-1246.150) (-1240.562) [-1242.860] -- 0:00:49 243500 -- (-1241.576) (-1242.466) (-1242.613) [-1243.174] * [-1243.183] (-1244.125) (-1241.558) (-1242.100) -- 0:00:49 244000 -- (-1243.027) (-1245.596) (-1244.870) [-1243.530] * (-1241.998) (-1241.484) (-1240.788) [-1242.832] -- 0:00:49 244500 -- (-1241.323) (-1243.057) (-1240.989) [-1242.376] * (-1243.430) [-1241.232] (-1244.347) (-1242.614) -- 0:00:49 245000 -- (-1242.041) [-1244.902] (-1241.331) (-1244.382) * (-1241.092) (-1240.796) (-1244.681) [-1245.778] -- 0:00:49 Average standard deviation of split frequencies: 0.022357 245500 -- (-1243.616) [-1244.892] (-1242.622) (-1243.688) * (-1241.537) (-1241.907) [-1243.981] (-1248.880) -- 0:00:49 246000 -- (-1246.912) (-1241.607) (-1242.364) [-1243.175] * (-1243.329) (-1243.082) [-1242.454] (-1245.412) -- 0:00:49 246500 -- [-1244.839] (-1240.708) (-1241.734) (-1241.369) * (-1243.732) [-1242.643] (-1241.789) (-1243.392) -- 0:00:48 247000 -- [-1244.333] (-1241.916) (-1245.901) (-1241.864) * (-1243.898) [-1244.827] (-1241.369) (-1242.350) -- 0:00:48 247500 -- (-1242.409) [-1241.837] (-1245.427) (-1243.230) * (-1240.537) (-1243.025) [-1245.340] (-1242.305) -- 0:00:48 248000 -- (-1242.917) (-1242.294) (-1245.472) [-1242.101] * (-1244.339) (-1243.023) [-1242.350] (-1243.641) -- 0:00:48 248500 -- (-1241.063) (-1241.530) (-1244.583) [-1241.536] * (-1243.569) (-1241.730) [-1242.325] (-1242.953) -- 0:00:48 249000 -- (-1242.294) (-1241.455) [-1242.835] (-1242.585) * (-1247.483) (-1242.112) (-1241.844) [-1242.410] -- 0:00:48 249500 -- (-1241.083) [-1243.194] (-1243.445) (-1241.991) * (-1245.721) [-1241.384] (-1241.661) (-1243.322) -- 0:00:48 250000 -- (-1244.643) [-1246.409] (-1241.590) (-1241.996) * (-1245.486) (-1241.512) (-1240.836) [-1243.178] -- 0:00:51 Average standard deviation of split frequencies: 0.022149 250500 -- (-1241.792) (-1243.278) [-1243.112] (-1242.079) * [-1243.550] (-1243.387) (-1243.410) (-1248.608) -- 0:00:50 251000 -- [-1241.876] (-1243.202) (-1243.729) (-1240.580) * (-1241.999) [-1244.607] (-1242.225) (-1248.713) -- 0:00:50 251500 -- [-1241.543] (-1242.836) (-1240.976) (-1245.470) * [-1245.257] (-1243.093) (-1241.987) (-1243.244) -- 0:00:50 252000 -- (-1241.168) (-1242.078) [-1242.553] (-1241.923) * (-1242.048) (-1242.882) (-1245.180) [-1244.820] -- 0:00:50 252500 -- [-1241.764] (-1245.293) (-1243.712) (-1241.830) * [-1243.611] (-1242.123) (-1242.463) (-1242.294) -- 0:00:50 253000 -- (-1240.837) [-1244.806] (-1242.295) (-1242.505) * (-1244.694) (-1243.605) (-1241.148) [-1241.186] -- 0:00:50 253500 -- (-1241.252) (-1243.420) [-1247.704] (-1242.315) * (-1243.647) [-1241.772] (-1241.204) (-1242.457) -- 0:00:50 254000 -- (-1242.974) [-1241.496] (-1249.352) (-1245.640) * (-1244.591) [-1245.286] (-1241.065) (-1240.653) -- 0:00:49 254500 -- (-1243.016) (-1240.466) (-1243.552) [-1247.042] * (-1246.054) (-1242.330) [-1241.425] (-1240.619) -- 0:00:49 255000 -- (-1240.523) [-1240.554] (-1241.861) (-1242.177) * [-1251.443] (-1241.984) (-1242.325) (-1240.464) -- 0:00:49 Average standard deviation of split frequencies: 0.021688 255500 -- (-1243.262) (-1242.761) [-1241.464] (-1241.254) * [-1243.455] (-1243.148) (-1242.548) (-1240.592) -- 0:00:49 256000 -- [-1241.051] (-1243.716) (-1246.634) (-1252.010) * (-1242.061) (-1243.390) (-1243.220) [-1240.964] -- 0:00:49 256500 -- (-1241.665) (-1242.901) [-1242.782] (-1245.644) * [-1242.304] (-1251.441) (-1243.133) (-1241.654) -- 0:00:49 257000 -- [-1241.595] (-1244.622) (-1242.995) (-1246.870) * [-1242.765] (-1247.402) (-1247.168) (-1241.586) -- 0:00:49 257500 -- [-1241.056] (-1241.887) (-1241.689) (-1248.533) * [-1241.901] (-1242.650) (-1243.904) (-1241.054) -- 0:00:49 258000 -- [-1240.707] (-1246.214) (-1240.889) (-1246.728) * (-1242.911) (-1243.072) [-1241.054] (-1240.677) -- 0:00:48 258500 -- [-1242.621] (-1246.552) (-1242.686) (-1244.339) * (-1243.558) (-1242.259) [-1240.893] (-1240.814) -- 0:00:48 259000 -- (-1242.787) (-1242.720) [-1240.805] (-1246.883) * (-1243.730) (-1247.825) (-1242.984) [-1241.389] -- 0:00:48 259500 -- (-1244.903) (-1242.227) [-1241.560] (-1245.691) * (-1247.043) (-1246.084) (-1243.001) [-1241.537] -- 0:00:48 260000 -- (-1242.584) (-1247.120) [-1240.983] (-1245.214) * [-1241.104] (-1242.225) (-1243.480) (-1241.963) -- 0:00:48 Average standard deviation of split frequencies: 0.021892 260500 -- (-1244.532) [-1243.776] (-1242.951) (-1242.203) * [-1243.328] (-1244.792) (-1244.480) (-1241.069) -- 0:00:48 261000 -- (-1244.274) [-1241.297] (-1244.291) (-1242.374) * (-1244.871) [-1244.743] (-1243.757) (-1240.467) -- 0:00:48 261500 -- [-1240.973] (-1241.297) (-1241.852) (-1242.265) * (-1243.032) (-1243.297) [-1243.948] (-1240.967) -- 0:00:48 262000 -- [-1240.931] (-1241.156) (-1245.920) (-1241.113) * (-1242.586) (-1241.044) [-1241.911] (-1241.882) -- 0:00:47 262500 -- (-1241.834) (-1241.009) (-1240.920) [-1241.387] * (-1242.361) [-1240.585] (-1250.072) (-1241.157) -- 0:00:47 263000 -- [-1242.176] (-1240.740) (-1241.806) (-1248.630) * (-1242.023) [-1243.110] (-1248.505) (-1244.395) -- 0:00:47 263500 -- (-1241.742) (-1243.788) [-1241.985] (-1246.217) * (-1245.989) [-1243.121] (-1241.749) (-1243.679) -- 0:00:47 264000 -- (-1242.504) [-1241.043] (-1244.704) (-1247.850) * (-1241.851) (-1243.659) [-1242.644] (-1241.437) -- 0:00:47 264500 -- (-1242.598) [-1241.765] (-1244.313) (-1246.516) * (-1244.803) (-1244.364) [-1243.677] (-1243.186) -- 0:00:50 265000 -- (-1240.289) [-1242.155] (-1242.564) (-1243.355) * (-1245.083) [-1242.872] (-1245.774) (-1240.473) -- 0:00:49 Average standard deviation of split frequencies: 0.021919 265500 -- (-1241.970) (-1242.030) (-1243.024) [-1240.403] * (-1243.457) (-1243.332) [-1242.149] (-1241.892) -- 0:00:49 266000 -- (-1241.359) (-1242.825) [-1242.280] (-1244.314) * (-1241.760) (-1243.207) (-1245.168) [-1243.701] -- 0:00:49 266500 -- (-1242.491) (-1243.761) [-1241.187] (-1244.681) * (-1240.994) (-1243.712) (-1244.058) [-1241.807] -- 0:00:49 267000 -- (-1244.083) (-1243.467) (-1242.721) [-1243.990] * (-1243.299) [-1244.761] (-1242.584) (-1242.889) -- 0:00:49 267500 -- [-1243.184] (-1243.887) (-1243.650) (-1241.805) * (-1242.766) (-1241.061) [-1241.212] (-1246.061) -- 0:00:49 268000 -- (-1243.118) [-1243.169] (-1241.191) (-1243.661) * (-1243.997) (-1244.183) [-1243.572] (-1247.753) -- 0:00:49 268500 -- (-1242.802) (-1243.842) [-1242.524] (-1244.805) * [-1243.832] (-1244.623) (-1242.652) (-1242.647) -- 0:00:49 269000 -- (-1242.515) [-1240.857] (-1242.226) (-1241.526) * (-1245.758) (-1242.179) [-1249.137] (-1243.702) -- 0:00:48 269500 -- (-1242.445) (-1241.309) [-1243.630] (-1244.650) * (-1246.978) (-1242.208) [-1244.408] (-1244.008) -- 0:00:48 270000 -- (-1242.149) (-1241.810) [-1245.012] (-1241.059) * [-1245.755] (-1242.862) (-1241.379) (-1241.238) -- 0:00:48 Average standard deviation of split frequencies: 0.021908 270500 -- (-1242.982) [-1245.615] (-1244.620) (-1244.916) * (-1245.659) (-1243.311) (-1241.617) [-1242.392] -- 0:00:48 271000 -- (-1240.781) (-1243.141) (-1242.716) [-1241.374] * (-1244.772) [-1245.576] (-1241.741) (-1246.265) -- 0:00:48 271500 -- (-1240.928) (-1243.452) [-1242.766] (-1242.513) * (-1242.022) (-1245.605) (-1241.104) [-1242.650] -- 0:00:48 272000 -- (-1241.134) (-1244.856) [-1241.825] (-1243.515) * (-1241.541) [-1242.377] (-1243.051) (-1244.252) -- 0:00:48 272500 -- (-1242.004) (-1242.186) (-1242.532) [-1244.185] * (-1241.929) (-1242.779) [-1241.033] (-1242.688) -- 0:00:48 273000 -- [-1241.319] (-1242.451) (-1242.519) (-1240.508) * (-1249.628) (-1243.416) [-1241.447] (-1243.949) -- 0:00:47 273500 -- (-1241.695) (-1242.232) (-1241.273) [-1240.625] * (-1243.302) (-1242.186) (-1241.697) [-1244.187] -- 0:00:47 274000 -- (-1247.552) (-1242.699) (-1240.825) [-1241.917] * (-1242.948) [-1242.619] (-1248.412) (-1242.720) -- 0:00:47 274500 -- [-1242.555] (-1242.700) (-1241.851) (-1242.545) * (-1242.442) (-1240.767) [-1244.717] (-1242.881) -- 0:00:47 275000 -- (-1242.223) [-1243.069] (-1241.740) (-1240.753) * [-1242.223] (-1241.829) (-1244.951) (-1242.409) -- 0:00:47 Average standard deviation of split frequencies: 0.021540 275500 -- [-1244.128] (-1241.671) (-1241.174) (-1241.385) * [-1243.214] (-1241.467) (-1245.056) (-1242.922) -- 0:00:47 276000 -- (-1243.000) [-1247.907] (-1244.285) (-1241.743) * [-1243.870] (-1244.164) (-1242.049) (-1242.153) -- 0:00:47 276500 -- (-1242.703) (-1248.136) [-1249.346] (-1241.789) * [-1246.196] (-1241.359) (-1244.471) (-1243.794) -- 0:00:47 277000 -- [-1241.036] (-1245.282) (-1243.354) (-1241.654) * (-1241.080) [-1242.291] (-1242.016) (-1242.471) -- 0:00:46 277500 -- (-1242.660) (-1246.207) [-1243.559] (-1242.158) * [-1240.560] (-1243.607) (-1245.071) (-1248.628) -- 0:00:46 278000 -- (-1242.862) (-1244.096) (-1242.897) [-1241.802] * (-1242.682) (-1243.151) [-1244.916] (-1245.026) -- 0:00:46 278500 -- (-1244.176) [-1245.993] (-1243.911) (-1243.354) * [-1241.455] (-1241.991) (-1245.738) (-1242.448) -- 0:00:46 279000 -- (-1243.502) (-1244.958) (-1243.265) [-1242.144] * (-1244.023) (-1240.873) [-1243.745] (-1245.916) -- 0:00:46 279500 -- (-1241.579) [-1241.133] (-1240.876) (-1244.590) * (-1243.013) (-1240.486) [-1241.640] (-1243.492) -- 0:00:46 280000 -- (-1242.693) (-1241.339) (-1241.475) [-1244.918] * [-1242.195] (-1243.907) (-1242.267) (-1244.438) -- 0:00:46 Average standard deviation of split frequencies: 0.020342 280500 -- (-1242.752) (-1240.795) (-1241.413) [-1241.650] * (-1242.573) [-1243.148] (-1243.637) (-1241.247) -- 0:00:48 281000 -- (-1241.943) (-1241.415) (-1240.713) [-1244.237] * [-1242.624] (-1242.752) (-1242.860) (-1243.665) -- 0:00:48 281500 -- (-1242.234) (-1242.356) [-1242.923] (-1245.444) * (-1241.313) (-1242.294) (-1244.129) [-1244.253] -- 0:00:48 282000 -- (-1244.037) (-1241.595) (-1242.054) [-1242.129] * (-1243.364) (-1243.596) (-1245.256) [-1242.161] -- 0:00:48 282500 -- (-1244.377) [-1241.444] (-1242.659) (-1242.498) * (-1243.893) (-1241.806) (-1241.207) [-1241.781] -- 0:00:48 283000 -- (-1244.730) (-1241.469) [-1242.389] (-1242.641) * [-1249.356] (-1243.039) (-1241.730) (-1242.515) -- 0:00:48 283500 -- (-1242.416) (-1244.868) [-1242.738] (-1242.322) * (-1245.279) (-1245.253) [-1241.922] (-1247.076) -- 0:00:48 284000 -- (-1240.913) (-1243.215) [-1245.344] (-1244.207) * (-1245.000) (-1242.904) [-1240.709] (-1243.216) -- 0:00:47 284500 -- [-1242.107] (-1241.200) (-1246.701) (-1258.616) * (-1243.360) [-1241.948] (-1241.799) (-1243.062) -- 0:00:47 285000 -- [-1245.545] (-1242.090) (-1246.204) (-1250.159) * (-1243.260) [-1245.751] (-1241.637) (-1244.041) -- 0:00:47 Average standard deviation of split frequencies: 0.020329 285500 -- (-1247.191) [-1242.778] (-1247.977) (-1252.366) * (-1242.931) [-1244.041] (-1243.309) (-1244.621) -- 0:00:47 286000 -- [-1244.206] (-1245.327) (-1245.378) (-1246.197) * [-1242.447] (-1241.017) (-1244.151) (-1249.096) -- 0:00:47 286500 -- (-1242.115) [-1244.885] (-1243.681) (-1244.426) * (-1242.425) [-1241.320] (-1243.087) (-1244.536) -- 0:00:47 287000 -- (-1242.361) [-1246.736] (-1241.153) (-1243.414) * [-1242.235] (-1240.941) (-1242.601) (-1246.909) -- 0:00:47 287500 -- [-1242.131] (-1244.813) (-1240.616) (-1244.895) * (-1245.185) (-1247.119) (-1240.641) [-1244.821] -- 0:00:47 288000 -- (-1241.839) (-1241.101) (-1240.864) [-1243.371] * (-1245.582) (-1244.171) (-1249.713) [-1245.397] -- 0:00:46 288500 -- (-1243.635) (-1245.966) (-1243.788) [-1243.108] * (-1242.174) (-1242.822) (-1245.657) [-1244.315] -- 0:00:46 289000 -- (-1243.799) (-1251.789) [-1244.235] (-1241.546) * (-1241.347) (-1241.285) [-1245.304] (-1245.337) -- 0:00:46 289500 -- [-1241.982] (-1242.881) (-1242.029) (-1250.791) * [-1242.564] (-1242.126) (-1245.755) (-1244.212) -- 0:00:46 290000 -- (-1245.416) [-1242.522] (-1241.699) (-1244.278) * [-1242.294] (-1243.102) (-1242.652) (-1244.315) -- 0:00:46 Average standard deviation of split frequencies: 0.019372 290500 -- (-1243.551) (-1246.151) (-1241.240) [-1242.544] * (-1241.160) (-1241.890) [-1242.273] (-1242.586) -- 0:00:46 291000 -- (-1242.089) [-1242.934] (-1241.645) (-1242.956) * [-1241.079] (-1242.585) (-1242.209) (-1242.614) -- 0:00:46 291500 -- [-1242.451] (-1244.650) (-1242.908) (-1242.357) * [-1241.530] (-1241.940) (-1241.322) (-1241.580) -- 0:00:46 292000 -- (-1241.146) (-1245.841) [-1245.829] (-1242.532) * (-1241.479) (-1241.782) (-1241.107) [-1241.271] -- 0:00:46 292500 -- (-1243.300) [-1244.493] (-1247.109) (-1243.836) * (-1241.347) [-1241.693] (-1242.823) (-1243.733) -- 0:00:45 293000 -- [-1244.258] (-1245.878) (-1245.561) (-1243.762) * (-1241.646) [-1243.290] (-1241.176) (-1241.166) -- 0:00:45 293500 -- [-1241.515] (-1245.222) (-1248.045) (-1241.725) * (-1241.230) [-1243.241] (-1241.195) (-1244.911) -- 0:00:45 294000 -- [-1243.629] (-1243.276) (-1242.557) (-1241.783) * [-1242.023] (-1242.471) (-1243.028) (-1242.755) -- 0:00:45 294500 -- (-1242.068) [-1243.297] (-1243.685) (-1241.542) * [-1241.580] (-1241.248) (-1247.815) (-1246.500) -- 0:00:45 295000 -- (-1241.637) (-1245.236) (-1240.679) [-1241.428] * [-1241.580] (-1242.904) (-1243.506) (-1246.833) -- 0:00:45 Average standard deviation of split frequencies: 0.019996 295500 -- [-1242.784] (-1247.008) (-1241.436) (-1240.973) * (-1242.682) (-1242.174) [-1243.237] (-1242.758) -- 0:00:45 296000 -- (-1243.246) (-1247.224) [-1242.284] (-1243.894) * [-1241.168] (-1243.001) (-1243.740) (-1245.865) -- 0:00:45 296500 -- (-1243.602) (-1251.757) (-1241.445) [-1242.018] * (-1242.603) (-1242.534) [-1244.052] (-1242.455) -- 0:00:45 297000 -- (-1241.390) (-1244.675) [-1241.201] (-1243.173) * (-1241.752) (-1242.281) [-1241.971] (-1242.366) -- 0:00:47 297500 -- (-1240.984) [-1245.718] (-1243.297) (-1243.320) * (-1243.741) [-1242.073] (-1241.595) (-1245.201) -- 0:00:47 298000 -- [-1240.860] (-1240.610) (-1241.589) (-1241.075) * (-1242.931) [-1242.038] (-1242.828) (-1244.219) -- 0:00:47 298500 -- (-1243.103) (-1240.557) (-1241.977) [-1240.730] * (-1241.395) (-1242.489) (-1243.692) [-1245.359] -- 0:00:47 299000 -- [-1244.445] (-1240.738) (-1244.725) (-1240.731) * (-1240.271) [-1241.617] (-1241.696) (-1243.587) -- 0:00:46 299500 -- (-1242.830) (-1248.451) [-1242.059] (-1240.731) * [-1243.036] (-1245.185) (-1242.560) (-1241.505) -- 0:00:46 300000 -- [-1241.530] (-1246.313) (-1242.982) (-1243.062) * (-1240.796) (-1242.116) [-1242.047] (-1244.849) -- 0:00:46 Average standard deviation of split frequencies: 0.019163 300500 -- (-1241.152) (-1246.367) (-1243.890) [-1242.675] * (-1241.750) [-1241.202] (-1241.999) (-1246.489) -- 0:00:46 301000 -- (-1243.404) [-1243.081] (-1242.137) (-1248.354) * [-1241.653] (-1241.004) (-1242.019) (-1241.029) -- 0:00:46 301500 -- (-1241.900) (-1241.523) [-1241.072] (-1246.493) * (-1242.133) (-1244.535) [-1241.660] (-1245.054) -- 0:00:46 302000 -- (-1244.753) (-1244.122) (-1244.525) [-1243.386] * (-1246.351) [-1241.935] (-1241.666) (-1241.022) -- 0:00:46 302500 -- (-1243.518) [-1243.867] (-1249.832) (-1241.833) * [-1243.900] (-1241.435) (-1243.448) (-1242.867) -- 0:00:46 303000 -- (-1242.968) [-1241.612] (-1250.609) (-1243.309) * (-1245.751) [-1242.559] (-1243.399) (-1243.448) -- 0:00:46 303500 -- (-1241.773) [-1241.320] (-1246.505) (-1243.460) * (-1243.171) (-1244.229) [-1241.556] (-1243.741) -- 0:00:45 304000 -- (-1242.112) [-1241.965] (-1241.812) (-1241.744) * (-1241.558) (-1241.073) [-1241.807] (-1243.581) -- 0:00:45 304500 -- (-1241.431) [-1241.442] (-1241.695) (-1240.770) * (-1243.793) (-1241.538) [-1241.488] (-1240.696) -- 0:00:45 305000 -- (-1243.828) (-1241.425) (-1243.935) [-1240.921] * (-1242.750) (-1241.796) (-1242.871) [-1241.002] -- 0:00:45 Average standard deviation of split frequencies: 0.019000 305500 -- (-1243.916) [-1241.443] (-1246.035) (-1241.963) * (-1245.480) (-1245.815) [-1241.140] (-1241.712) -- 0:00:45 306000 -- (-1245.083) [-1242.698] (-1242.802) (-1242.911) * [-1242.032] (-1243.489) (-1242.217) (-1240.766) -- 0:00:45 306500 -- (-1243.962) [-1241.531] (-1241.587) (-1245.124) * (-1246.519) (-1242.611) (-1242.621) [-1241.034] -- 0:00:45 307000 -- (-1249.005) [-1244.578] (-1242.058) (-1244.425) * (-1243.908) [-1241.794] (-1241.794) (-1240.674) -- 0:00:45 307500 -- (-1241.664) (-1243.165) [-1244.216] (-1246.607) * (-1242.803) (-1241.576) (-1242.700) [-1243.252] -- 0:00:45 308000 -- [-1240.655] (-1243.782) (-1243.105) (-1245.493) * [-1243.559] (-1240.919) (-1242.819) (-1245.597) -- 0:00:44 308500 -- (-1242.503) (-1243.452) [-1241.645] (-1242.490) * (-1244.674) (-1242.806) [-1242.420] (-1244.337) -- 0:00:44 309000 -- (-1243.456) (-1245.043) [-1241.171] (-1247.540) * [-1242.632] (-1242.573) (-1243.194) (-1243.063) -- 0:00:44 309500 -- (-1243.668) (-1245.471) (-1244.311) [-1242.151] * (-1243.116) (-1242.809) (-1242.095) [-1242.886] -- 0:00:44 310000 -- [-1243.720] (-1241.481) (-1241.904) (-1241.610) * (-1240.592) (-1241.478) [-1243.060] (-1242.915) -- 0:00:44 Average standard deviation of split frequencies: 0.019191 310500 -- (-1244.421) [-1241.207] (-1248.019) (-1246.428) * (-1242.106) (-1244.399) (-1241.662) [-1246.626] -- 0:00:44 311000 -- (-1242.016) (-1241.461) [-1242.764] (-1241.006) * (-1243.226) [-1243.688] (-1243.564) (-1245.391) -- 0:00:44 311500 -- (-1241.734) (-1241.404) [-1242.217] (-1241.007) * (-1242.750) (-1241.223) [-1245.600] (-1243.878) -- 0:00:44 312000 -- (-1242.463) [-1240.758] (-1242.903) (-1245.487) * (-1243.728) [-1240.793] (-1241.714) (-1244.233) -- 0:00:44 312500 -- (-1244.796) (-1241.542) [-1242.111] (-1243.821) * (-1242.732) (-1242.347) (-1245.983) [-1241.447] -- 0:00:44 313000 -- (-1242.844) [-1241.535] (-1243.237) (-1242.697) * [-1240.957] (-1241.680) (-1242.487) (-1246.011) -- 0:00:46 313500 -- (-1244.796) [-1242.975] (-1246.323) (-1245.594) * [-1241.743] (-1242.487) (-1243.051) (-1242.119) -- 0:00:45 314000 -- (-1247.597) [-1241.984] (-1248.536) (-1245.045) * (-1247.287) [-1243.366] (-1241.203) (-1241.258) -- 0:00:45 314500 -- (-1242.115) [-1241.834] (-1242.581) (-1244.473) * (-1243.107) (-1241.407) (-1241.063) [-1241.888] -- 0:00:45 315000 -- (-1242.033) (-1245.986) [-1243.014] (-1242.647) * (-1242.376) (-1241.026) [-1241.031] (-1244.530) -- 0:00:45 Average standard deviation of split frequencies: 0.017238 315500 -- [-1242.033] (-1242.430) (-1243.582) (-1243.381) * (-1242.456) (-1242.886) [-1244.257] (-1242.184) -- 0:00:45 316000 -- [-1242.460] (-1243.383) (-1242.950) (-1244.478) * (-1243.540) (-1244.083) [-1243.192] (-1241.651) -- 0:00:45 316500 -- (-1244.606) (-1243.859) (-1240.583) [-1241.898] * (-1246.322) [-1242.278] (-1241.951) (-1242.248) -- 0:00:45 317000 -- (-1242.142) (-1244.178) (-1240.608) [-1241.932] * (-1243.312) [-1241.992] (-1240.548) (-1241.712) -- 0:00:45 317500 -- [-1246.408] (-1241.548) (-1240.547) (-1242.871) * (-1242.283) [-1242.129] (-1242.470) (-1242.736) -- 0:00:45 318000 -- (-1242.080) [-1241.840] (-1241.166) (-1245.294) * [-1241.801] (-1242.410) (-1243.110) (-1246.485) -- 0:00:45 318500 -- (-1244.659) (-1242.044) (-1243.916) [-1246.313] * (-1241.464) [-1240.621] (-1243.508) (-1245.000) -- 0:00:44 319000 -- (-1246.651) [-1241.289] (-1242.566) (-1241.446) * [-1241.840] (-1242.907) (-1241.280) (-1242.996) -- 0:00:44 319500 -- (-1243.065) [-1241.629] (-1241.874) (-1242.409) * (-1241.687) [-1241.671] (-1241.279) (-1242.979) -- 0:00:44 320000 -- [-1242.424] (-1243.380) (-1243.056) (-1245.282) * (-1244.611) (-1242.640) [-1242.292] (-1247.264) -- 0:00:44 Average standard deviation of split frequencies: 0.017381 320500 -- (-1241.451) [-1241.626] (-1243.184) (-1243.883) * (-1243.378) [-1242.767] (-1241.656) (-1242.909) -- 0:00:44 321000 -- (-1241.487) [-1240.858] (-1243.628) (-1242.974) * [-1244.072] (-1242.625) (-1241.811) (-1244.268) -- 0:00:44 321500 -- (-1246.472) [-1240.526] (-1242.859) (-1245.427) * (-1244.813) (-1240.970) (-1241.801) [-1242.136] -- 0:00:44 322000 -- (-1244.240) (-1240.357) (-1240.469) [-1241.354] * [-1240.888] (-1240.969) (-1244.225) (-1243.656) -- 0:00:44 322500 -- (-1241.498) (-1242.643) [-1241.947] (-1248.443) * (-1244.073) (-1241.809) [-1241.742] (-1242.820) -- 0:00:44 323000 -- (-1242.157) (-1241.802) (-1241.459) [-1241.509] * [-1242.485] (-1241.653) (-1242.578) (-1243.054) -- 0:00:44 323500 -- (-1241.591) (-1243.794) [-1241.948] (-1242.089) * (-1242.177) (-1242.751) (-1241.077) [-1244.288] -- 0:00:43 324000 -- [-1241.158] (-1241.678) (-1245.202) (-1241.979) * (-1241.939) [-1240.556] (-1241.644) (-1243.917) -- 0:00:43 324500 -- (-1241.009) [-1242.594] (-1243.300) (-1244.405) * (-1244.831) (-1242.866) (-1242.908) [-1243.493] -- 0:00:43 325000 -- [-1242.731] (-1242.146) (-1243.677) (-1247.523) * [-1240.506] (-1242.148) (-1245.141) (-1243.339) -- 0:00:43 Average standard deviation of split frequencies: 0.017513 325500 -- [-1241.732] (-1240.487) (-1241.343) (-1245.193) * [-1240.494] (-1241.699) (-1243.253) (-1246.272) -- 0:00:43 326000 -- (-1243.208) (-1244.678) (-1245.381) [-1244.121] * [-1241.974] (-1243.032) (-1242.154) (-1246.499) -- 0:00:43 326500 -- (-1242.180) (-1242.160) (-1245.623) [-1245.385] * (-1242.807) (-1241.112) (-1242.152) [-1242.271] -- 0:00:43 327000 -- [-1242.197] (-1245.324) (-1242.359) (-1241.752) * (-1241.833) (-1242.254) [-1241.552] (-1241.641) -- 0:00:43 327500 -- (-1241.079) (-1245.328) (-1243.089) [-1242.131] * (-1242.214) (-1243.306) (-1241.419) [-1242.647] -- 0:00:43 328000 -- (-1240.702) (-1247.261) (-1241.092) [-1243.160] * [-1242.028] (-1243.201) (-1243.529) (-1246.069) -- 0:00:43 328500 -- [-1241.368] (-1245.831) (-1241.354) (-1243.903) * (-1240.976) (-1243.028) [-1245.158] (-1242.610) -- 0:00:42 329000 -- [-1246.481] (-1241.827) (-1243.671) (-1243.969) * (-1243.876) [-1241.776] (-1244.854) (-1242.073) -- 0:00:42 329500 -- (-1241.608) (-1241.535) [-1240.505] (-1246.006) * (-1249.966) (-1245.055) (-1244.645) [-1243.550] -- 0:00:44 330000 -- [-1241.467] (-1240.747) (-1241.068) (-1243.387) * (-1244.231) (-1247.154) [-1240.624] (-1241.310) -- 0:00:44 Average standard deviation of split frequencies: 0.016688 330500 -- (-1241.467) [-1243.665] (-1240.939) (-1241.400) * (-1242.432) [-1249.812] (-1245.499) (-1241.351) -- 0:00:44 331000 -- (-1241.491) (-1240.623) [-1241.450] (-1242.121) * (-1241.957) (-1244.271) (-1246.113) [-1243.184] -- 0:00:44 331500 -- [-1246.918] (-1241.290) (-1241.387) (-1244.241) * (-1242.727) (-1244.977) (-1244.738) [-1242.399] -- 0:00:44 332000 -- (-1240.637) (-1241.202) (-1242.195) [-1243.695] * (-1240.386) [-1245.676] (-1241.624) (-1241.477) -- 0:00:44 332500 -- [-1242.264] (-1242.034) (-1246.236) (-1246.562) * (-1242.956) (-1244.621) [-1241.651] (-1241.106) -- 0:00:44 333000 -- (-1242.358) (-1245.158) (-1249.582) [-1242.585] * (-1246.989) (-1249.823) (-1243.520) [-1242.467] -- 0:00:44 333500 -- (-1242.363) (-1243.788) (-1242.331) [-1243.627] * (-1243.814) (-1245.539) [-1243.160] (-1244.270) -- 0:00:43 334000 -- (-1242.319) (-1244.978) (-1242.684) [-1244.182] * [-1242.150] (-1245.766) (-1243.188) (-1243.038) -- 0:00:43 334500 -- (-1241.356) (-1243.167) [-1241.112] (-1242.813) * (-1244.785) [-1243.039] (-1244.377) (-1243.101) -- 0:00:43 335000 -- (-1242.218) (-1243.088) [-1240.727] (-1242.007) * [-1244.231] (-1245.852) (-1242.298) (-1242.869) -- 0:00:43 Average standard deviation of split frequencies: 0.016176 335500 -- (-1245.613) (-1244.049) [-1240.755] (-1242.301) * [-1242.035] (-1252.220) (-1242.251) (-1241.653) -- 0:00:43 336000 -- [-1243.806] (-1244.150) (-1240.783) (-1242.098) * (-1241.734) (-1243.104) (-1240.332) [-1242.791] -- 0:00:43 336500 -- (-1246.188) [-1242.681] (-1242.197) (-1242.098) * (-1242.226) (-1246.055) (-1242.338) [-1242.662] -- 0:00:43 337000 -- (-1244.082) [-1240.953] (-1245.237) (-1241.094) * [-1243.990] (-1244.365) (-1242.437) (-1243.606) -- 0:00:43 337500 -- (-1243.533) (-1242.035) (-1241.496) [-1242.011] * (-1244.447) (-1241.255) (-1241.483) [-1244.506] -- 0:00:43 338000 -- (-1243.349) (-1242.484) (-1246.871) [-1240.893] * [-1244.346] (-1241.968) (-1240.964) (-1243.965) -- 0:00:43 338500 -- (-1242.151) (-1244.256) (-1241.789) [-1240.586] * (-1241.283) [-1244.044] (-1241.590) (-1242.968) -- 0:00:42 339000 -- (-1244.365) (-1246.913) (-1241.224) [-1241.776] * (-1242.111) (-1241.882) (-1242.329) [-1247.589] -- 0:00:42 339500 -- (-1246.964) [-1240.916] (-1243.339) (-1241.614) * (-1241.899) (-1242.980) (-1243.710) [-1241.948] -- 0:00:42 340000 -- (-1245.900) (-1240.654) [-1240.485] (-1243.131) * (-1241.979) (-1242.628) (-1243.646) [-1243.890] -- 0:00:42 Average standard deviation of split frequencies: 0.015221 340500 -- (-1244.027) [-1243.360] (-1244.722) (-1242.631) * (-1241.817) [-1244.794] (-1242.638) (-1242.305) -- 0:00:42 341000 -- (-1244.494) [-1244.810] (-1244.174) (-1242.375) * (-1243.134) (-1242.513) (-1243.426) [-1241.660] -- 0:00:42 341500 -- (-1242.628) (-1245.486) (-1244.566) [-1241.798] * [-1243.264] (-1242.943) (-1244.882) (-1243.529) -- 0:00:42 342000 -- [-1241.106] (-1242.840) (-1242.503) (-1244.272) * [-1240.570] (-1242.035) (-1241.888) (-1242.404) -- 0:00:42 342500 -- (-1240.851) (-1240.533) [-1244.808] (-1243.238) * (-1241.227) [-1242.057] (-1242.681) (-1240.735) -- 0:00:42 343000 -- (-1240.690) (-1242.067) [-1245.308] (-1242.381) * (-1243.189) (-1241.728) [-1241.559] (-1241.863) -- 0:00:42 343500 -- (-1242.152) (-1241.260) [-1241.844] (-1241.093) * (-1242.943) (-1245.219) (-1243.161) [-1240.790] -- 0:00:42 344000 -- (-1241.519) [-1241.459] (-1242.301) (-1241.779) * [-1242.558] (-1245.004) (-1243.389) (-1241.297) -- 0:00:41 344500 -- (-1241.000) (-1242.944) (-1242.558) [-1241.002] * (-1243.078) [-1246.217] (-1242.657) (-1245.989) -- 0:00:41 345000 -- [-1243.321] (-1242.357) (-1243.931) (-1241.904) * (-1244.101) (-1246.599) [-1243.773] (-1243.605) -- 0:00:41 Average standard deviation of split frequencies: 0.016750 345500 -- (-1242.111) (-1242.244) [-1243.543] (-1241.415) * (-1243.296) (-1242.456) [-1242.411] (-1240.939) -- 0:00:43 346000 -- (-1245.925) (-1241.279) (-1242.206) [-1242.018] * (-1247.791) (-1243.165) [-1241.402] (-1243.259) -- 0:00:43 346500 -- [-1242.975] (-1240.567) (-1241.841) (-1241.638) * (-1249.051) (-1244.519) [-1243.441] (-1244.522) -- 0:00:43 347000 -- (-1245.492) (-1243.908) (-1241.965) [-1245.037] * (-1242.001) (-1242.843) [-1241.368] (-1244.189) -- 0:00:43 347500 -- (-1241.807) (-1242.834) (-1241.820) [-1243.942] * (-1241.496) [-1242.872] (-1241.573) (-1242.332) -- 0:00:43 348000 -- (-1245.786) (-1240.658) (-1244.051) [-1242.619] * (-1244.538) (-1242.179) (-1241.285) [-1240.882] -- 0:00:43 348500 -- (-1244.564) [-1242.954] (-1245.289) (-1241.054) * (-1243.895) [-1242.923] (-1241.717) (-1240.809) -- 0:00:42 349000 -- [-1242.501] (-1243.169) (-1242.233) (-1243.275) * [-1242.104] (-1246.785) (-1243.880) (-1242.084) -- 0:00:42 349500 -- (-1242.118) (-1243.773) (-1244.595) [-1241.336] * (-1242.688) [-1245.605] (-1244.079) (-1246.583) -- 0:00:42 350000 -- (-1241.527) (-1243.306) [-1243.354] (-1242.799) * [-1240.838] (-1245.093) (-1243.594) (-1241.883) -- 0:00:42 Average standard deviation of split frequencies: 0.017634 350500 -- (-1241.527) [-1242.005] (-1242.846) (-1242.826) * (-1241.876) (-1250.688) (-1242.797) [-1241.622] -- 0:00:42 351000 -- (-1240.667) [-1243.320] (-1241.421) (-1245.285) * (-1242.475) (-1241.009) [-1241.411] (-1243.760) -- 0:00:42 351500 -- (-1244.734) (-1241.394) [-1243.544] (-1241.191) * (-1241.543) (-1241.209) (-1242.764) [-1243.654] -- 0:00:42 352000 -- (-1244.019) (-1241.396) [-1244.280] (-1247.062) * (-1241.714) (-1241.738) (-1250.250) [-1240.735] -- 0:00:42 352500 -- (-1241.284) (-1242.178) (-1244.023) [-1241.240] * (-1244.500) (-1244.868) (-1244.326) [-1243.652] -- 0:00:42 353000 -- [-1244.158] (-1243.330) (-1243.843) (-1241.760) * (-1242.498) [-1243.510] (-1242.196) (-1241.427) -- 0:00:42 353500 -- [-1242.300] (-1242.169) (-1250.153) (-1243.160) * (-1248.547) (-1243.462) [-1244.428] (-1242.125) -- 0:00:42 354000 -- (-1242.801) (-1240.873) [-1242.944] (-1245.544) * (-1245.431) (-1244.295) [-1244.346] (-1246.460) -- 0:00:41 354500 -- (-1241.723) (-1241.633) (-1241.020) [-1242.795] * (-1242.531) [-1243.624] (-1240.983) (-1246.434) -- 0:00:41 355000 -- [-1241.747] (-1241.354) (-1241.285) (-1242.133) * (-1241.046) (-1245.580) [-1240.641] (-1244.012) -- 0:00:41 Average standard deviation of split frequencies: 0.017214 355500 -- (-1245.613) (-1243.102) (-1240.856) [-1241.148] * [-1240.802] (-1243.683) (-1247.934) (-1242.409) -- 0:00:41 356000 -- (-1243.096) (-1241.189) [-1240.887] (-1241.518) * [-1241.473] (-1245.376) (-1241.897) (-1240.860) -- 0:00:41 356500 -- (-1241.917) [-1241.257] (-1241.742) (-1243.111) * (-1247.523) [-1243.258] (-1241.489) (-1240.741) -- 0:00:41 357000 -- (-1241.900) [-1242.314] (-1242.523) (-1243.294) * [-1241.060] (-1241.650) (-1245.482) (-1242.905) -- 0:00:41 357500 -- (-1243.287) (-1248.408) [-1242.392] (-1242.847) * [-1243.197] (-1244.851) (-1243.254) (-1242.675) -- 0:00:41 358000 -- (-1240.614) [-1244.162] (-1243.150) (-1241.594) * (-1243.230) (-1249.361) (-1241.885) [-1240.524] -- 0:00:41 358500 -- [-1245.142] (-1245.575) (-1243.493) (-1246.995) * (-1242.851) (-1242.094) (-1242.024) [-1242.462] -- 0:00:41 359000 -- [-1242.964] (-1244.091) (-1243.358) (-1241.919) * (-1242.112) (-1245.126) [-1241.462] (-1246.708) -- 0:00:41 359500 -- (-1243.807) (-1241.462) (-1241.444) [-1241.002] * (-1242.007) (-1249.002) (-1244.727) [-1242.869] -- 0:00:40 360000 -- (-1245.816) (-1241.711) [-1240.451] (-1242.321) * (-1248.031) [-1243.234] (-1241.016) (-1242.329) -- 0:00:40 Average standard deviation of split frequencies: 0.015838 360500 -- (-1242.504) [-1241.055] (-1240.996) (-1243.883) * (-1243.306) (-1249.353) (-1242.513) [-1240.774] -- 0:00:40 361000 -- (-1245.855) (-1243.392) (-1242.993) [-1243.630] * (-1241.649) (-1244.598) [-1242.778] (-1240.713) -- 0:00:40 361500 -- (-1241.979) (-1241.456) [-1240.430] (-1241.171) * [-1244.247] (-1240.813) (-1243.811) (-1241.583) -- 0:00:40 362000 -- [-1242.658] (-1242.642) (-1240.669) (-1241.472) * (-1243.106) (-1240.994) (-1241.357) [-1241.378] -- 0:00:42 362500 -- (-1241.477) (-1244.666) [-1241.545] (-1243.842) * [-1241.634] (-1240.913) (-1241.520) (-1241.147) -- 0:00:42 363000 -- (-1240.697) (-1241.462) [-1242.464] (-1243.176) * (-1241.166) [-1241.198] (-1242.633) (-1242.911) -- 0:00:42 363500 -- [-1240.852] (-1240.956) (-1242.698) (-1245.683) * (-1243.201) [-1244.977] (-1242.864) (-1244.496) -- 0:00:42 364000 -- (-1242.116) [-1242.739] (-1246.939) (-1244.960) * [-1241.317] (-1240.644) (-1241.374) (-1242.837) -- 0:00:41 364500 -- (-1242.550) [-1244.745] (-1244.080) (-1246.873) * (-1244.114) [-1240.870] (-1241.250) (-1245.031) -- 0:00:41 365000 -- (-1242.495) [-1240.477] (-1242.490) (-1241.456) * (-1244.180) (-1246.980) [-1240.620] (-1240.444) -- 0:00:41 Average standard deviation of split frequencies: 0.015527 365500 -- (-1241.567) (-1240.963) (-1244.009) [-1244.987] * [-1242.686] (-1246.000) (-1241.796) (-1243.187) -- 0:00:41 366000 -- [-1241.085] (-1241.204) (-1242.446) (-1246.420) * [-1243.466] (-1242.336) (-1242.411) (-1240.470) -- 0:00:41 366500 -- [-1241.680] (-1241.253) (-1243.099) (-1241.747) * [-1241.572] (-1243.430) (-1245.555) (-1244.029) -- 0:00:41 367000 -- (-1242.701) (-1241.930) (-1242.113) [-1242.693] * [-1241.697] (-1243.998) (-1243.219) (-1242.786) -- 0:00:41 367500 -- [-1242.169] (-1241.938) (-1242.169) (-1241.777) * (-1242.027) (-1241.347) (-1243.539) [-1243.965] -- 0:00:41 368000 -- (-1243.038) [-1242.350] (-1242.368) (-1245.599) * (-1243.288) (-1241.333) (-1241.136) [-1243.509] -- 0:00:41 368500 -- [-1241.370] (-1243.383) (-1243.164) (-1242.669) * (-1242.874) [-1240.547] (-1240.846) (-1241.304) -- 0:00:41 369000 -- (-1241.750) [-1241.893] (-1242.888) (-1241.136) * (-1243.953) (-1241.678) (-1241.909) [-1241.298] -- 0:00:41 369500 -- (-1242.272) (-1243.262) (-1241.903) [-1241.816] * (-1243.867) (-1245.618) [-1242.225] (-1242.041) -- 0:00:40 370000 -- (-1243.877) (-1242.585) [-1245.736] (-1247.194) * (-1242.023) (-1243.379) (-1242.221) [-1242.831] -- 0:00:40 Average standard deviation of split frequencies: 0.015060 370500 -- (-1243.847) (-1244.291) [-1240.386] (-1242.575) * (-1243.162) (-1245.552) (-1241.627) [-1241.111] -- 0:00:40 371000 -- (-1242.619) (-1246.280) (-1242.577) [-1243.219] * (-1242.830) [-1241.009] (-1241.560) (-1241.082) -- 0:00:40 371500 -- (-1241.609) (-1242.737) [-1240.851] (-1242.455) * (-1245.329) (-1241.596) [-1242.666] (-1244.477) -- 0:00:40 372000 -- (-1241.868) (-1244.059) (-1241.084) [-1242.486] * [-1240.812] (-1241.352) (-1241.299) (-1244.003) -- 0:00:40 372500 -- (-1242.369) [-1240.504] (-1244.094) (-1244.498) * (-1244.704) (-1240.906) (-1242.106) [-1243.020] -- 0:00:40 373000 -- (-1243.351) (-1243.349) (-1245.414) [-1244.179] * (-1247.566) [-1241.428] (-1246.596) (-1242.417) -- 0:00:40 373500 -- (-1241.961) (-1241.669) (-1244.262) [-1244.908] * (-1242.994) (-1241.017) (-1243.125) [-1243.118] -- 0:00:40 374000 -- (-1244.628) (-1242.514) [-1242.099] (-1242.950) * [-1243.122] (-1242.841) (-1241.595) (-1241.840) -- 0:00:40 374500 -- (-1243.615) (-1244.815) (-1244.294) [-1241.846] * (-1241.790) (-1241.539) [-1241.921] (-1243.529) -- 0:00:40 375000 -- [-1242.958] (-1243.049) (-1243.021) (-1252.122) * [-1241.674] (-1242.646) (-1242.091) (-1243.070) -- 0:00:40 Average standard deviation of split frequencies: 0.014766 375500 -- (-1244.076) [-1242.549] (-1245.378) (-1245.990) * (-1240.819) (-1244.312) (-1242.901) [-1241.977] -- 0:00:39 376000 -- [-1242.022] (-1241.570) (-1243.634) (-1248.280) * (-1243.800) (-1247.576) [-1245.616] (-1242.659) -- 0:00:39 376500 -- (-1244.924) (-1241.960) [-1246.216] (-1247.548) * (-1241.227) [-1243.168] (-1242.917) (-1243.767) -- 0:00:39 377000 -- (-1241.076) (-1241.832) (-1243.657) [-1244.716] * [-1242.462] (-1241.149) (-1247.855) (-1241.335) -- 0:00:39 377500 -- [-1241.145] (-1240.847) (-1243.598) (-1240.589) * (-1246.426) (-1241.315) [-1240.687] (-1240.791) -- 0:00:39 378000 -- [-1241.243] (-1240.808) (-1243.017) (-1240.664) * (-1246.973) [-1241.750] (-1240.772) (-1240.689) -- 0:00:41 378500 -- (-1242.389) (-1241.213) (-1244.063) [-1243.164] * (-1243.768) (-1245.705) [-1240.459] (-1243.746) -- 0:00:41 379000 -- (-1243.192) [-1241.550] (-1242.008) (-1242.701) * (-1242.037) [-1242.828] (-1240.991) (-1244.943) -- 0:00:40 379500 -- (-1242.534) [-1241.504] (-1241.970) (-1241.419) * (-1241.838) (-1242.913) [-1241.865] (-1243.130) -- 0:00:40 380000 -- (-1240.226) (-1240.850) (-1241.194) [-1240.300] * (-1246.217) (-1240.648) (-1240.773) [-1242.851] -- 0:00:40 Average standard deviation of split frequencies: 0.014998 380500 -- (-1242.643) [-1240.762] (-1242.741) (-1240.793) * (-1242.568) [-1241.093] (-1240.934) (-1241.892) -- 0:00:40 381000 -- (-1243.129) (-1240.735) [-1242.367] (-1244.195) * (-1243.245) (-1244.193) [-1241.954] (-1241.110) -- 0:00:40 381500 -- (-1243.608) (-1242.387) (-1244.296) [-1243.394] * (-1244.258) [-1241.869] (-1243.792) (-1240.675) -- 0:00:40 382000 -- (-1242.144) (-1242.894) [-1241.563] (-1243.615) * (-1244.428) (-1243.275) (-1242.902) [-1242.214] -- 0:00:40 382500 -- (-1241.201) (-1245.514) [-1242.141] (-1241.571) * [-1242.263] (-1241.359) (-1242.174) (-1241.101) -- 0:00:40 383000 -- (-1247.404) [-1241.942] (-1240.567) (-1246.973) * (-1242.263) (-1241.797) [-1243.957] (-1243.648) -- 0:00:40 383500 -- [-1241.954] (-1241.884) (-1241.039) (-1246.684) * (-1243.637) (-1242.894) (-1242.580) [-1242.875] -- 0:00:40 384000 -- (-1244.231) (-1241.490) (-1242.092) [-1245.078] * [-1243.446] (-1243.288) (-1242.801) (-1242.799) -- 0:00:40 384500 -- (-1242.812) (-1242.883) [-1240.997] (-1251.986) * (-1241.019) (-1242.014) (-1241.327) [-1243.098] -- 0:00:40 385000 -- (-1245.704) [-1244.686] (-1242.088) (-1240.698) * [-1241.118] (-1241.742) (-1241.269) (-1242.958) -- 0:00:39 Average standard deviation of split frequencies: 0.013884 385500 -- (-1241.099) [-1244.166] (-1248.839) (-1242.995) * (-1240.877) [-1243.399] (-1241.142) (-1248.560) -- 0:00:39 386000 -- (-1241.231) (-1242.405) (-1241.961) [-1243.430] * (-1241.942) [-1243.390] (-1242.076) (-1245.395) -- 0:00:39 386500 -- (-1242.403) (-1241.246) (-1241.590) [-1242.075] * (-1241.684) (-1247.200) (-1242.132) [-1242.380] -- 0:00:39 387000 -- (-1243.316) [-1241.173] (-1242.522) (-1246.106) * (-1244.100) (-1245.361) [-1240.969] (-1242.236) -- 0:00:39 387500 -- (-1244.067) (-1242.541) [-1242.076] (-1243.517) * (-1243.084) [-1245.032] (-1243.776) (-1243.476) -- 