--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:56:54 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/12res/wbbL/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1241.92 -1245.23 2 -1241.97 -1245.85 -------------------------------------- TOTAL -1241.94 -1245.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890519 0.089031 0.332162 1.452637 0.859783 1391.94 1446.47 1.000 r(A<->C){all} 0.171190 0.019528 0.000107 0.451733 0.137919 94.35 205.14 1.002 r(A<->G){all} 0.169459 0.021934 0.000191 0.466578 0.128385 110.30 228.37 1.001 r(A<->T){all} 0.173563 0.021561 0.000047 0.469307 0.134254 146.68 173.33 1.001 r(C<->G){all} 0.160869 0.019865 0.000098 0.435774 0.120458 215.63 238.94 1.001 r(C<->T){all} 0.163870 0.018430 0.000046 0.428004 0.131090 191.37 251.23 1.000 r(G<->T){all} 0.161049 0.020339 0.000021 0.453306 0.117954 113.63 171.57 1.000 pi(A){all} 0.153014 0.000140 0.130570 0.175537 0.152780 1108.90 1259.47 1.000 pi(C){all} 0.285780 0.000220 0.257869 0.315427 0.285614 1103.71 1183.80 1.001 pi(G){all} 0.347100 0.000250 0.316094 0.378444 0.347319 1148.34 1213.79 1.000 pi(T){all} 0.214106 0.000172 0.188413 0.239409 0.213745 1038.56 1202.25 1.000 alpha{1,2} 0.424906 0.236395 0.000452 1.369378 0.258066 1294.21 1381.97 1.000 alpha{3} 0.458009 0.227401 0.000170 1.401651 0.305596 1320.31 1322.25 1.000 pinvar{all} 0.998389 0.000004 0.994851 0.999999 0.998976 1054.65 1150.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1216.240201 Model 2: PositiveSelection -1216.240134 Model 0: one-ratio -1216.240445 Model 7: beta -1216.240281 Model 8: beta&w>1 -1216.240134 Model 0 vs 1 4.8799999967741314E-4 Model 2 vs 1 1.3400000034380355E-4 Model 8 vs 7 2.9400000039458973E-4
>C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=308 C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA ************************************************** C1 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C2 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C3 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C4 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C5 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C6 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP ************************************************** C1 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C2 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C3 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C4 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C5 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C6 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG ************************************************** C1 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C2 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C3 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C4 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C5 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C6 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG ************************************************** C1 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C2 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C3 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C4 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C5 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C6 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA ************************************************** C1 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C2 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C3 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C4 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C5 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C6 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA ************************************************** C1 RQLAEGRR C2 RQLAEGRR C3 RQLAEGRR C4 RQLAEGRR C5 RQLAEGRR C6 RQLAEGRR ******** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9240] Library Relaxation: Multi_proc [96] Relaxation Summary: [9240]--->[9240] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.504 Mb, Max= 30.866 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA ************************************************** C1 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C2 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C3 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C4 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C5 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP C6 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP ************************************************** C1 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C2 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C3 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C4 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C5 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG C6 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG ************************************************** C1 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C2 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C3 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C4 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C5 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG C6 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG ************************************************** C1 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C2 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C3 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C4 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C5 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA C6 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA ************************************************** C1 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C2 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C3 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C4 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C5 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA C6 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA ************************************************** C1 RQLAEGRR C2 RQLAEGRR C3 RQLAEGRR C4 RQLAEGRR C5 RQLAEGRR C6 RQLAEGRR ******** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C2 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C3 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C4 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C5 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA C6 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA ************************************************** C1 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C2 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C3 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C4 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C5 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA C6 CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA ************************************************** C1 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C2 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C3 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C4 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C5 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG C6 GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG ************************************************** C1 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C2 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C3 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C4 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C5 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG C6 GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG ************************************************** C1 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C2 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C3 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C4 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C5 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG C6 GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG ************************************************** C1 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C2 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C3 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C4 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C5 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT C6 GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT ************************************************** C1 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C2 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C3 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C4 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C5 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC C6 GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC ************************************************** C1 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C2 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C3 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C4 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C5 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG C6 CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG ************************************************** C1 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C2 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C3 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C4 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C5 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC C6 GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ************************************************** C1 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C2 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C3 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C4 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C5 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC C6 ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC ************************************************** C1 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C2 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C3 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C4 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C5 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT C6 CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT ************************************************** C1 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C2 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C3 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C4 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C5 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC C6 CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC ************************************************** C1 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C2 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C3 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C4 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C5 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG C6 TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG ************************************************** C1 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C2 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C3 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C4 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C5 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC C6 GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC ************************************************** C1 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C2 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C3 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C4 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C5 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG C6 TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG ************************************************** C1 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C2 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C3 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C4 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C5 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG C6 GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG ************************************************** C1 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C2 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C3 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C4 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C5 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT C6 GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT ************************************************** C1 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C2 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C3 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C4 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C5 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC C6 CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC ************************************************** C1 AGGCAACTGGCAGAAGGGCGACGT C2 AGGCAACTGGCAGAAGGGCGACGT C3 AGGCAACTGGCAGAAGGGCGACGT C4 AGGCAACTGGCAGAAGGGCGACGT C5 AGGCAACTGGCAGAAGGGCGACGT C6 AGGCAACTGGCAGAAGGGCGACGT ************************ >C1 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C2 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C3 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C4 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C5 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C6 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >C1 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C2 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C3 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C4 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C5 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >C6 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 924 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791302 Setting output file names to "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 932829207 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0570605940 Seed = 675030362 Swapseed = 1579791302 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2067.956291 -- -24.965149 Chain 2 -- -2067.956291 -- -24.965149 Chain 3 -- -2067.956291 -- -24.965149 Chain 4 -- -2067.956171 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2067.956291 -- -24.965149 Chain 2 -- -2067.956291 -- -24.965149 Chain 3 -- -2067.956291 -- -24.965149 Chain 4 -- -2067.956171 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2067.956] (-2067.956) (-2067.956) (-2067.956) * [-2067.956] (-2067.956) (-2067.956) (-2067.956) 500 -- (-1259.249) (-1256.077) [-1255.031] (-1285.195) * [-1256.004] (-1275.224) (-1296.255) (-1275.580) -- 0:00:00 1000 -- [-1255.267] (-1249.516) (-1256.235) (-1260.223) * (-1243.916) (-1257.793) [-1250.253] (-1250.487) -- 0:00:00 1500 -- (-1253.027) (-1252.350) [-1248.576] (-1250.024) * (-1252.421) (-1255.727) (-1255.102) [-1256.054] -- 0:00:00 2000 -- (-1249.115) (-1251.577) [-1243.649] (-1250.415) * (-1249.212) (-1260.673) (-1258.618) [-1250.684] -- 0:00:00 2500 -- [-1247.367] (-1253.110) (-1248.512) (-1248.333) * [-1253.919] (-1258.573) (-1251.045) (-1250.115) -- 0:00:00 3000 -- [-1249.686] (-1252.805) (-1248.539) (-1250.214) * [-1252.720] (-1251.798) (-1256.173) (-1247.620) -- 0:00:00 3500 -- (-1258.858) (-1254.527) (-1251.022) [-1250.872] * [-1249.635] (-1255.539) (-1257.615) (-1252.281) -- 0:00:00 4000 -- (-1250.873) [-1252.432] (-1251.881) (-1258.012) * [-1251.744] (-1249.562) (-1253.124) (-1255.726) -- 0:00:00 4500 -- (-1252.039) [-1254.351] (-1269.435) (-1250.229) * (-1255.170) (-1249.754) [-1249.146] (-1251.154) -- 0:00:00 5000 -- (-1253.225) [-1255.255] (-1252.323) (-1252.821) * (-1251.925) (-1248.381) [-1248.199] (-1251.960) -- 0:00:00 Average standard deviation of split frequencies: 0.119422 5500 -- (-1248.533) [-1252.559] (-1241.502) (-1252.067) * (-1263.117) (-1244.669) (-1251.884) [-1254.573] -- 0:00:00 6000 -- [-1251.103] (-1259.944) (-1242.528) (-1267.300) * (-1255.754) (-1250.969) (-1256.484) [-1253.446] -- 0:02:45 6500 -- [-1248.440] (-1254.478) (-1243.706) (-1252.045) * (-1255.922) (-1258.412) [-1250.805] (-1253.749) -- 0:02:32 7000 -- [-1260.942] (-1251.463) (-1243.349) (-1257.334) * [-1253.571] (-1248.923) (-1251.264) (-1255.062) -- 0:02:21 7500 -- (-1247.855) [-1248.597] (-1243.834) (-1253.999) * [-1255.168] (-1247.133) (-1257.121) (-1249.707) -- 0:02:12 8000 -- [-1243.935] (-1248.745) (-1244.361) (-1246.386) * (-1248.608) [-1247.312] (-1248.768) (-1255.279) -- 0:02:04 8500 -- [-1250.725] (-1248.657) (-1243.275) (-1254.795) * (-1249.988) [-1251.727] (-1246.331) (-1260.430) -- 0:01:56 9000 -- (-1250.579) (-1257.117) (-1241.116) [-1250.416] * (-1260.289) [-1250.370] (-1254.942) (-1259.894) -- 0:01:50 9500 -- (-1248.414) (-1252.657) [-1241.778] (-1267.848) * (-1254.211) (-1250.698) [-1248.789] (-1253.732) -- 0:01:44 10000 -- (-1252.097) (-1260.749) (-1244.294) [-1247.804] * (-1251.599) (-1259.463) [-1249.712] (-1255.990) -- 0:01:39 Average standard deviation of split frequencies: 0.077340 10500 -- [-1251.784] (-1250.075) (-1245.167) (-1249.816) * (-1252.370) (-1259.660) [-1251.217] (-1254.745) -- 0:01:34 11000 -- (-1251.810) [-1250.624] (-1243.430) (-1253.542) * (-1246.977) [-1248.964] (-1258.445) (-1262.001) -- 0:01:29 11500 -- (-1256.146) (-1252.936) [-1243.630] (-1256.943) * (-1254.414) [-1246.355] (-1249.928) (-1244.840) -- 0:01:25 12000 -- [-1247.918] (-1254.284) (-1241.691) (-1252.146) * [-1249.192] (-1250.574) (-1257.050) (-1243.113) -- 0:01:22 12500 -- [-1247.240] (-1256.383) (-1241.690) (-1257.018) * [-1246.780] (-1251.848) (-1253.967) (-1242.151) -- 0:01:19 13000 -- [-1258.531] (-1250.302) (-1243.581) (-1252.665) * (-1251.521) [-1257.543] (-1248.653) (-1246.391) -- 0:01:15 13500 -- (-1255.706) (-1244.716) (-1243.915) [-1246.122] * (-1260.411) (-1256.005) [-1250.531] (-1245.606) -- 