0:00:39 388000 -- (-1243.216) (-1240.630) [-1245.463] (-1247.698) * (-1246.115) [-1240.948] (-1243.972) (-1242.522) -- 0:00:39 388500 -- (-1243.259) [-1241.079] (-1244.381) (-1243.323) * (-1242.394) (-1242.514) (-1247.236) [-1241.426] -- 0:00:39 389000 -- (-1241.218) (-1241.135) (-1243.027) [-1243.580] * (-1240.776) (-1247.038) [-1243.834] (-1242.526) -- 0:00:39 389500 -- (-1240.991) (-1240.956) (-1241.366) [-1242.687] * (-1244.495) [-1242.838] (-1244.389) (-1241.788) -- 0:00:39 390000 -- (-1240.940) [-1242.755] (-1242.288) (-1243.450) * [-1243.279] (-1244.235) (-1241.841) (-1242.989) -- 0:00:39 Average standard deviation of split frequencies: 0.014480 390500 -- (-1243.158) [-1241.004] (-1244.562) (-1242.308) * (-1242.112) [-1241.013] (-1244.308) (-1245.536) -- 0:00:39 391000 -- (-1241.858) (-1243.787) [-1247.471] (-1245.728) * (-1243.382) [-1242.181] (-1241.711) (-1241.494) -- 0:00:38 391500 -- (-1244.253) (-1240.885) [-1243.460] (-1245.772) * (-1244.173) (-1244.448) [-1241.405] (-1242.195) -- 0:00:38 392000 -- [-1244.844] (-1240.906) (-1243.733) (-1242.124) * (-1242.478) [-1242.826] (-1242.408) (-1241.210) -- 0:00:38 392500 -- (-1241.945) (-1241.187) [-1243.784] (-1241.973) * [-1242.719] (-1244.704) (-1244.791) (-1242.522) -- 0:00:38 393000 -- (-1242.909) (-1244.105) [-1243.173] (-1242.128) * (-1244.807) (-1244.636) [-1243.002] (-1242.376) -- 0:00:38 393500 -- (-1247.570) (-1240.775) [-1242.143] (-1244.626) * [-1243.708] (-1244.105) (-1251.817) (-1246.105) -- 0:00:38 394000 -- (-1243.569) [-1240.581] (-1242.483) (-1241.963) * (-1241.953) [-1242.984] (-1241.342) (-1245.387) -- 0:00:38 394500 -- (-1241.044) (-1245.732) [-1244.406] (-1242.644) * [-1242.393] (-1245.792) (-1245.962) (-1243.816) -- 0:00:39 395000 -- (-1240.359) (-1246.896) [-1244.108] (-1241.828) * (-1245.177) [-1244.686] (-1241.147) (-1240.583) -- 0:00:39 Average standard deviation of split frequencies: 0.014814 395500 -- (-1240.359) [-1242.703] (-1240.355) (-1240.581) * [-1243.678] (-1244.911) (-1242.806) (-1241.237) -- 0:00:39 396000 -- [-1242.283] (-1245.272) (-1240.360) (-1242.984) * (-1242.143) [-1244.211] (-1241.251) (-1240.346) -- 0:00:39 396500 -- (-1242.848) (-1240.378) [-1240.818] (-1242.140) * (-1242.084) (-1244.305) [-1241.451] (-1245.349) -- 0:00:39 397000 -- (-1242.927) (-1240.838) [-1244.525] (-1241.177) * (-1242.235) (-1242.090) (-1243.316) [-1241.047] -- 0:00:39 397500 -- (-1243.396) [-1240.353] (-1244.995) (-1242.192) * (-1243.844) [-1241.673] (-1242.454) (-1242.057) -- 0:00:39 398000 -- (-1240.733) (-1240.353) (-1244.255) [-1242.250] * (-1244.146) (-1242.124) [-1240.968] (-1241.039) -- 0:00:39 398500 -- (-1240.744) (-1241.340) (-1241.349) [-1241.609] * (-1243.534) (-1241.121) (-1241.631) [-1241.447] -- 0:00:39 399000 -- [-1243.509] (-1240.890) (-1242.279) (-1243.065) * (-1242.850) [-1243.905] (-1241.851) (-1241.149) -- 0:00:39 399500 -- (-1247.702) (-1243.795) [-1242.848] (-1241.149) * (-1246.097) (-1244.844) [-1241.640] (-1241.244) -- 0:00:39 400000 -- (-1244.666) (-1244.117) (-1242.550) [-1242.097] * (-1246.798) (-1241.525) [-1240.454] (-1243.233) -- 0:00:39 Average standard deviation of split frequencies: 0.015230 400500 -- [-1245.494] (-1246.858) (-1242.650) (-1241.359) * [-1245.110] (-1240.776) (-1243.172) (-1242.244) -- 0:00:38 401000 -- (-1243.655) (-1248.105) (-1244.661) [-1242.165] * (-1240.932) (-1240.943) [-1245.352] (-1245.214) -- 0:00:38 401500 -- [-1243.374] (-1242.579) (-1243.075) (-1240.854) * (-1242.631) [-1241.961] (-1244.471) (-1243.059) -- 0:00:38 402000 -- (-1247.546) (-1241.219) (-1246.810) [-1240.664] * (-1246.753) [-1242.091] (-1242.780) (-1240.849) -- 0:00:38 402500 -- (-1244.807) (-1242.327) [-1241.464] (-1240.859) * [-1243.103] (-1244.717) (-1241.168) (-1241.461) -- 0:00:38 403000 -- (-1246.557) (-1242.860) [-1244.834] (-1241.231) * (-1242.999) [-1241.691] (-1242.592) (-1242.828) -- 0:00:38 403500 -- (-1244.149) (-1245.892) [-1246.387] (-1241.168) * (-1242.392) (-1243.180) [-1243.540] (-1240.638) -- 0:00:38 404000 -- [-1242.918] (-1242.421) (-1242.393) (-1240.396) * [-1241.201] (-1243.184) (-1245.007) (-1241.188) -- 0:00:38 404500 -- (-1244.042) (-1240.491) (-1242.051) [-1241.279] * [-1241.800] (-1241.116) (-1243.442) (-1241.770) -- 0:00:38 405000 -- (-1243.819) (-1240.942) [-1241.589] (-1242.604) * (-1240.679) [-1241.215] (-1242.572) (-1242.856) -- 0:00:38 Average standard deviation of split frequencies: 0.015997 405500 -- (-1242.856) [-1242.167] (-1247.935) (-1245.359) * [-1241.169] (-1243.183) (-1242.342) (-1242.035) -- 0:00:38 406000 -- (-1245.255) (-1241.714) (-1245.956) [-1242.667] * [-1242.416] (-1242.484) (-1243.664) (-1243.454) -- 0:00:38 406500 -- (-1243.261) [-1242.927] (-1249.755) (-1240.757) * [-1243.646] (-1241.129) (-1244.553) (-1247.294) -- 0:00:37 407000 -- (-1243.781) (-1240.817) (-1251.707) [-1240.904] * (-1240.884) [-1241.902] (-1242.365) (-1244.669) -- 0:00:37 407500 -- [-1242.778] (-1247.781) (-1257.002) (-1242.199) * [-1240.801] (-1247.660) (-1243.651) (-1243.758) -- 0:00:37 408000 -- (-1243.172) (-1244.086) [-1246.376] (-1242.249) * [-1243.523] (-1248.025) (-1244.565) (-1242.726) -- 0:00:37 408500 -- (-1241.795) (-1244.445) [-1244.257] (-1244.027) * (-1241.784) (-1242.662) [-1242.166] (-1245.735) -- 0:00:37 409000 -- (-1241.312) [-1245.141] (-1244.419) (-1241.274) * [-1243.536] (-1246.609) (-1243.038) (-1241.871) -- 0:00:37 409500 -- [-1241.562] (-1244.559) (-1242.523) (-1241.733) * (-1245.256) (-1246.694) [-1246.496] (-1241.281) -- 0:00:37 410000 -- (-1242.301) (-1243.441) (-1243.032) [-1240.939] * (-1245.156) [-1240.968] (-1241.519) (-1241.180) -- 0:00:37 Average standard deviation of split frequencies: 0.014604 410500 -- (-1242.703) (-1241.882) (-1242.895) [-1241.371] * (-1241.129) (-1240.839) (-1244.769) [-1241.697] -- 0:00:38 411000 -- (-1244.067) [-1244.190] (-1242.044) (-1241.416) * (-1241.598) (-1241.529) [-1243.584] (-1243.494) -- 0:00:38 411500 -- (-1241.289) (-1245.479) (-1242.758) [-1240.990] * [-1241.695] (-1240.708) (-1246.824) (-1244.898) -- 0:00:38 412000 -- (-1241.290) (-1243.572) (-1242.285) [-1240.973] * (-1244.570) (-1242.828) [-1245.387] (-1242.565) -- 0:00:38 412500 -- [-1241.565] (-1244.985) (-1242.592) (-1243.411) * (-1243.090) (-1242.239) [-1244.721] (-1241.667) -- 0:00:38 413000 -- (-1243.171) (-1245.604) [-1243.789] (-1242.254) * (-1245.591) (-1242.669) [-1243.326] (-1241.725) -- 0:00:38 413500 -- (-1246.000) (-1245.168) (-1241.792) [-1242.247] * (-1240.709) (-1240.899) [-1242.105] (-1248.503) -- 0:00:38 414000 -- (-1242.899) (-1241.655) [-1241.310] (-1242.393) * [-1241.990] (-1241.330) (-1241.289) (-1241.389) -- 0:00:38 414500 -- [-1241.162] (-1242.438) (-1241.957) (-1243.261) * [-1240.684] (-1242.018) (-1241.639) (-1244.559) -- 0:00:38 415000 -- (-1242.611) [-1245.461] (-1243.580) (-1241.332) * [-1242.090] (-1243.868) (-1243.861) (-1247.502) -- 0:00:38 Average standard deviation of split frequencies: 0.014417 415500 -- (-1245.957) (-1244.955) [-1241.954] (-1243.442) * (-1242.261) (-1247.586) [-1241.457] (-1251.773) -- 0:00:37 416000 -- (-1243.197) (-1246.536) [-1243.257] (-1240.864) * (-1244.514) (-1245.690) [-1242.380] (-1249.194) -- 0:00:37 416500 -- (-1242.629) (-1243.671) (-1241.236) [-1241.579] * (-1242.147) (-1251.265) (-1241.921) [-1242.677] -- 