0:01:13 14000 -- [-1252.303] (-1249.065) (-1243.163) (-1255.043) * (-1254.602) [-1248.287] (-1251.726) (-1241.735) -- 0:01:10 14500 -- (-1249.108) [-1255.858] (-1247.728) (-1256.979) * (-1241.603) [-1246.217] (-1251.411) (-1241.895) -- 0:01:07 15000 -- (-1251.142) (-1252.016) (-1244.376) [-1253.157] * (-1242.597) [-1247.520] (-1255.564) (-1242.007) -- 0:01:05 Average standard deviation of split frequencies: 0.079723 15500 -- (-1248.157) (-1257.636) (-1242.385) [-1254.193] * (-1241.350) (-1249.677) (-1246.552) [-1243.004] -- 0:01:03 16000 -- [-1244.576] (-1248.747) (-1240.980) (-1249.631) * (-1242.627) (-1250.093) (-1257.050) [-1242.952] -- 0:01:01 16500 -- (-1249.568) (-1249.735) [-1240.870] (-1248.078) * (-1241.463) [-1261.711] (-1253.321) (-1243.542) -- 0:00:59 17000 -- (-1253.069) [-1257.404] (-1245.691) (-1247.600) * (-1241.936) [-1248.161] (-1255.591) (-1242.965) -- 0:00:57 17500 -- (-1260.345) (-1256.187) (-1244.569) [-1249.127] * (-1241.943) (-1262.669) (-1251.552) [-1244.627] -- 0:00:56 18000 -- (-1252.438) (-1252.299) (-1244.785) [-1253.149] * [-1242.268] (-1249.695) (-1247.627) (-1244.625) -- 0:00:54 18500 -- (-1249.367) (-1254.511) [-1240.977] (-1249.826) * (-1241.669) (-1251.627) [-1249.811] (-1243.317) -- 0:00:53 19000 -- [-1245.373] (-1248.847) (-1240.871) (-1256.109) * [-1240.707] (-1257.175) (-1251.457) (-1241.922) -- 0:00:51 19500 -- (-1253.283) [-1256.793] (-1241.317) (-1251.848) * (-1243.102) (-1256.961) [-1251.041] (-1242.331) -- 0:00:50 20000 -- [-1248.195] (-1253.749) (-1241.358) (-1249.099) * (-1242.477) (-1252.103) [-1248.805] (-1242.851) -- 0:01:38 Average standard deviation of split frequencies: 0.060379 20500 -- (-1254.386) [-1248.552] (-1241.704) (-1248.241) * (-1240.315) (-1253.175) (-1249.815) [-1242.253] -- 0:01:35 21000 -- (-1252.673) (-1252.537) (-1241.325) [-1255.976] * (-1241.586) (-1247.127) [-1249.264] (-1240.890) -- 0:01:33 21500 -- (-1254.280) (-1247.407) [-1242.302] (-1251.933) * [-1242.723] (-1248.419) (-1261.978) (-1241.798) -- 0:01:31 22000 -- (-1256.218) (-1246.829) (-1241.326) [-1249.818] * (-1241.263) (-1247.654) (-1255.003) [-1241.502] -- 0:01:28 22500 -- (-1260.415) (-1248.653) [-1241.232] (-1258.744) * (-1241.256) (-1247.510) [-1252.156] (-1244.312) -- 0:01:26 23000 -- (-1245.524) (-1244.107) (-1243.249) [-1247.578] * (-1243.367) (-1250.316) (-1248.337) [-1243.220] -- 0:01:24 23500 -- (-1250.608) [-1242.019] (-1242.193) (-1263.836) * (-1244.218) (-1252.929) (-1250.751) [-1243.219] -- 0:01:23 24000 -- (-1256.036) [-1242.433] (-1241.417) (-1247.313) * [-1242.105] (-1249.618) (-1250.852) (-1243.019) -- 0:01:21 24500 -- (-1254.522) (-1241.981) [-1244.129] (-1248.238) * (-1242.541) (-1243.248) [-1247.390] (-1243.608) -- 0:01:19 25000 -- (-1253.894) (-1243.070) (-1241.234) [-1250.545] * [-1241.776] (-1245.431) (-1252.289) (-1243.664) -- 0:01:18 Average standard deviation of split frequencies: 0.053569 25500 -- [-1256.086] (-1243.807) (-1240.678) (-1252.478) * [-1242.758] (-1243.546) (-1248.479) (-1241.630) -- 0:01:16 26000 -- (-1258.879) (-1244.937) [-1241.448] (-1247.832) * (-1241.804) (-1246.006) [-1254.098] (-1243.338) -- 0:01:14 26500 -- (-1252.170) [-1241.274] (-1244.010) (-1260.928) * [-1241.659] (-1244.701) (-1251.943) (-1244.435) -- 0:01:13 27000 -- (-1255.487) (-1243.919) (-1246.072) [-1249.961] * (-1241.892) (-1244.482) (-1251.144) [-1245.528] -- 0:01:12 27500 -- (-1262.857) (-1246.106) [-1246.116] (-1252.064) * (-1242.330) (-1243.610) [-1253.160] (-1244.268) -- 0:01:10 28000 -- (-1252.879) (-1243.405) (-1246.570) [-1252.869] * (-1241.815) (-1244.207) (-1250.661) [-1243.882] -- 0:01:09 28500 -- (-1251.287) [-1241.375] (-1245.494) (-1259.684) * (-1242.045) [-1242.989] (-1253.597) (-1243.202) -- 0:01:08 29000 -- [-1247.925] (-1241.305) (-1244.068) (-1256.434) * [-1242.250] (-1240.940) (-1258.379) (-1244.151) -- 0:01:06 29500 -- [-1256.127] (-1242.191) (-1243.264) (-1256.497) * (-1241.028) [-1242.282] (-1253.803) (-1243.261) -- 0:01:05 30000 -- (-1248.410) [-1241.275] (-1241.202) (-1252.126) * [-1240.818] (-1244.964) (-1252.358) (-1244.553) -- 0:01:04 Average standard deviation of split frequencies: 0.054900 30500 -- (-1247.186) (-1242.717) [-1241.049] (-1245.323) * (-1242.106) (-1240.692) (-1255.705) [-1241.835] -- 0:01:03 31000 -- (-1252.174) [-1243.292] (-1240.842) (-1247.585) * (-1240.985) (-1240.507) (-1258.463) [-1242.183] -- 0:01:02 31500 -- (-1256.443) (-1242.496) (-1241.789) [-1246.149] * (-1240.620) (-1241.398) [-1247.339] (-1246.184) -- 0:01:01 32000 -- (-1256.043) (-1245.615) (-1241.744) [-1247.021] * (-1240.369) (-1242.995) [-1255.854] (-1242.039) -- 0:01:00 32500 -- (-1250.938) (-1244.298) (-1244.033) [-1245.609] * (-1244.521) (-1247.493) [-1252.013] (-1243.779) -- 0:00:59 33000 -- (-1247.926) (-1242.665) (-1244.061) [-1247.222] * (-1242.424) [-1244.636] (-1256.547) (-1244.061) -- 0:00:58 33500 -- (-1253.014) (-1246.831) (-1242.835) [-1247.112] * (-1241.761) [-1243.711] (-1251.238) (-1241.914) -- 0:00:57 34000 -- [-1248.930] (-1245.312) (-1246.594) (-1252.189) * (-1242.275) (-1241.774) [-1248.262] (-1242.539) -- 0:01:25 34500 -- (-1255.686) (-1246.204) (-1242.926) [-1246.329] * (-1242.863) (-1241.752) [-1251.002] (-1241.790) -- 0:01:23 35000 -- [-1248.565] (-1244.739) (-1242.972) (-1248.501) * (-1242.832) (-1240.661) (-1253.821) [-1240.612] -- 0:01:22 Average standard deviation of split frequencies: 0.053757 35500 -- (-1252.313) (-1243.979) [-1242.389] (-1256.288) * (-1242.979) (-1242.000) [-1254.540] (-1242.652) -- 0:01:21 36000 -- (-1251.523) (-1245.468) [-1243.532] (-1253.595) * (-1241.966) (-1241.651) (-1250.652) [-1241.869] -- 0:01:20 36500 -- (-1250.438) (-1242.910) (-1243.463) [-1248.529] * (-1241.961) (-1242.111) (-1252.743) [-1242.214] -- 0:01:19 37000 -- (-1251.399) [-1242.085] (-1242.064) (-1254.662) * [-1245.456] (-1242.451) (-1250.826) (-1242.294) -- 0:01:18 37500 -- (-1254.367) (-1241.640) [-1241.168] (-1252.912) * (-1242.505) (-1243.000) [-1249.666] (-1242.049) -- 0:01:17 38000 -- [-1251.084] (-1241.954) (-1242.681) (-1253.950) * (-1248.199) (-1241.222) [-1248.399] (-1241.012) -- 0:01:15 38500 -- (-1247.773) [-1242.793] (-1244.485) (-1258.124) * (-1246.733) (-1241.048) [-1249.508] (-1244.618) -- 0:01:14 39000 -- (-1247.565) (-1246.804) [-1241.187] (-1250.484) * (-1249.740) (-1244.457) [-1246.390] (-1240.560) -- 0:01:13 39500 -- (-1246.955) [-1244.174] (-1240.898) (-1253.400) * (-1241.615) (-1240.831) [-1257.174] (-1240.574) -- 0:01:12 40000 -- [-1248.239] (-1242.654) (-1241.109) (-1256.447) * (-1241.775) [-1243.721] (-1254.225) (-1243.165) -- 0:01:12 Average standard deviation of split frequencies: 0.043148 40500 -- (-1260.309) (-1242.653) (-1243.386) [-1249.612] * [-1244.044] (-1243.913) (-1259.589) (-1243.066) -- 0:01:11 41000 -- [-1249.347] (-1243.947) (-1243.149) (-1250.295) * (-1248.529) (-1243.091) (-1249.086) [-1240.711] -- 0:01:10 41500 -- (-1253.966) [-1243.164] (-1245.128) (-1250.734) * (-1242.796) [-1242.490] (-1245.527) (-1242.782) -- 0:01:09 42000 -- [-1248.819] (-1241.310) (-1245.005) (-1249.623) * [-1242.792] (-1242.763) (-1242.594) (-1243.859) -- 0:01:08 42500 -- (-1254.736) (-1241.955) (-1244.130) [-1249.165] * (-1243.605) (-1243.952) [-1241.830] (-1243.309) -- 0:01:07 43000 -- (-1250.377) (-1241.564) (-1245.017) [-1251.315] * [-1242.630] (-1245.027) (-1241.653) (-1243.519) -- 0:01:06 43500 -- (-1269.248) (-1243.457) [-1242.011] (-1250.472) * (-1242.664) (-1242.059) (-1242.322) [-1243.719] -- 0:01:05 44000 -- (-1250.230) (-1242.445) (-1241.649) [-1249.891] * (-1241.453) [-1242.590] (-1242.606) (-1245.528) -- 0:01:05 44500 -- (-1252.831) (-1245.619) (-1241.301) [-1251.698] * [-1245.040] (-1242.854) (-1244.746) (-1243.171) -- 0:01:04 45000 -- (-1248.477) [-1242.489] (-1243.141) (-1255.048) * (-1244.311) [-1242.614] (-1243.942) (-1247.328) -- 0:01:03 Average standard deviation of split frequencies: 0.038552 45500 -- (-1255.293) (-1242.773) (-1242.012) [-1247.299] * [-1249.241] (-1241.927) (-1244.644) (-1240.565) -- 0:01:02 46000 -- (-1253.568) (-1241.321) [-1241.631] (-1251.743) * (-1246.073) (-1243.632) [-1246.773] (-1241.354) -- 0:01:02 46500 -- (-1254.114) [-1241.056] (-1241.877) (-1255.115) * (-1242.118) (-1243.387) (-1246.263) [-1241.105] -- 0:01:01 47000 -- (-1263.159) [-1242.656] (-1242.675) (-1250.277) * (-1242.081) (-1243.521) (-1250.248) [-1242.886] -- 0:01:00 47500 -- (-1246.657) (-1245.683) (-1242.703) [-1244.325] * (-1243.087) [-1241.976] (-1245.685) (-1242.932) -- 0:01:00 48000 -- [-1245.067] (-1244.106) (-1242.925) (-1245.197) * [-1244.119] (-1243.138) (-1243.496) (-1242.310) -- 0:01:19 48500 -- (-1242.952) [-1242.824] (-1243.458) (-1245.417) * (-1246.016) [-1241.496] (-1241.729) (-1241.860) -- 0:01:18 49000 -- (-1244.150) (-1242.757) [-1242.815] (-1244.111) * (-1247.822) (-1242.166) [-1240.791] (-1242.120) -- 0:01:17 49500 -- [-1244.949] (-1240.849) (-1242.395) (-1240.739) * (-1243.258) (-1243.968) (-1242.115) [-1243.630] -- 0:01:16 50000 -- [-1243.501] (-1242.143) (-1242.028) (-1242.569) * (-1244.015) (-1246.144) (-1242.839) [-1242.541] -- 0:01:16 Average