0:00:37 417000 -- [-1242.580] (-1241.305) (-1240.729) (-1241.286) * [-1241.933] (-1249.373) (-1242.815) (-1241.334) -- 0:00:37 417500 -- [-1243.253] (-1241.644) (-1240.878) (-1241.117) * (-1245.163) (-1245.989) (-1241.157) [-1242.026] -- 0:00:37 418000 -- (-1242.709) (-1245.919) (-1241.479) [-1241.233] * (-1240.635) (-1242.538) [-1242.552] (-1241.447) -- 0:00:37 418500 -- (-1243.646) (-1244.677) [-1241.728] (-1241.533) * (-1240.630) (-1242.570) [-1242.989] (-1242.418) -- 0:00:37 419000 -- (-1243.149) (-1243.186) [-1242.650] (-1242.963) * [-1240.561] (-1240.786) (-1241.000) (-1241.079) -- 0:00:37 419500 -- (-1243.075) (-1242.855) [-1244.349] (-1241.861) * (-1241.291) (-1242.730) [-1241.090] (-1240.947) -- 0:00:37 420000 -- [-1243.920] (-1246.156) (-1244.364) (-1241.690) * (-1241.499) (-1243.139) (-1241.387) [-1242.276] -- 0:00:37 Average standard deviation of split frequencies: 0.014132 420500 -- (-1241.235) (-1245.524) [-1242.772] (-1241.642) * (-1243.221) [-1246.269] (-1243.969) (-1242.494) -- 0:00:37 421000 -- (-1244.333) (-1242.915) [-1242.316] (-1241.396) * (-1243.651) (-1241.326) [-1245.841] (-1241.906) -- 0:00:37 421500 -- (-1242.109) (-1241.304) [-1244.273] (-1241.850) * [-1242.973] (-1243.786) (-1247.528) (-1241.920) -- 0:00:37 422000 -- [-1241.777] (-1241.330) (-1242.558) (-1241.159) * (-1245.214) (-1244.507) (-1242.244) [-1243.882] -- 0:00:36 422500 -- [-1241.201] (-1241.147) (-1247.390) (-1241.900) * (-1242.498) [-1243.500] (-1243.360) (-1243.471) -- 0:00:36 423000 -- (-1241.053) [-1241.050] (-1244.137) (-1242.419) * (-1242.763) [-1241.972] (-1245.330) (-1241.952) -- 0:00:36 423500 -- (-1242.564) (-1242.010) (-1243.326) [-1241.320] * (-1241.618) (-1243.100) (-1242.426) [-1241.148] -- 0:00:36 424000 -- [-1242.860] (-1242.658) (-1245.555) (-1241.544) * (-1242.575) [-1245.729] (-1243.283) (-1240.828) -- 0:00:36 424500 -- (-1241.470) (-1241.210) [-1242.751] (-1244.534) * [-1242.658] (-1243.567) (-1243.813) (-1241.942) -- 0:00:36 425000 -- (-1240.689) [-1244.014] (-1247.325) (-1244.710) * (-1241.352) (-1242.914) [-1242.325] (-1240.461) -- 0:00:36 Average standard deviation of split frequencies: 0.013771 425500 -- [-1241.130] (-1241.084) (-1245.955) (-1240.960) * (-1242.044) [-1246.635] (-1249.048) (-1240.472) -- 0:00:36 426000 -- [-1241.603] (-1241.985) (-1243.227) (-1240.420) * (-1244.234) (-1241.232) [-1243.166] (-1240.597) -- 0:00:36 426500 -- (-1246.083) [-1245.520] (-1242.489) (-1240.422) * (-1243.835) [-1242.835] (-1242.129) (-1245.014) -- 0:00:36 427000 -- [-1244.773] (-1244.861) (-1242.071) (-1240.437) * (-1242.524) (-1242.241) (-1241.805) [-1242.166] -- 0:00:37 427500 -- [-1241.823] (-1248.356) (-1241.522) (-1241.297) * [-1244.075] (-1240.923) (-1240.787) (-1242.753) -- 0:00:37 428000 -- (-1241.385) (-1242.309) (-1245.150) [-1242.106] * (-1245.211) (-1240.923) [-1242.049] (-1241.891) -- 0:00:37 428500 -- (-1241.601) (-1243.739) (-1246.975) [-1241.749] * (-1245.653) (-1244.349) (-1241.802) [-1243.718] -- 0:00:37 429000 -- (-1242.927) (-1241.183) (-1245.938) [-1242.016] * (-1247.429) (-1247.096) [-1240.899] (-1243.883) -- 0:00:37 429500 -- (-1243.418) (-1245.491) [-1242.770] (-1241.097) * (-1246.359) (-1244.286) [-1241.411] (-1243.407) -- 0:00:37 430000 -- (-1242.495) [-1241.348] (-1241.578) (-1242.877) * (-1244.075) (-1246.145) (-1241.402) [-1243.003] -- 0:00:37 Average standard deviation of split frequencies: 0.014777 430500 -- [-1242.119] (-1241.475) (-1245.873) (-1241.888) * (-1242.226) (-1242.893) (-1241.336) [-1242.194] -- 0:00:37 431000 -- (-1241.728) (-1241.535) (-1243.539) [-1241.041] * [-1244.828] (-1241.506) (-1241.353) (-1244.285) -- 0:00:36 431500 -- (-1241.642) (-1241.984) (-1242.390) [-1247.220] * (-1244.553) (-1242.327) (-1242.334) [-1243.453] -- 0:00:36 432000 -- (-1242.577) (-1241.594) (-1241.578) [-1243.406] * (-1244.091) [-1243.422] (-1241.943) (-1242.804) -- 0:00:36 432500 -- [-1245.784] (-1241.602) (-1241.820) (-1242.818) * [-1244.973] (-1244.111) (-1241.302) (-1242.732) -- 0:00:36 433000 -- [-1241.657] (-1242.373) (-1241.788) (-1247.868) * [-1246.916] (-1241.721) (-1245.985) (-1241.078) -- 0:00:36 433500 -- [-1242.779] (-1244.494) (-1242.515) (-1246.591) * (-1240.799) (-1241.846) [-1245.344] (-1242.516) -- 0:00:36 434000 -- [-1241.776] (-1242.197) (-1242.352) (-1254.666) * (-1242.194) (-1241.722) (-1245.206) [-1242.303] -- 0:00:36 434500 -- (-1242.531) (-1246.305) [-1242.426] (-1245.777) * [-1242.705] (-1243.006) (-1242.903) (-1240.993) -- 0:00:36 435000 -- (-1240.825) (-1244.326) [-1242.597] (-1245.641) * [-1241.031] (-1241.617) (-1243.418) (-1241.764) -- 0:00:36 Average standard deviation of split frequencies: 0.014056 435500 -- (-1241.411) [-1241.309] (-1241.850) (-1242.673) * (-1241.381) (-1240.787) (-1243.563) [-1243.802] -- 0:00:36 436000 -- (-1242.086) [-1244.763] (-1243.738) (-1244.746) * (-1242.300) (-1241.974) [-1242.430] (-1240.876) -- 0:00:36 436500 -- (-1246.659) (-1245.799) [-1243.510] (-1241.143) * (-1241.604) (-1241.947) [-1243.855] (-1246.306) -- 0:00:36 437000 -- (-1246.102) (-1241.629) (-1244.347) [-1241.237] * (-1244.784) (-1242.041) (-1241.501) [-1245.175] -- 0:00:36 437500 -- (-1243.232) (-1242.360) (-1243.076) [-1243.782] * (-1244.661) (-1241.477) [-1246.576] (-1244.670) -- 0:00:36 438000 -- (-1243.120) [-1242.019] (-1242.395) (-1241.890) * [-1242.976] (-1241.027) (-1244.095) (-1244.991) -- 0:00:35 438500 -- (-1243.123) [-1241.444] (-1243.179) (-1244.103) * (-1240.803) (-1242.031) [-1243.023] (-1245.971) -- 0:00:35 439000 -- [-1246.138] (-1244.883) (-1243.510) (-1245.445) * [-1241.016] (-1241.998) (-1241.930) (-1242.146) -- 0:00:35 439500 -- (-1242.075) (-1242.024) (-1242.617) [-1241.490] * [-1242.897] (-1240.889) (-1243.759) (-1240.893) -- 0:00:35 440000 -- (-1241.046) (-1246.117) (-1243.185) [-1241.834] * [-1243.099] (-1242.079) (-1241.426) (-1241.969) -- 0:00:35 Average standard deviation of split frequencies: 0.014679 440500 -- (-1241.011) (-1245.684) [-1243.757] (-1242.346) * (-1243.204) (-1242.563) [-1242.318] (-1242.087) -- 0:00:35 441000 -- (-1242.067) (-1242.598) [-1241.915] (-1241.411) * (-1242.745) [-1241.751] (-1241.712) (-1242.957) -- 0:00:35 441500 -- (-1242.905) (-1242.322) [-1241.938] (-1242.471) * (-1244.723) (-1244.517) [-1242.965] (-1244.223) -- 0:00:35 442000 -- (-1242.905) (-1241.433) (-1246.792) [-1242.575] * (-1245.972) (-1241.856) [-1244.727] (-1243.522) -- 0:00:35 442500 -- (-1242.291) [-1242.180] (-1243.472) (-1241.844) * (-1247.989) (-1240.943) (-1242.782) [-1242.871] -- 0:00:35 443000 -- (-1241.245) [-1241.976] (-1243.162) (-1245.418) * (-1243.134) [-1246.256] (-1241.408) (-1243.102) -- 0:00:36 443500 -- [-1242.715] (-1244.709) (-1242.468) (-1243.889) * (-1242.622) (-1245.080) (-1242.434) [-1244.015] -- 0:00:36 444000 -- (-1244.267) (-1244.811) [-1242.293] (-1244.460) * (-1243.783) (-1242.208) (-1243.894) [-1244.015] -- 0:00:36 444500 -- (-1244.970) [-1245.779] (-1245.273) (-1242.341) * [-1245.380] (-1243.777) (-1246.602) (-1242.689) -- 0:00:36 445000 -- [-1241.986] (-1246.290) (-1244.666) (-1242.579) * [-1245.556] (-1243.370) (-1243.718) (-1243.308) -- 0:00:36 Average standard deviation of split frequencies: 0.014386 445500 -- (-1241.358) [-1241.544] (-1247.044) (-1248.502) * (-1246.168) (-1242.050) [-1242.558] (-1245.496) -- 0:00:36 446000 -- (-1241.558) (-1241.456) (-1245.544) [-1242.382] * (-1242.976) (-1242.759) [-1242.072] (-1241.581) -- 0:00:36 446500 -- (-1242.434) [-1242.279] (-1246.628) (-1240.767) * (-1242.425) [-1240.995] (-1249.387) (-1242.913) -- 0:00:35 447000 -- (-1244.955) [-1242.926] (-1242.220) (-1243.216) * [-1240.416] (-1242.389) (-1242.868) (-1242.298) -- 0:00:35 447500 -- (-1241.516) (-1241.879) [-1244.140] (-1240.711) * (-1246.142) (-1241.602) [-1243.893] (-1241.156) -- 0:00:35 448000 -- [-1241.102] (-1245.485) (-1245.480) (-1241.672) * (-1243.672) [-1242.903] (-1241.289) (-1241.826) -- 0:00:35 448500 -- (-1242.030) (-1241.441) (-1247.345) [-1242.943] * (-1243.688) [-1242.235] (-1241.076) (-1241.473) -- 0:00:35 449000 -- (-1241.038) (-1241.092) (-1243.891) [-1242.941] * (-1242.737) [-1241.784] (-1241.812) (-1241.073) -- 0:00:35 449500 -- (-1241.288) (-1241.239) (-1245.426) [-1243.961] * (-1242.623) (-1241.486) [-1241.779] (-1241.420) -- 0:00:35 450000 -- (-1242.267) [-1242.571] (-1244.164) (-1246.541) * (-1242.376) (-1240.552) (-1242.757) [-1241.836] -- 0:00:35 Average standard deviation of split frequencies: 0.014398 450500 -- (-1242.244) (-1242.795) [-1243.740] (-1244.534) * [-1241.647] (-1242.560) (-1242.833) (-1243.089) -- 0:00:35 451000 -- (-1241.002) (-1242.424) [-1243.201] (-1243.787) * (-1242.042) (-1240.927) [-1241.433] (-1241.793) -- 0:00:35 451500 -- (-1242.538) (-1244.464) [-1242.256] (-1242.401) * (-1242.767) (-1243.868) [-1242.228] (-1242.723) -- 0:00:35 452000 -- [-1242.538] (-1242.656) (-1243.532) (-1240.855) * (-1241.809) (-1243.365) (-1246.365) [-1242.169] -- 0:00:35 452500 -- (-1241.852) (-1246.434) (-1242.427) [-1241.669] * (-1244.317) [-1241.389] (-1242.545) (-1242.284) -- 0:00:35 453000 -- [-1241.102] (-1245.521) (-1245.505) (-1242.047) * (-1243.072) (-1241.425) [-1241.562] (-1243.447) -- 0:00:35 453500 -- (-1241.578) (-1244.811) (-1241.899) [-1241.881] * (-1243.034) (-1243.705) (-1243.829) [-1245.592] -- 0:00:34 454000 -- [-1241.247] (-1241.619) (-1241.713) (-1241.733) * (-1242.795) (-1242.365) [-1243.173] (-1241.921) -- 0:00:34 454500 -- (-1242.088) [-1241.416] (-1241.565) (-1244.577) * (-1243.822) [-1242.580] (-1252.781) (-1242.431) -- 0:00:34 455000 -- (-1243.488) (-1243.309) [-1245.142] (-1243.992) * (-1244.565) [-1243.622] (-1242.529) (-1241.393) -- 0:00:34 Average standard deviation of split frequencies: 0.014716 455500 -- (-1241.494) (-1240.371) [-1242.320] (-1241.341) * (-1243.053) (-1244.656) [-1241.759] (-1247.509) -- 0:00:34 456000 -- (-1240.812) (-1240.601) (-1241.265) [-1245.021] * (-1243.728) (-1248.044) [-1240.760] (-1243.692) -- 0:00:34 456500 -- (-1240.385) (-1241.858) (-1241.926) [-1245.478] * (-1243.834) (-1247.031) [-1241.678] (-1242.949) -- 0:00:34 457000 -- (-1241.513) (-1240.927) (-1241.650) [-1242.644] * (-1242.672) (-1241.313) (-1241.388) [-1240.902] -- 0:00:34 457500 -- [-1240.746] (-1243.431) (-1242.863) (-1246.158) * (-1241.978) (-1241.173) [-1244.809] (-1248.532) -- 0:00:34 458000 -- (-1243.109) [-1243.437] (-1243.384) (-1245.608) * (-1242.840) (-1241.070) [-1243.018] (-1243.875) -- 0:00:34 458500 -- [-1245.616] (-1243.597) (-1241.786) (-1242.698) * (-1243.691) (-1241.721) (-1240.722) [-1241.372] -- 0:00:34 459000 -- (-1241.450) [-1243.983] (-1241.034) (-1241.492) * (-1246.354) (-1243.554) (-1242.713) [-1242.844] -- 0:00:34 459500 -- (-1241.158) [-1241.652] (-1241.603) (-1242.739) * (-1245.305) (-1246.782) [-1241.270] (-1242.478) -- 0:00:35 460000 -- (-1240.832) (-1242.309) [-1241.325] (-1242.895) * (-1247.079) [-1240.539] (-1240.757) (-1243.699) -- 0:00:35 Average standard deviation of split frequencies: 0.014326 460500 -- (-1240.896) (-1245.468) [-1243.956] (-1246.062) * [-1242.744] (-1248.145) (-1242.708) (-1243.676) -- 0:00:35 461000 -- (-1242.327) (-1243.813) [-1242.806] (-1241.794) * (-1241.448) [-1243.426] (-1240.831) (-1245.151) -- 0:00:35 461500 -- (-1240.601) (-1241.977) [-1243.271] (-1241.891) * (-1241.508) (-1241.815) [-1242.817] (-1242.042) -- 0:00:35 462000 -- (-1240.809) (-1245.963) (-1240.954) [-1243.572] * [-1241.494] (-1241.937) (-1243.132) (-1244.305) -- 0:00:34 462500 -- (-1241.409) (-1248.076) (-1241.536) [-1243.075] * [-1241.096] (-1242.193) (-1243.968) (-1246.525) -- 0:00:34 463000 -- (-1240.927) (-1245.580) [-1242.247] (-1243.339) * (-1247.302) [-1242.712] (-1245.004) (-1245.190) -- 0:00:34 463500 -- [-1247.388] (-1244.435) (-1240.546) (-1244.064) * (-1241.896) (-1243.485) (-1245.137) [-1242.847] -- 0:00:34 464000 -- [-1241.279] (-1242.274) (-1241.159) (-1243.850) * (-1244.290) (-1242.645) (-1242.243) [-1241.458] -- 0:00:34 464500 -- [-1241.661] (-1241.666) (-1241.882) (-1244.537) * (-1242.377) (-1242.689) [-1245.757] (-1245.497) -- 0:00:34 465000 -- (-1243.515) [-1242.075] (-1242.914) (-1241.688) * [-1241.917] (-1241.720) (-1245.633) (-1243.800) -- 0:00:34 Average standard deviation of split frequencies: 0.014162 465500 -- [-1241.350] (-1243.355) (-1244.025) (-1241.777) * (-1241.297) (-1241.014) [-1243.889] (-1241.298) -- 0:00:34 466000 -- [-1243.276] (-1241.340) (-1240.506) (-1241.717) * [-1241.700] (-1241.016) (-1241.982) (-1241.874) -- 0:00:34 466500 -- (-1242.362) (-1241.019) (-1241.918) [-1241.849] * [-1241.193] (-1241.276) (-1244.315) (-1244.322) -- 0:00:34 467000 -- (-1243.405) [-1242.982] (-1242.940) (-1241.599) * (-1246.233) (-1240.823) [-1242.799] (-1243.838) -- 0:00:34 467500 -- [-1243.444] (-1245.583) (-1241.059) (-1242.677) * (-1246.122) [-1243.250] (-1243.358) (-1241.839) -- 0:00:34 468000 -- (-1242.150) [-1242.643] (-1240.608) (-1242.437) * (-1245.433) (-1240.538) (-1245.068) [-1245.836] -- 0:00:34 468500 -- (-1242.847) (-1244.275) [-1244.999] (-1242.144) * (-1242.401) (-1241.085) (-1243.564) [-1240.810] -- 0:00:34 469000 -- [-1241.347] (-1244.730) (-1241.672) (-1240.577) * [-1242.164] (-1243.227) (-1242.596) (-1245.319) -- 0:00:33 469500 -- (-1242.548) [-1243.065] (-1240.979) (-1241.251) * (-1242.238) [-1241.750] (-1244.005) (-1241.202) -- 0:00:33 470000 -- (-1240.602) [-1243.264] (-1244.529) (-1243.714) * (-1242.082) (-1242.356) (-1241.400) [-1241.175] -- 0:00:33 Average standard deviation of split frequencies: 0.013521 470500 -- (-1242.590) (-1244.478) (-1242.153) [-1241.037] * (-1241.006) (-1242.729) [-1242.356] (-1240.775) -- 0:00:33 471000 -- [-1244.792] (-1246.078) (-1242.330) (-1241.190) * (-1241.987) (-1243.002) [-1241.202] (-1241.617) -- 0:00:33 471500 -- (-1246.122) [-1243.515] (-1242.140) (-1241.398) * (-1242.240) [-1240.978] (-1241.508) (-1242.422) -- 0:00:33 472000 -- (-1241.631) (-1244.169) (-1240.537) [-1242.760] * [-1242.815] (-1240.978) (-1241.928) (-1241.951) -- 0:00:33 472500 -- (-1240.564) [-1244.912] (-1242.360) (-1245.487) * (-1243.216) [-1240.480] (-1242.828) (-1241.897) -- 0:00:33 473000 -- (-1241.447) (-1241.271) [-1241.629] (-1243.743) * [-1241.736] (-1242.185) (-1242.341) (-1241.442) -- 0:00:33 473500 -- (-1240.725) (-1245.766) [-1242.843] (-1245.517) * (-1241.829) (-1243.506) [-1242.539] (-1241.967) -- 0:00:33 474000 -- [-1242.855] (-1244.518) (-1245.963) (-1240.324) * [-1240.541] (-1243.179) (-1243.025) (-1240.914) -- 0:00:33 474500 -- [-1243.723] (-1245.398) (-1241.121) (-1240.368) * [-1241.