standard deviation of split frequencies: 0.042090 50500 -- (-1242.130) (-1242.144) [-1241.701] (-1241.754) * (-1247.467) (-1244.318) [-1242.783] (-1242.765) -- 0:01:15 51000 -- (-1242.478) (-1241.763) (-1243.248) [-1240.317] * (-1242.994) (-1243.040) [-1242.843] (-1242.201) -- 0:01:14 51500 -- (-1243.875) [-1242.728] (-1244.953) (-1242.726) * (-1247.652) (-1240.749) [-1242.676] (-1241.940) -- 0:01:13 52000 -- (-1240.910) (-1245.491) (-1243.241) [-1240.415] * (-1247.250) [-1243.673] (-1246.111) (-1245.837) -- 0:01:12 52500 -- (-1243.574) (-1242.001) (-1243.097) [-1241.974] * (-1247.697) (-1242.881) [-1243.418] (-1241.679) -- 0:01:12 53000 -- (-1240.294) (-1241.513) (-1243.527) [-1241.285] * [-1241.160] (-1241.894) (-1242.587) (-1243.111) -- 0:01:11 53500 -- [-1240.304] (-1242.959) (-1244.006) (-1241.220) * (-1242.432) (-1244.012) (-1241.749) [-1241.202] -- 0:01:10 54000 -- (-1242.059) (-1243.114) [-1245.096] (-1240.779) * (-1241.108) (-1242.388) (-1243.538) [-1240.848] -- 0:01:10 54500 -- [-1241.890] (-1243.931) (-1245.129) (-1240.520) * (-1241.827) (-1241.809) (-1241.947) [-1240.909] -- 0:01:09 55000 -- (-1241.265) (-1245.579) (-1242.314) [-1240.603] * [-1241.722] (-1243.305) (-1241.263) (-1240.903) -- 0:01:08 Average standard deviation of split frequencies: 0.038883 55500 -- (-1241.160) (-1245.483) [-1241.712] (-1243.789) * (-1243.539) (-1243.941) (-1244.103) [-1241.444] -- 0:01:08 56000 -- (-1245.763) (-1242.046) [-1241.927] (-1240.903) * (-1244.794) (-1243.452) [-1243.974] (-1245.314) -- 0:01:07 56500 -- [-1243.282] (-1244.579) (-1242.976) (-1241.265) * [-1243.670] (-1243.447) (-1241.755) (-1243.384) -- 0:01:06 57000 -- [-1241.838] (-1242.124) (-1242.208) (-1241.366) * (-1241.069) [-1242.783] (-1240.562) (-1245.962) -- 0:01:06 57500 -- [-1243.688] (-1243.446) (-1244.715) (-1241.621) * [-1241.723] (-1241.070) (-1244.808) (-1243.782) -- 0:01:05 58000 -- (-1242.932) (-1242.022) (-1242.134) [-1241.790] * (-1240.872) [-1241.914] (-1242.250) (-1243.007) -- 0:01:04 58500 -- (-1241.474) (-1241.346) [-1241.920] (-1243.392) * (-1241.913) [-1242.904] (-1241.040) (-1244.521) -- 0:01:04 59000 -- (-1244.931) [-1240.771] (-1242.758) (-1241.777) * (-1246.472) (-1241.474) [-1240.915] (-1242.010) -- 0:01:03 59500 -- (-1242.510) (-1242.996) [-1241.589] (-1241.006) * (-1246.691) [-1241.423] (-1240.462) (-1240.396) -- 0:01:03 60000 -- (-1242.694) [-1242.461] (-1245.120) (-1244.935) * (-1246.984) [-1241.902] (-1245.652) (-1241.698) -- 0:01:02 Average standard deviation of split frequencies: 0.037372 60500 -- (-1242.722) (-1244.851) (-1243.430) [-1243.438] * (-1242.585) (-1242.445) [-1241.448] (-1240.968) -- 0:01:02 61000 -- [-1242.646] (-1243.979) (-1242.217) (-1243.502) * (-1244.872) [-1240.976] (-1241.448) (-1242.740) -- 0:01:01 61500 -- [-1243.105] (-1242.221) (-1243.378) (-1246.324) * (-1243.824) [-1241.393] (-1241.594) (-1242.900) -- 0:01:01 62000 -- (-1244.934) [-1242.253] (-1243.388) (-1246.936) * (-1242.846) (-1243.853) (-1243.700) [-1240.932] -- 0:01:00 62500 -- (-1249.384) (-1243.062) [-1241.988] (-1245.255) * (-1242.448) (-1245.692) (-1241.625) [-1240.642] -- 0:01:00 63000 -- (-1243.439) (-1246.076) (-1243.979) [-1244.678] * (-1242.223) (-1246.293) (-1242.372) [-1241.115] -- 0:00:59 63500 -- (-1242.742) [-1242.004] (-1243.412) (-1241.975) * [-1241.731] (-1244.793) (-1242.850) (-1244.853) -- 0:01:13 64000 -- (-1244.176) (-1242.006) [-1242.403] (-1241.914) * (-1243.741) [-1244.603] (-1242.870) (-1243.323) -- 0:01:13 64500 -- (-1241.808) [-1242.533] (-1242.200) (-1242.718) * [-1241.534] (-1244.812) (-1242.791) (-1243.226) -- 0:01:12 65000 -- [-1241.809] (-1242.073) (-1248.343) (-1243.318) * (-1242.085) (-1247.953) [-1241.244] (-1243.738) -- 0:01:11 Average standard deviation of split frequencies: 0.036053 65500 -- [-1243.010] (-1242.131) (-1241.585) (-1243.636) * (-1241.723) [-1242.229] (-1244.326) (-1245.923) -- 0:01:11 66000 -- [-1243.453] (-1241.751) (-1241.264) (-1243.112) * (-1246.490) [-1245.627] (-1243.691) (-1244.504) -- 0:01:10 66500 -- (-1242.933) [-1241.682] (-1241.275) (-1243.686) * (-1243.570) (-1243.051) (-1244.467) [-1242.451] -- 0:01:10 67000 -- (-1243.221) (-1245.903) [-1241.084] (-1241.244) * (-1241.979) (-1247.934) (-1247.834) [-1242.558] -- 0:01:09 67500 -- [-1241.550] (-1243.892) (-1240.679) (-1244.409) * (-1242.776) (-1246.358) (-1243.393) [-1244.257] -- 0:01:09 68000 -- (-1242.688) (-1242.947) [-1241.185] (-1241.748) * (-1244.305) (-1249.874) (-1243.332) [-1243.718] -- 0:01:08 68500 -- (-1241.469) (-1241.051) [-1240.318] (-1241.912) * (-1244.181) (-1245.899) (-1242.890) [-1242.782] -- 0:01:07 69000 -- (-1244.790) [-1244.870] (-1241.373) (-1242.884) * (-1244.041) (-1242.420) [-1240.617] (-1242.559) -- 0:01:07 69500 -- (-1244.068) (-1242.098) [-1240.570] (-1245.916) * (-1244.955) (-1242.482) (-1240.617) [-1244.432] -- 0:01:06 70000 -- (-1243.384) [-1242.304] (-1244.050) (-1242.639) * [-1242.923] (-1242.387) (-1240.617) (-1244.937) -- 0:01:06 Average standard deviation of split frequencies: 0.040343 70500 -- (-1242.090) (-1240.655) [-1243.851] (-1244.254) * (-1243.768) (-1241.971) (-1242.609) [-1245.415] -- 0:01:05 71000 -- (-1242.060) (-1241.521) (-1244.056) [-1242.737] * (-1243.031) (-1241.482) [-1242.820] (-1247.033) -- 0:01:05 71500 -- (-1242.547) [-1242.391] (-1242.968) (-1242.884) * (-1246.774) [-1241.929] (-1240.929) (-1244.520) -- 0:01:04 72000 -- [-1245.891] (-1241.105) (-1242.721) (-1243.483) * (-1241.255) (-1242.057) [-1240.763] (-1243.290) -- 0:01:04 72500 -- (-1243.991) (-1241.019) (-1244.371) [-1244.594] * (-1241.967) [-1242.256] (-1242.028) (-1242.809) -- 0:01:03 73000 -- [-1243.126] (-1240.720) (-1247.227) (-1240.907) * [-1241.504] (-1241.604) (-1242.451) (-1240.728) -- 0:01:03 73500 -- [-1246.083] (-1241.035) (-1245.640) (-1240.318) * [-1241.259] (-1242.222) (-1244.650) (-1241.426) -- 0:01:03 74000 -- (-1242.260) [-1240.903] (-1243.258) (-1241.312) * (-1243.613) (-1242.914) (-1240.619) [-1241.452] -- 0:01:02 74500 -- (-1241.405) [-1242.690] (-1243.894) (-1241.088) * (-1243.204) [-1240.844] (-1246.115) (-1242.361) -- 0:01:02 75000 -- (-1241.017) (-1242.708) (-1244.762) [-1242.239] * (-1240.826) (-1241.787) (-1244.287) [-1241.098] -- 0:01:01 Average standard deviation of split frequencies: 0.035739 75500 -- (-1241.321) [-1242.554] (-1244.471) (-1241.830) * [-1240.920] (-1241.051) (-1243.200) (-1241.109) -- 0:01:01 76000 -- (-1241.769) (-1241.664) (-1244.557) [-1242.604] * [-1241.143] (-1240.579) (-1242.951) (-1241.976) -- 0:01:00 76500 -- (-1243.844) [-1241.456] (-1243.304) (-1243.855) * (-1242.939) [-1242.503] (-1245.902) (-1243.014) -- 0:01:00 77000 -- (-1243.469) [-1242.129] (-1242.895) (-1241.651) * (-1244.072) (-1241.235) (-1244.189) [-1241.564] -- 0:00:59 77500 -- (-1241.456) (-1244.076) (-1242.400) [-1242.620] * (-1244.090) (-1242.575) (-1243.719) [-1243.330] -- 0:00:59 78000 -- (-1241.792) (-1245.308) (-1244.518) [-1241.621] * [-1243.094] (-1242.003) (-1241.451) (-1243.018) -- 0:00:59 78500 -- [-1240.934] (-1240.959) (-1242.253) (-1242.563) * [-1244.477] (-1241.799) (-1241.602) (-1243.258) -- 0:00:58 79000 -- (-1245.621) [-1244.007] (-1242.663) (-1242.190) * (-1244.621) (-1242.773) [-1242.208] (-1244.940) -- 0:00:58 79500 -- (-1243.256) (-1242.771) [-1242.343] (-1243.329) * (-1243.255) (-1241.146) (-1241.396) [-1245.330] -- 0:01:09 80000 -- [-1243.704] (-1244.549) (-1241.574) (-1245.354) * (-1242.536) (-1241.154) (-1243.219) [-1246.017] -- 0:01:09 Average standard deviation of split frequencies: 0.035063 80500 -- [-1244.631] (-1245.311) (-1246.329) (-1246.952) * (-1253.094) [-1241.694] (-1241.894) (-1245.071) -- 0:01:08 81000 -- (-1246.029) (-1241.899) [-1241.703] (-1249.474) * (-1251.614) [-1243.320] (-1241.204) (-1242.282) -- 0:01:08 81500 -- (-1243.728) (-1244.753) (-1245.477) [-1242.001] * (-1244.057) (-1242.163) [-1242.193] (-1241.554) -- 0:01:07 82000 -- (-1245.320) [-1241.641] (-1242.620) (-1242.503) * (-1245.099) (-1244.707) (-1245.927) [-1241.624] -- 0:01:07 82500 -- [-1241.667] (-1241.853) (-1244.014) (-1242.504) * (-1243.945) (-1241.832) (-1246.832) [-1241.604] -- 0:01:06 83000 -- [-1241.562] (-1241.782) (-1242.703) (-1244.253) * (-1244.531) (-1241.832) (-1241.495) [-1242.161] -- 0:01:06 83500 -- (-1241.391) (-1242.814) [-1240.900] (-1243.893) * (-1243.729) (-1242.011) (-1241.210) [-1240.557] -- 0:01:05 84000 -- (-1241.327) (-1244.787) [-1244.062] (-1242.761) * [-1242.867] (-1244.399) (-1241.128) (-1244.145) -- 0:01:05 84500 -- (-1243.065) (-1242.495) [-1243.043] (-1243.476) * [-1243.734] (-1242.438) (-1241.343) (-1242.218) -- 0:01:05 85000 -- [-1241.284] (-1243.057) (-1245.816) (-1242.723) * (-1241.151) [-1242.819] (-1242.737) (-1243.092) -- 0:01:04 Average standard deviation of split frequencies: 0.031584 85500 -- (-1242.505) [-1243.912] (-1246.941) (-1242.387) * (-1243.146) [-1245.072] (-1242.387) (-1241.481) -- 0:01:04 86000 -- (-1244.067) (-1243.504) [-1240.722] (-1242.238) * [-1240.958] (-1242.824) (-1243.198) (-1241.034) -- 0:01:03 86500 -- (-1242.222) [-1241.304] (-1241.507) (-1242.304) * (-1241.685) [-1242.781] (-1241.996) (-1245.018) -- 0:01:03 87000 -- (-1242.420) (-1244.272) (-1248.692) [-1242.501] * (-1241.852) (-1247.360) (-1243.245) [-1243.719] -- 0:01:02 87500 -- [-1244.119] (-1243.061) (-1246.584) (-1240.967) * (-1240.921) (-1243.069) [-1243.757] (-1246.582) -- 0:01:02 88000 -- (-1243.787) (-1243.508) (-1242.930) [-1247.025] * (-1242.859) [-1242.817] (-1249.434) (-1246.961) -- 0:01:02 88500 -- (-1243.957) (-1243.095) (-1243.192) [-1242.150] * [-1240.411] (-1243.749) (-1248.518) (-1244.311) -- 0:01:01 89000 -- (-1242.442) (-1241.493) (-1244.396) [-1241.887] * (-1240.398) (-1244.023) (-1244.867) [-1242.398] -- 0:01:01 89500 -- (-1242.754) [-1246.745] (-1240.863) (-1242.308) * (-1241.651) [-1243.726] (-1245.147) (-1245.660) -- 0:01:01 90000 -- [-1242.602] (-1241.639) (-1245.853) (-1240.347) * (-1241.669) [-1243.475] (-1243.300) (-1242.088) -- 0:01:00 Average standard deviation of split frequencies: 0.027730 90500 -- (-1241.899) (-1241.517) [-1243.771] (-1243.593) * [-1241.029] (-1242.000) (-1244.931) (-1241.963) -- 0:01:00 91000 -- [-1241.272] (-1242.118) (-1244.668) (-1242.416) * (-1242.529) (-1241.198) [-1244.106] (-1244.372) -- 0:00:59 91500 -- (-1245.291) [-1241.223] (-1244.492) (-1244.031) * [-1243.033] (-1241.943) (-1241.410) (-1243.509) -- 0:00:59 92000 -- (-1242.628) (-1247.484) (-1241.886) [-1242.086] * (-1242.117) (-1243.818) [-1241.969] (-1245.907) -- 0:00:59 92500 -- [-1242.633] (-1244.032) (-1241.365) (-1243.303) * (-1241.807) (-1243.462) [-1242.255] (-1244.463) -- 0:00:58 93000 -- (-1241.742) (-1242.018) [-1241.352] (-1243.298) * [-1241.714] (-1243.308) (-1241.251) (-1242.142) -- 0:00:58 93500 -- (-1242.574) (-1244.093) [-1241.379] (-1241.867) * (-1244.718) (-1242.111) [-1240.701] (-1243.214) -- 0:00:58 94000 -- (-1242.557) (-1242.024) [-1242.084] (-1246.333) * (-1245.037) (-1242.532) (-1241.892) [-1241.511] -- 0:01:07 94500 -- (-1241.597) [-1244.328] (-1241.435) (-1243.217) * (-1244.974) (-1244.261) (-1241.811) [-1241.663] -- 0:01:07 95000 -- (-1242.808) (-1243.449) (-1243.349) [-1244.248] * [-1249.591] (-1241.933) (-1242.195) (-1244.937) -- 0:01:06 Average standard deviation of split frequencies: 0.025043 95500 -- (-1241.433) [-1243.218] (-1241.889) (-1241.389) * (-1244.945) [-1242.800] (-1241.078) (-1245.874) -- 0:01:06 96000 -- (-1241.802) (-1240.885) [-1242.407] (-1241.487) * [-1244.015] (-1241.701) (-1241.259) (-1244.310) -- 0:01:05 96500 -- (-1241.856) (-1240.974) (-1244.436) [-1241.368] * [-1244.067] (-1241.368) (-1247.340) (-1245.077) -- 0:01:05 97000 -- (-1242.473) (-1244.268) (-1245.978) [-1241.614] * [-1246.726] (-1241.753) (-1247.700) (-1241.534) -- 0:01:05 97500 -- (-1243.285) (-1243.406) [-1244.214] (-1241.711) * (-1246.192) (-1243.685) (-1242.208) [-1240.715] -- 0:01:04 98000 -- (-1242.631) (-1245.642) (-1248.280) [-1242.646] * [-1245.396] (-1243.159) (-1245.535) (-1240.905) -- 0:01:04 98500 -- (-1243.016) [-1242.220] (-1242.567) (-1243.850) * (-1242.359) [-1242.870] (-1244.033) (-1242.382) -- 0:01:04 99000 -- (-1241.588) (-1242.546) [-1244.186] (-1242.040) * (-1240.798) (-1242.229) (-1243.920) [-1242.609] -- 0:01:03 99500 -- (-1241.304) (-1240.554) [-1242.623] (-1244.247) * [-1240.935] (-1243.096) (-1241.765) (-1242.900) -- 0:01:03 100000 -- [-1243.968] (-1242.256) (-1241.177) (-1242.447) * [-1240.972] (-1243.146) (-1247.123) (-1241.040) -- 0:01:02 Average standard deviation of split frequencies: 0.027111 100500 -- (-1241.755) (-1244.753) [-1242.452] (-1241.755) * (-1248.362) (-1241.721) [-1243.398] (-1241.690) -- 0:01:02 101000 -- (-1245.002) [-1242.382] (-1240.854) (-1241.740) * (-1245.169) [-1242.173] (-1245.426) (-1246.589) -- 0:01:02 101500 -- [-1241.375] (-1241.037) (-1242.572) (-1241.912) * (-1241.885) [-1244.032] (-1242.905) (-1241.513) -- 0:01:01 102000 -- [-1241.764] (-1247.611) (-1242.223) (-1246.803) * [-1241.871] (-1242.532) (-1245.460) (-1241.240) -- 0:01:01 102500 -- (-1242.879) (-1248.489) [-1240.772] (-1243.759) * (-1241.913) [-1243.096] (-1246.319) (-1241.410) -- 0:01:01 103000 -- [-1242.597] (-1247.474) (-1243.865) (-1243.577) * (-1242.973) [-1242.141] (-1249.595) (-1243.833) -- 0:01:00 103500 -- (-1242.437) (-1247.948) (-1241.720) [-1245.343] * [-1244.290] (-1240.616) (-1245.800) (-1243.240) -- 0:01:00 104000 -- (-1244.168) [-1241.621] (-1241.929) (-1241.830) * (-1242.200) (-1240.805) [-1246.029] (-1243.240) -- 0:01:00 104500 -- [-1242.308] (-1242.529) (-1241.880) (-1240.477) * [-1244.782] (-1243.779) (-1245.794) (-1244.541) -- 0:00:59 105000 -- (-1241.053) (-1241.869) [-1243.373] (-1240.883) * [-1242.851] (-1244.296) (-1247.842) (-1242.050) -- 0:00:59 Average standard deviation of split frequencies: 0.025624 105500 -- (-1241.851) [-1241.454] (-1241.924) (-1241.088) * (-1247.207) (-1241.189) [-1243.305] (-1241.080) -- 0:00:59 106000 -- (-1242.503) [-1241.107] (-1242.409) (-1241.088) * [-1244.979] (-1241.489) (-1243.748) (-1241.862) -- 0:00:59 106500 -- [-1243.511] (-1240.716) (-1243.115) (-1242.758) * (-1243.690) (-1242.947) (-1244.301) [-1243.471] -- 0:00:58 107000 -- [-1243.515] (-1243.005) (-1241.484) (-1241.465) * [-1242.431] (-1244.173) (-1242.544) (-1244.651) -- 0:01:06 107500 -- (-1243.850) (-1241.820) (-1241.811) [-1243.963] * (-1243.165) (-1244.921) (-1242.537) [-1241.198] -- 0:01:06 108000 -- (-1246.019) (-1240.708) [-1243.627] (-1243.418) * (-1241.898) (-1248.601) [-1242.346] (-1242.236) -- 0:01:06 108500 -- [-1244.524] (-1242.503) (-1242.043) (-1241.280) * (-1243.222) (-1243.134) (-1241.583) [-1244.522] -- 0:01:05 109000 -- [-1245.025] (-1243.121) (-1245.023) (-1243.293) * (-1244.374) (-1243.236) (-1241.785) [-1241.548] -- 0:01:05 109500 -- (-1246.806) (-1241.260) [-1241.241] (-1245.581) * (-1241.121) (-1246.673) [-1241.769] (-1244.899) -- 0:01:05 110000 -- (-1245.207) [-1241.272] (-1241.111) (-1245.671) * [-1243.626] (-1245.873) (-1242.279) (-1248.231) -- 0:01:04 Average standard deviation of split frequencies: 0.026679 110500 -- (-1245.231) (-1242.984) [-1243.651] (-1245.070) * (-1243.346) (-1246.291) [-1241.678] (-1244.474) -- 0:01:04 111000 -- (-1243.592) [-1243.286] (-1241.427) (-1246.200) * (-1242.740) [-1241.278] (-1240.525) (-1246.308) -- 0:01:04 111500 -- (-1243.417) (-1242.475) [-1241.469] (-1247.725) * (-1247.523) [-1241.279] (-1240.496) (-1246.527) -- 0:01:03 112000 -- (-1241.231) (-1244.733) [-1246.882] (-1245.006) * [-1245.399] (-1249.314) (-1243.699) (-1246.757) -- 0:01:03 112500 -- (-1241.770) (-1243.442) (-1243.566) [-1241.723] * [-1244.819] (-1244.010) (-1243.200) (-1245.190) -- 0:01:03 113000 -- [-1242.005] (-1242.496) (-1241.766) (-1241.879) * (-1244.552) (-1243.533) [-1240.904] (-1243.901) -- 0:01:02 113500 -- (-1246.401) (-1240.750) [-1242.312] (-1242.111) * (-1244.996) [-1243.791] (-1241.079) (-1245.298) -- 0:01:02 114000 -- (-1248.872) (-1241.421) (-1242.030) [-1244.200] * (-1240.987) (-1250.542) (-1244.616) [-1241.910] -- 0:01:02 114500 -- (-1245.008) [-1240.988] (-1241.701) (-1246.223) * (-1241.135) [-1246.815] (-1244.750) (-1246.462) -- 0:01:01 115000 -- (-1243.927) (-1240.988) [-1242.659] (-1244.917) * (-1241.516) [-1243.229] (-1246.369) (-1244.011) -- 0:01:01 Average standard deviation of split frequencies: 0.024157 115500 -- (-1241.170) (-1240.454) [-1240.776] (-1242.858) * (-1241.516) [-1243.520] (-1243.954) (-1241.824) -- 0:01:01 116000 -- (-1240.875) (-1242.520) (-1241.097) [-1241.742] * [-1241.381] (-1241.199) (-1244.603) (-1241.722) -- 0:01:00 116500 -- (-1250.272) (-1242.379) [-1240.965] (-1243.165) * (-1245.043) (-1242.565) [-1243.378] (-1242.500) -- 0:01:00 117000 -- (-1246.527) (-1245.089) (-1241.308) [-1244.060] * (-1242.056) (-1244.982) (-1243.494) [-1243.061] -- 0:01:00 117500 -- (-1247.202) (-1245.089) [-1241.015] (-1244.985) * (-1241.230) [-1245.407] (-1241.495) (-1243.985) -- 0:01:00 118000 -- (-1250.904) [-1246.871] (-1241.422) (-1244.188) * (-1243.745) [-1244.131] (-1241.877) (-1243.126) -- 0:00:59 118500 -- (-1244.449) (-1243.474) [-1245.679] (-1242.572) * (-1242.904) (-1243.109) [-1240.248] (-1242.558) -- 0:00:59 119000 -- (-1250.577) (-1242.910) [-1242.820] (-1243.499) * (-1242.058) (-1241.560) (-1241.550) [-1242.600] -- 0:00:59 119500 -- (-1242.692) (-1243.658) (-1241.408) [-1241.894] * (-1242.925) (-1245.657) [-1243.659] (-1242.724) -- 0:00:58 120000 -- [-1241.495] (-1243.811) (-1240.796) (-1241.494) * (-1242.127) [-1242.786] (-1243.020) (-1243.354) -- 0:00:58 Average standard deviation of split frequencies: 0.024742 120500 -- (-1242.207) (-1243.597) [-1240.799] (-1241.991) * (-1242.426) (-1240.892) [-1242.280] (-1240.699) -- 0:00:58 121000 -- (-1241.667) (-1243.392) (-1240.483) [-1243.430] * (-1241.959) (-1243.408) (-1240.936) [-1242.353] -- 0:00:58 121500 -- [-1241.658] (-1243.295) (-1242.402) (-1242.339) * (-1242.512) (-1247.883) [-1244.678] (-1241.186) -- 0:00:57 122000 -- [-1241.541] (-1242.490) (-1240.780) (-1243.036) * [-1244.077] (-1243.503) (-1241.873) (-1241.045) -- 0:00:57 122500 -- (-1242.316) (-1241.516) (-1241.543) [-1241.978] * (-1248.104) (-1245.484) [-1242.920] (-1242.366) -- 0:01:04 123000 -- [-1241.865] (-1243.297) (-1247.097) (-1241.885) * (-1245.804) (-1245.850) [-1241.027] (-1241.769) -- 0:01:04 123500 -- (-1245.447) (-1244.854) (-1247.065) [-1240.531] * (-1243.215) [-1241.543] (-1242.388) (-1240.675) -- 0:01:03 124000 -- (-1244.893) (-1241.579) (-1241.306) [-1242.544] * (-1241.939) (-1241.555) (-1243.205) [-1241.835] -- 0:01:03 124500 -- [-1243.453] (-1241.691) (-1241.226) (-1243.894) * (-1242.071) [-1241.248] (-1243.358) (-1241.924) -- 0:01:03 125000 -- (-1243.489) (-1244.401) (-1240.891) [-1243.376] * (-1244.847) (-1241.750) [-1243.373] (-1243.296) -- 0:01:03 Average standard deviation of split frequencies: 0.023383 125500 -- [-1245.132] (-1245.274) (-1240.438) (-1242.083) * (-1242.696) (-1241.962) (-1241.961) [-1241.605] -- 0:01:02 126000 -- (-1247.024) [-1245.535] (-1241.232) (-1242.083) * (-1244.538) (-1241.364) [-1244.244] (-1241.774) -- 0:01:02 126500 -- (-1244.494) (-1241.432) (-1241.817) [-1241.166] * (-1244.401) (-1242.663) [-1240.613] (-1244.960) -- 0:01:02 127000 -- (-1243.434) (-1242.474) [-1241.176] (-1241.662) * (-1247.952) (-1244.836) (-1240.337) [-1243.957] -- 0:01:01 127500 -- (-1243.931) [-1243.436] (-1240.889) (-1240.877) * (-1242.225) [-1241.556] (-1240.608) (-1241.700) -- 0:01:01 128000 -- (-1241.504) [-1242.238] (-1244.618) (-1245.524) * (-1243.691) [-1241.667] (-1242.297) (-1241.298) -- 0:01:01 128500 -- (-1241.222) [-1241.350] (-1242.958) (-1242.986) * (-1244.224) [-1242.150] (-1241.702) (-1242.970) -- 0:01:01 129000 -- (-1241.393) [-1243.182] (-1243.768) (-1243.196) * [-1244.173] (-1242.553) (-1244.118) (-1244.710) -- 0:01:00 129500 -- (-1241.271) [-1241.545] (-1244.133) (-1243.061) * (-1242.193) (-1242.873) [-1241.880] (-1243.457) -- 0:01:00 130000 -- [-1240.694] (-1242.739) (-1244.474) (-1241.770) * (-1244.584) (-1241.550) (-1240.768) [-1244.816] -- 0:01:00 Average standard deviation of split frequencies: 0.022785 130500 -- (-1240.953) (-1248.073) (-1243.188) [-1242.082] * (-1244.915) (-1240.912) (-1242.076) [-1242.244] -- 0:00:59 131000 -- (-1242.904) (-1244.095) [-1242.548] (-1246.181) * (-1244.264) (-1243.015) [-1241.496] (-1242.135) -- 0:00:59 131500 -- (-1242.257) [-1244.586] (-1243.084) (-1242.602) * [-1247.621] (-1243.046) (-1241.520) (-1241.448) -- 0:00:59 132000 -- (-1247.355) (-1246.007) [-1241.660] (-1245.466) * (-1248.049) [-1243.164] (-1241.825) (-1241.811) -- 0:00:59 132500 -- (-1247.717) (-1249.117) [-1242.119] (-1244.782) * (-1245.950) [-1243.042] (-1240.955) (-1242.234) -- 0:00:58 133000 -- [-1243.026] (-1242.639) (-1244.043) (-1246.618) * (-1247.729) (-1241.576) (-1242.172) [-1243.011] -- 0:00:58 133500 -- [-1243.231] (-1243.980) (-1242.282) (-1242.320) * (-1247.641) [-1245.178] (-1241.102) (-1242.877) -- 0:00:58 134000 -- (-1241.863) (-1242.070) (-1245.288) [-1245.060] * (-1243.209) (-1244.683) [-1241.808] (-1245.256) -- 0:00:58 134500 -- (-1243.886) [-1244.895] (-1243.671) (-1245.306) * (-1245.038) (-1242.992) [-1242.771] (-1241.785) -- 0:00:57 135000 -- (-1242.029) (-1245.158) [-1245.040] (-1245.930) * (-1243.679) (-1243.030) (-1243.999) [-1244.235] -- 0:00:57 Average standard deviation of split frequencies: 0.023899 135500 -- (-1242.517) (-1242.503) [-1242.708] (-1243.541) * (-1245.618) (-1244.974) [-1241.332] (-1243.160) -- 0:00:57 136000 -- [-1240.965] (-1242.947) (-1241.152) (-1244.317) * (-1244.854) (-1243.851) [-1244.297] (-1244.800) -- 0:00:57 136500 -- (-1246.814) (-1242.367) (-1243.269) [-1242.562] * (-1246.233) (-1242.695) [-1241.547] (-1242.656) -- 0:00:56 137000 -- (-1244.794) (-1245.044) [-1244.388] (-1244.429) * [-1242.821] (-1242.329) (-1242.376) (-1242.882) -- 0:00:56 137500 -- (-1242.950) (-1243.074) [-1242.881] (-1246.058) * (-1243.494) (-1243.447) (-1241.534) [-1241.473] -- 0:00:56 138000 -- [-1241.308] (-1242.466) (-1242.991) (-1243.453) * [-1244.009] (-1242.332) (-1242.328) (-1241.881) -- 0:00:56 138500 -- (-1241.572) (-1243.071) (-1243.171) [-1242.531] * (-1243.172) (-1246.678) [-1242.527] (-1244.485) -- 0:01:02 139000 -- (-1241.987) [-1242.772] (-1244.250) (-1242.767) * (-1242.601) (-1244.244) (-1242.049) [-1242.203] -- 0:01:01 139500 -- (-1244.056) (-1243.269) [-1242.967] (-1244.561) * (-1241.111) (-1241.013) (-1240.831) [-1241.760] -- 0:01:01 140000 -- (-1243.584) [-1245.728] (-1241.751) (-1243.374) * (-1243.475) (-1242.365) (-1241.854) [-1241.274] -- 0:01:01 Average standard deviation of split frequencies: 0.021342 140500 -- (-1243.303) [-1240.896] (-1241.658) (-1241.684) * (-1244.494) (-1244.434) (-1243.426) [-1242.303] -- 0:01:01 141000 -- (-1243.261) (-1241.260) (-1241.708) [-1245.316] * [-1241.216] (-1244.434) (-1244.168) (-1242.983) -- 0:01:00 141500 -- (-1242.410) (-1243.151) (-1243.324) [-1243.870] * (-1243.777) (-1244.651) (-1245.050) [-1242.452] -- 0:01:00 142000 -- (-1243.449) [-1241.846] (-1244.891) (-1247.107) * [-1243.843] (-1244.654) (-1242.170) (-1247.247) -- 0:01:00 142500 -- (-1244.527) [-1241.214] (-1242.273) (-1242.217) * [-1240.560] (-1242.276) (-1245.289) (-1242.754) -- 0:01:00 143000 -- (-1243.687) [-1242.623] (-1241.980) (-1244.873) * (-1242.267) (-1242.230) (-1243.318) [-1242.722] -- 0:00:59 143500 -- (-1241.701) (-1242.931) (-1242.332) [-1243.950] * [-1241.364] (-1242.770) (-1242.824) (-1242.488) -- 0:00:59 144000 -- [-1241.295] (-1247.522) (-1241.300) (-1241.777) * [-1241.526] (-1241.718) (-1243.639) (-1241.447) -- 0:00:59 144500 -- [-1241.355] (-1249.686) (-1242.680) (-1244.817) * (-1246.122) (-1242.732) (-1247.079) [-1243.150] -- 0:00:59 145000 -- (-1242.569) (-1242.655) (-1243.137) [-1243.524] * (-1244.868) (-1240.877) [-1241.751] (-1241.048) -- 0:00:58 Average standard deviation of split frequencies: 0.021922 145500 -- [-1243.033] (-1242.790) (-1241.802) (-1242.506) * (-1242.146) (-1241.161) (-1247.930) [-1241.739] -- 0:00:58 146000 -- [-1241.231] (-1241.399) (-1241.245) (-1241.851) * (-1241.158) (-1241.075) (-1241.551) [-1245.914] -- 0:00:58 146500 -- (-1241.174) (-1240.947) (-1248.608) [-1246.570] * [-1241.975] (-1242.977) (-1240.829) (-1243.237) -- 0:00:58 147000 -- (-1242.502) (-1241.202) (-1242.496) [-1243.453] * (-1242.154) (-1244.272) [-1241.334] (-1244.315) -- 0:00:58 147500 -- (-1241.992) (-1241.144) (-1242.611) [-1243.410] * (-1241.754) (-1243.997) [-1240.781] (-1243.840) -- 0:00:57 148000 -- (-1242.414) [-1241.712] (-1241.544) (-1242.980) * (-1242.859) (-1243.305) (-1241.412) [-1240.867] -- 0:00:57 148500 -- (-1241.213) (-1241.257) (-1241.019) [-1244.292] * (-1246.556) (-1244.210) (-1242.558) [-1242.683] -- 0:00:57 149000 -- [-1242.750] (-1241.979) (-1242.527) (-1242.994) * (-1244.318) (-1245.422) [-1241.854] (-1242.108) -- 0:00:57 149500 -- (-1243.392) (-1241.164) (-1243.066) [-1244.747] * (-1241.948) (-1244.483) (-1241.030) [-1242.278] -- 0:00:56 150000 -- [-1243.122] (-1244.335) (-1243.066) (-1243.686) * (-1243.851) (-1243.331) [-1241.474] (-1243.494) -- 0:00:56 Average standard deviation of split frequencies: 0.021243 150500 -- (-1243.173) (-1243.589) (-1242.776) [-1243.237] * (-1241.161) (-1242.512) (-1243.038) [-1242.039] -- 0:00:56 151000 -- (-1243.610) (-1241.377) [-1243.597] (-1243.212) * [-1243.279] (-1243.784) (-1242.198) (-1242.627) -- 0:00:56 151500 -- (-1244.331) (-1242.195) [-1242.799] (-1243.927) * (-1240.683) (-1244.122) [-1243.085] (-1241.836) -- 0:00:56 152000 -- (-1243.267) (-1244.845) [-1242.270] (-1242.098) * (-1242.840) (-1242.049) [-1242.456] (-1245.306) -- 0:00:55 152500 -- (-1243.036) (-1240.857) (-1240.380) [-1241.651] * [-1243.746] (-1242.562) (-1241.608) (-1242.292) -- 0:00:55 153000 -- (-1244.554) (-1241.240) (-1241.786) [-1240.667] * (-1244.932) (-1243.547) (-1242.101) [-1242.484] -- 0:00:55 153500 -- (-1245.575) [-1240.776] (-1241.093) (-1241.302) * (-1243.921) [-1243.234] (-1242.281) (-1244.823) -- 0:00:55 154000 -- (-1246.261) [-1242.992] (-1242.499) (-1244.746) * (-1243.381) [-1242.989] (-1244.573) (-1248.272) -- 0:00:54 154500 -- (-1244.474) (-1245.711) [-1242.732] (-1245.145) * (-1240.997) (-1241.730) [-1242.053] (-1241.442) -- 0:00:54 155000 -- (-1246.375) (-1242.085) (-1243.727) [-1242.828] * (-1241.414) [-1244.905] (-1242.053) (-1241.998) -- 0:00:59 Average standard deviation of split frequencies: 0.022425 155500 -- (-1245.257) [-1242.691] (-1241.451) (-1244.023) * [-1240.938] (-1248.544) (-1243.276) (-1241.539) -- 0:00:59 156000 -- (-1241.692) (-1242.035) [-1241.260] (-1242.591) * (-1241.890) [-1242.559] (-1242.695) (-1241.368) -- 0:00:59 156500 -- (-1245.818) (-1241.671) (-1244.736) [-1241.094] * (-1243.553) (-1242.617) [-1240.636] (-1244.010) -- 0:00:59 157000 -- (-1247.162) (-1240.747) (-1244.144) [-1241.157] * (-1244.555) [-1242.638] (-1246.368) (-1246.771) -- 0:00:59 157500 -- (-1243.418) (-1240.894) [-1246.655] (-1242.605) * (-1245.038) (-1241.919) [-1244.068] (-1245.292) -- 0:00:58 158000 -- (-1241.460) [-1242.935] (-1241.370) (-1242.605) * [-1240.992] (-1245.434) (-1243.947) (-1246.025) -- 0:00:58 158500 -- (-1242.027) [-1242.540] (-1241.468) (-1241.147) * (-1241.219) [-1243.703] (-1243.337) (-1245.026) -- 0:00:58 159000 -- (-1242.028) (-1242.139) (-1241.840) [-1241.371] * [-1241.704] (-1242.755) (-1246.207) (-1246.185) -- 0:00:58 159500 -- [-1241.819] (-1246.919) (-1242.016) (-1243.051) * (-1242.029) (-1245.105) [-1244.363] (-1244.780) -- 0:00:57 160000 -- (-1242.596) [-1244.829] (-1244.551) (-1249.560) * (-1241.364) (-1241.060) [-1245.822] (-1242.493) -- 0:00:57 Average standard deviation of split frequencies: 0.023318 160500 -- [-1243.684] (-1243.369) (-1245.383) (-1243.713) * (-1242.303) (-1241.901) (-1245.505) [-1241.056] -- 0:00:57 161000 -- (-1240.514) (-1241.306) [-1243.230] (-1243.120) * (-1241.311) (-1244.589) (-1247.453) [-1240.412] -- 0:00:57 161500 -- (-1242.949) (-1241.656) (-1241.080) [-1244.817] * [-1241.447] (-1244.054) (-1243.943) (-1241.479) -- 0:00:57 162000 -- [-1241.742] (-1241.399) (-1241.863) (-1243.914) * [-1241.447] (-1245.776) (-1243.002) (-1241.045) -- 0:00:56 162500 -- (-1241.729) (-1241.930) [-1241.992] (-1248.945) * (-1242.643) (-1241.999) (-1242.077) [-1244.104] -- 0:00:56 163000 -- (-1242.770) (-1244.227) [-1240.820] (-1242.910) * [-1242.758] (-1242.307) (-1243.064) (-1242.621) -- 0:00:56 163500 -- [-1242.940] (-1241.348) (-1240.571) (-1242.334) * [-1241.262] (-1241.581) (-1240.727) (-1240.864) -- 0:00:56 164000 -- (-1242.062) (-1242.708) [-1243.920] (-1243.814) * (-1241.536) [-1240.359] (-1240.705) (-1243.720) -- 0:00:56 164500 -- (-1241.447) (-1242.465) (-1243.363) [-1241.870] * [-1242.980] (-1242.043) (-1241.131) (-1243.148) -- 0:00:55 165000 -- (-1242.144) (-1242.676) [-1241.681] (-1243.730) * (-1245.062) (-1242.844) (-1240.793) [-1241.982] -- 0:00:55 Average standard deviation of split frequencies: 0.023428 165500 -- (-1240.909) (-1244.239) [-1241.900] (-1242.096) * [-1245.824] (-1241.975) (-1245.922) (-1241.833) -- 0:00:55 166000 -- (-1241.303) (-1244.036) [-1242.050] (-1242.701) * [-1245.839] (-1242.547) (-1243.868) (-1241.666) -- 0:00:55 166500 -- [-1241.308] (-1244.052) (-1241.776) (-1243.458) * [-1243.486] (-1244.021) (-1242.625) (-1241.990) -- 0:00:55 167000 -- [-1242.906] (-1245.114) (-1241.673) (-1241.500) * (-1246.754) [-1242.847] (-1251.738) (-1242.067) -- 0:00:54 167500 -- [-1242.031] (-1243.108) (-1241.676) (-1243.282) * (-1240.605) (-1242.246) [-1242.892] (-1241.857) -- 0:00:54 168000 -- (-1241.421) [-1242.455] (-1247.911) (-1243.179) * (-1242.053) (-1243.121) [-1242.521] (-1242.031) -- 0:00:54 168500 -- (-1241.648) [-1243.185] (-1241.835) (-1241.910) * [-1243.470] (-1242.024) (-1241.663) (-1241.176) -- 0:00:54 169000 -- (-1245.720) [-1242.550] (-1243.733) (-1242.555) * (-1243.166) (-1241.835) [-1240.403] (-1241.905) -- 0:00:54 169500 -- [-1245.712] (-1241.471) (-1242.733) (-1244.075) * (-1249.368) (-1242.602) [-1241.348] (-1241.520) -- 0:00:53 170000 -- (-1244.752) (-1245.247) [-1243.943] (-1244.293) * (-1245.370) (-1241.253) [-1241.358] (-1246.183) -- 0:00:53 Average standard deviation of split frequencies: 0.025005 170500 -- (-1242.218) (-1242.155) (-1241.324) [-1244.417] * (-1243.364) (-1241.316) [-1241.432] (-1245.472) -- 0:00:53 171000 -- (-1242.125) (-1242.186) [-1241.776] (-1243.238) * (-1241.553) [-1242.421] (-1241.370) (-1242.934) -- 0:00:58 171500 -- [-1241.868] (-1242.323) (-1245.156) (-1243.648) * (-1241.494) (-1243.857) (-1240.669) [-1245.461] -- 0:00:57 172000 -- (-1241.474) [-1241.787] (-1243.498) (-1242.294) * (-1242.575) [-1243.901] (-1240.633) (-1242.518) -- 0:00:57 172500 -- [-1241.475] (-1244.256) (-1241.256) (-1242.767) * [-1241.169] (-1244.405) (-1242.209) (-1243.135) -- 0:00:57 173000 -- [-1241.093] (-1247.729) (-1242.611) (-1244.962) * (-1243.396) (-1242.123) [-1241.618] (-1242.746) -- 0:00:57 173500 -- [-1240.296] (-1245.174) (-1243.027) (-1242.945) * (-1242.706) (-1243.317) (-1242.836) [-1241.125] -- 0:00:57 174000 -- (-1241.217) [-1241.647] (-1245.473) (-1242.901) * (-1241.831) [-1241.162] (-1246.859) (-1246.007) -- 0:00:56 174500 -- (-1242.174) (-1242.435) [-1243.309] (-1242.945) * (-1243.254) [-1241.048] (-1243.986) (-1242.471) -- 0:00:56 175000 -- (-1241.450) [-1242.629] (-1241.179) (-1242.504) * (-1243.293) (-1241.990) [-1244.754] (-1241.695) -- 0:00:56 Average standard deviation of split frequencies: 0.025516 175500 -- (-1241.470) (-1242.502) (-1241.312) [-1241.497] * [-1241.106] (-1243.892) (-1244.831) (-1242.248) -- 0:00:56 176000 -- (-1242.217) (-1247.358) (-1245.580) [-1241.444] * (-1241.753) (-1245.780) [-1243.264] (-1243.311) -- 0:00:56 176500 -- [-1241.920] (-1243.507) (-1242.489) (-1241.353) * [-1241.282] (-1244.689) (-1243.650) (-1244.436) -- 0:00:55 177000 -- [-1244.163] (-1244.690) (-1242.012) (-1240.846) * (-1243.430) (-1242.786) [-1249.411] (-1243.713) -- 0:00:55 177500 -- (-1245.670) [-1241.412] (-1242.231) (-1242.040) * (-1243.612) [-1243.216] (-1245.688) (-1246.082) -- 0:00:55 178000 -- [-1245.607] (-1241.627) (-1240.639) (-1240.574) * (-1244.374) (-1242.269) (-1240.480) [-1241.536] -- 0:00:55 178500 -- (-1246.496) (-1240.813) (-1242.099) [-1240.753] * (-1244.177) (-1244.245) [-1242.699] (-1241.625) -- 0:00:55 179000 -- (-1246.842) [-1244.637] (-1241.143) (-1240.487) * (-1244.349) (-1242.256) (-1243.777) [-1241.043] -- 0:00:55 179500 -- (-1247.598) [-1246.560] (-1243.759) (-1241.023) * (-1246.672) [-1241.216] (-1242.034) (-1241.470) -- 0:00:54 180000 -- (-1241.831) (-1246.037) [-1241.316] (-1242.152) * (-1242.699) [-1242.362] (-1241.573) (-1243.010) -- 0:00:54 Average standard deviation of split frequencies: 0.023346 180500 -- (-1242.745) [-1241.649] (-1246.707) (-1241.886) * [-1242.492] (-1242.927) (-1244.685) (-1243.885) -- 0:00:54 181000 -- [-1241.350] (-1244.127) (-1245.724) (-1241.664) * (-1244.224) (-1242.083) (-1241.139) [-1241.573] -- 0:00:54 181500 -- [-1241.836] (-1245.073) (-1244.722) (-1244.388) * (-1244.536) [-1242.682] (-1241.102) (-1243.337) -- 0:00:54 182000 -- [-1240.844] (-1245.191) (-1240.576) (-1245.610) * (-1244.348) (-1245.362) [-1241.132] (-1244.949) -- 0:00:53 182500 -- (-1242.100) (-1242.895) [-1242.098] (-1246.934) * [-1241.880] (-1244.584) (-1243.409) (-1251.931) -- 0:00:53 183000 -- [-1248.345] (-1241.137) (-1241.212) (-1244.347) * [-1244.608] (-1243.671) (-1243.247) (-1244.772) -- 0:00:53 183500 -- (-1243.329) (-1241.006) [-1244.080] (-1244.548) * (-1243.681) [-1246.177] (-1244.322) (-1244.038) -- 0:00:53 184000 -- (-1241.326) (-1240.951) (-1243.253) [-1242.788] * (-1244.932) (-1249.817) (-1244.868) [-1241.167] -- 0:00:53 184500 -- (-1243.022) [-1244.446] (-1243.169) (-1245.471) * [-1245.206] (-1244.008) (-1245.252) (-1245.359) -- 0:00:53 185000 -- (-1241.430) (-1243.872) (-1240.913) [-1242.727] * (-1246.962) (-1241.466) (-1241.702) [-1245.780] -- 0:00:52 Average standard deviation of split frequencies: 0.024544 185500 -- (-1240.996) (-1243.376) [-1240.369] (-1245.643) * (-1245.801) [-1243.710] (-1244.396) (-1244.142) -- 0:00:52 186000 -- (-1241.127) [-1241.146] (-1240.760) (-1242.570) * (-1248.754) (-1243.230) (-1246.009) [-1242.612] -- 0:00:56 186500 -- (-1242.234) (-1241.721) [-1240.688] (-1244.118) * (-1244.150) [-1240.863] (-1244.734) (-1242.476) -- 0:00:56 187000 -- (-1242.275) (-1243.532) (-1241.132) [-1242.037] * (-1241.041) (-1242.183) (-1241.419) [-1242.521] -- 0:00:56 187500 -- (-1241.049) [-1240.599] (-1243.161) (-1241.248) * (-1240.785) (-1245.725) (-1244.805) [-1241.317] -- 0:00:56 188000 -- (-1241.265) [-1242.280] (-1240.515) (-1241.841) * (-1241.847) [-1243.135] (-1244.756) (-1243.737) -- 0:00:56 188500 -- (-1241.509) (-1242.318) [-1240.333] (-1242.706) * (-1244.105) (-1253.732) (-1245.560) [-1242.867] -- 0:00:55 189000 -- (-1241.228) (-1241.904) (-1243.664) [-1243.747] * (-1242.837) (-1245.880) (-1243.485) [-1242.141] -- 0:00:55 189500 -- (-1242.336) [-1242.185] (-1240.633) (-1244.096) * (-1244.013) (-1246.040) [-1248.107] (-1241.500) -- 0:00:55 190000 -- [-1241.806] (-1246.524) (-1241.597) (-1243.318) * (-1248.205) (-1243.907) (-1244.953) [-1242.279] -- 0:00:55 Average standard deviation of split frequencies: 0.022642 190500 -- (-1243.966) [-1248.547] (-1248.817) (-1243.684) * (-1245.033) (-1243.438) [-1244.175] (-1242.054) -- 0:00:55 191000 -- (-1243.746) (-1246.672) (-1242.559) [-1241.415] * (-1242.703) (-1240.696) (-1243.518) [-1241.773] -- 0:00:55 191500 -- [-1241.464] (-1243.123) (-1244.608) (-1241.751) * (-1241.753) [-1241.229] (-1244.771) (-1241.064) -- 0:00:54 192000 -- [-1240.911] (-1240.461) (-1246.426) (-1241.920) * (-1241.811) [-1241.604] (-1246.939) (-1241.833) -- 0:00:54 192500 -- [-1240.794] (-1241.477) (-1244.334) (-1243.689) * [-1242.175] (-1242.918) (-1247.445) (-1241.301) -- 0:00:54 193000 -- (-1242.506) (-1241.075) [-1242.925] (-1242.416) * (-1242.616) [-1242.427] (-1242.120) (-1240.873) -- 0:00:54 193500 -- (-1240.911) [-1243.581] (-1245.490) (-1240.617) * (-1241.657) [-1241.626] (-1243.066) (-1240.814) -- 0:00:54 194000 -- (-1241.441) [-1241.249] (-1242.415) (-1240.470) * (-1241.506) (-1243.487) [-1243.107] (-1240.517) -- 0:00:54 194500 -- (-1241.466) [-1240.978] (-1245.854) (-1241.125) * (-1246.312) [-1243.980] (-1244.785) (-1241.245) -- 0:00:53 195000 -- [-1242.063] (-1244.442) (-1247.829) (-1241.573) * (-1248.694) [-1241.071] (-1241.887) (-1241.245) -- 0:00:53 Average standard deviation of split frequencies: 0.024684 195500 -- [-1241.448] (-1241.375) (-1246.202) (-1244.281) * (-1243.801) (-1243.882) [-1241.584] (-1243.964) -- 0:00:53 196000 -- (-1242.560) [-1243.332] (-1243.634) (-1245.579) * (-1244.595) (-1243.593) [-1242.119] (-1242.304) -- 0:00:53 196500 -- (-1245.001) (-1244.008) [-1242.879] (-1241.438) * (-1241.547) [-1244.311] (-1242.351) (-1243.363) -- 0:00:53 197000 -- [-1241.062] (-1245.688) (-1242.022) (-1243.141) * (-1242.924) [-1241.468] (-1243.009) (-1243.510) -- 0:00:52 197500 -- [-1241.555] (-1241.541) (-1242.979) (-1241.236) * (-1243.239) (-1242.489) (-1241.103) [-1240.879] -- 0:00:52 198000 -- (-1242.889) (-1242.133) [-1242.630] (-1240.646) * (-1242.735) (-1246.805) (-1242.063) [-1245.184] -- 0:00:52 198500 -- [-1242.086] (-1241.420) (-1244.333) (-1245.910) * [-1242.281] (-1242.983) (-1244.170) (-1240.841) -- 0:00:52 199000 -- (-1243.059) [-1241.313] (-1241.586) (-1244.915) * (-1242.649) [-1242.301] (-1241.453) (-1241.255) -- 0:00:52 199500 -- (-1241.560) (-1244.396) (-1242.792) [-1244.519] * [-1242.865] (-1241.374) (-1244.578) (-1242.725) -- 0:00:52 200000 -- (-1243.105) [-1243.065] (-1242.668) (-1242.697) * (-1245.648) (-1241.034) (-1243.283) [-1242.799] -- 0:00:51 Average standard deviation of split frequencies: 0.025470 200500 -- (-1244.244) (-1244.401) [-1241.579] (-1245.071) * (-1244.410) (-1244.538) [-1243.652] (-1243.752) -- 0:00:51 201000 -- (-1242.813) [-1243.807] (-1247.093) (-1243.241) * (-1242.275) (-1244.390) [-1243.111] (-1242.617) -- 0:00:51 201500 -- (-1243.649) [-1241.105] (-1243.107) (-1243.470) * (-1242.253) (-1242.513) (-1240.446) [-1241.936] -- 0:00:55 202000 -- (-1245.683) (-1241.400) (-1243.298) [-1244.780] * (-1246.327) (-1241.381) (-1241.507) [-1242.229] -- 0:00:55 202500 -- (-1243.080) (-1241.191) (-1241.609) [-1246.548] * [-1243.497] (-1241.364) (-1242.841) (-1241.347) -- 0:00:55 203000 -- [-1242.694] (-1240.832) (-1244.055) (-1243.993) * (-1244.541) (-1243.590) (-1242.885) [-1240.507] -- 0:00:54 203500 -- (-1241.087) (-1240.862) [-1243.300] (-1243.033) * (-1242.376) (-1242.150) [-1242.077] (-1241.451) -- 0:00:54 204000 -- (-1241.169) (-1241.439) [-1240.608] (-1248.630) * [-1240.670] (-1242.349) (-1242.540) (-1240.891) -- 0:00:54 204500 -- (-1241.547) (-1242.056) (-1240.608) [-1244.664] * (-1240.519) [-1242.402] (-1241.141) (-1241.132) -- 0:00:54 205000 -- [-1242.183] (-1244.831) (-1241.351) (-1242.343) * [-1241.981] (-1242.290) (-1241.722) (-1241.991) -- 0:00:54 Average standard deviation of split frequencies: 0.024931 205500 -- (-1240.876) (-1242.439) (-1241.477) [-1240.920] * [-1241.774] (-1242.615) (-1244.112) (-1241.047) -- 0:00:54 206000 -- [-1242.750] (-1243.470) (-1244.314) (-1240.774) * (-1241.165) (-1242.037) (-1244.429) [-1241.576] -- 0:00:53 206500 -- (-1244.362) (-1241.359) (-1243.518) [-1243.639] * (-1244.659) (-1241.795) (-1243.434) [-1242.472] -- 0:00:53 207000 -- [-1244.062] (-1241.336) (-1242.462) (-1242.818) * (-1245.607) (-1241.448) [-1242.937] (-1251.725) -- 0:00:53 207500 -- [-1241.922] (-1240.819) (-1242.812) (-1241.453) * [-1241.278] (-1240.834) (-1242.554) (-1246.811) -- 0:00:53 208000 -- (-1242.117) [-1240.484] (-1242.247) (-1241.461) * (-1241.266) (-1242.121) (-1246.404) [-1243.792] -- 0:00:53 208500 -- [-1242.455] (-1244.494) (-1244.414) (-1242.147) * (-1241.865) (-1244.560) (-1249.060) [-1245.372] -- 0:00:53 209000 -- (-1242.543) [-1241.669] (-1244.641) (-1242.176) * [-1244.063] (-1242.287) (-1246.720) (-1244.323) -- 0:00:52 209500 -- (-1246.171) (-1242.977) (-1243.338) [-1242.044] * [-1245.810] (-1246.783) (-1242.437) (-1241.189) -- 0:00:52 210000 -- (-1248.360) (-1245.696) [-1241.775] (-1242.034) * (-1242.418) (-1241.445) (-1248.439) [-1242.891] -- 0:00:52 Average standard deviation of split frequencies: 0.024143 210500 -- (-1242.943) (-1242.296) (-1242.200) [-1245.155] * (-1242.757) (-1244.239) [-1243.102] (-1243.405) -- 0:00:52 211000 -- (-1241.604) [-1244.243] (-1241.146) (-1248.568) * (-1242.859) (-1249.203) [-1242.104] (-1243.715) -- 0:00:52 211500 -- (-1247.258) [-1241.814] (-1244.537) (-1248.378) * [-1242.358] (-1243.647) (-1244.783) (-1242.785) -- 0:00:52 212000 -- [-1242.134] (-1243.524) (-1241.427) (-1247.750) * (-1242.469) [-1245.406] (-1243.482) (-1242.874) -- 0:00:52 212500 -- (-1242.117) (-1249.279) (-1241.023) [-1241.040] * [-1242.249] (-1243.181) (-1243.233) (-1242.318) -- 0:00:51 213000 -- (-1242.613) (-1248.613) (-1241.023) [-1241.207] * (-1242.881) [-1242.125] (-1243.610) (-1241.963) -- 0:00:51 213500 -- (-1243.013) (-1241.133) [-1241.025] (-1242.835) * (-1242.979) (-1244.548) [-1243.234] (-1244.159) -- 0:00:51 214000 -- (-1242.111) (-1241.393) (-1241.019) [-1240.913] * (-1244.896) [-1245.320] (-1243.081) (-1241.385) -- 0:00:51 214500 -- (-1241.860) (-1241.409) (-1245.413) [-1240.883] * (-1242.967) (-1243.106) (-1245.402) [-1242.287] -- 0:00:51 215000 -- [-1243.168] (-1242.043) (-1247.774) (-1240.638) * [-1241.923] (-1245.731) (-1246.231) (-1241.181) -- 0:00:51 Average standard deviation of split frequencies: 0.023037 215500 -- (-1246.401) (-1242.812) [-1242.654] (-1240.621) * (-1242.011) (-1243.039) (-1249.329) [-1240.762] -- 0:00:50 216000 -- (-1241.674) [-1241.707] (-1243.607) (-1241.646) * (-1241.677) [-1242.738] (-1245.617) (-1240.762) -- 0:00:50 216500 -- (-1244.551) [-1242.749] (-1241.559) (-1243.033) * [-1243.324] (-1242.397) (-1244.219) (-1241.348) -- 0:00:50 217000 -- (-1247.084) [-1246.442] (-1243.502) (-1241.936) * (-1243.717) [-1243.280] (-1242.246) (-1242.004) -- 0:00:50 217500 -- (-1246.237) (-1242.642) [-1242.422] (-1242.544) * (-1240.985) [-1243.141] (-1242.271) (-1241.395) -- 0:00:50 218000 -- (-1242.050) [-1240.827] (-1247.861) (-1242.040) * (-1241.339) [-1243.169] (-1242.105) (-1242.111) -- 0:00:53 218500 -- (-1242.049) (-1241.276) (-1240.323) [-1243.382] * (-1241.661) (-1242.912) (-1245.924) [-1242.239] -- 0:00:53 219000 -- (-1241.808) [-1243.378] (-1242.352) (-1243.634) * (-1242.229) (-1242.428) (-1246.516) [-1242.967] -- 0:00:53 219500 -- (-1243.071) [-1240.856] (-1242.289) (-1242.784) * [-1243.682] (-1244.858) (-1243.365) (-1240.757) -- 0:00:53 220000 -- (-1245.910) (-1241.968) [-1241.659] (-1242.172) * (-1244.469) (-1242.552) (-1244.093) [-1241.530] -- 0:00:53 Average standard deviation of split frequencies: 0.023625 220500 -- (-1245.478) (-1246.189) (-1243.647) [-1244.136] * (-1244.279) (-1243.219) (-1245.649) [-1244.283] -- 0:00:53 221000 -- (-1247.450) [-1247.848] (-1243.083) (-1242.268) * (-1243.708) [-1241.807] (-1247.405) (-1242.900) -- 0:00:52 221500 -- (-1243.336) (-1246.049) [-1241.447] (-1242.621) * [-1241.386] (-1243.970) (-1247.025) (-1243.826) -- 0:00:52 222000 -- [-1241.070] (-1244.277) (-1243.468) (-1241.685) * [-1240.978] (-1245.635) (-1240.974) (-1242.592) -- 0:00:52 222500 -- (-1244.133) (-1245.641) [-1244.427] (-1241.299) * (-1242.583) (-1249.207) [-1241.447] (-1242.902) -- 0:00:52 223000 -- (-1241.441) (-1245.349) (-1240.577) [-1243.461] * (-1240.726) (-1244.530) [-1241.434] (-1246.740) -- 0:00:52 223500 -- (-1242.970) (-1243.275) [-1241.448] (-1243.207) * (-1242.557) (-1243.818) (-1245.024) [-1246.039] -- 0:00:52 224000 -- (-1243.649) (-1243.802) [-1241.861] (-1242.706) * (-1240.831) (-1244.674) [-1244.433] (-1243.370) -- 0:00:51 224500 -- (-1245.594) (-1243.328) [-1242.242] (-1241.669) * (-1241.833) (-1243.681) (-1244.997) [-1244.430] -- 0:00:51 225000 -- [-1245.863] (-1243.288) (-1240.783) (-1243.256) * (-1241.264) (-1246.569) (-1244.594) [-1243.555] -- 0:00:51 Average standard deviation of split frequencies: 0.023292 225500 -- (-1249.791) (-1243.006) (-1241.179) [-1243.734] * (-1246.444) (-1244.810) (-1243.682) [-1245.110] -- 0:00:51 226000 -- [-1249.545] (-1243.241) (-1241.023) (-1242.556) * (-1244.036) (-1249.173) [-1241.133] (-1247.674) -- 0:00:51 226500 -- (-1244.291) [-1242.989] (-1240.862) (-1242.457) * (-1243.625) [-1245.694] (-1241.985) (-1246.982) -- 0:00:51 227000 -- (-1244.804) [-1243.000] (-1241.806) (-1244.067) * (-1242.455) (-1244.010) (-1243.684) [-1242.861] -- 0:00:51 227500 -- [-1242.642] (-1249.872) (-1241.571) (-1243.755) * (-1242.750) [-1243.181] (-1245.173) (-1246.821) -- 0:00:50 228000 -- [-1245.914] (-1246.605) (-1242.122) (-1242.798) * (-1242.444) [-1243.011] (-1243.005) (-1243.790) -- 0:00:50 228500 -- (-1243.319) (-1241.853) [-1240.824] (-1242.866) * (-1242.913) (-1243.912) (-1244.473) [-1243.673] -- 0:00:50 229000 -- (-1244.651) (-1242.667) (-1250.262) [-1242.142] * [-1242.533] (-1241.095) (-1246.193) (-1245.559) -- 0:00:50 229500 -- (-1244.346) [-1243.417] (-1241.353) (-1241.463) * (-1240.553) (-1242.271) [-1241.632] (-1246.911) -- 0:00:50 230000 -- (-1243.026) [-1245.261] (-1241.351) (-1241.352) * (-1243.414) (-1242.129) (-1242.439) [-1240.684] -- 0:00:50 Average standard deviation of split frequencies: 0.024070 230500 -- (-1241.618) (-1243.400) [-1241.411] (-1242.369) * [-1243.399] (-1244.152) (-1242.786) (-1244.353) -- 0:00:50 231000 -- (-1243.062) [-1241.442] (-1245.492) (-1242.854) * (-1241.229) (-1242.260) (-1246.045) [-1243.575] -- 0:00:49 231500 -- (-1244.335) (-1244.213) (-1241.242) [-1247.419] * (-1243.292) (-1241.897) [-1241.007] (-1242.051) -- 0:00:49 232000 -- (-1242.985) (-1242.722) (-1241.331) [-1241.392] * (-1242.640) [-1242.783] (-1244.475) (-1244.036) -- 0:00:49 232500 -- (-1243.653) (-1242.617) (-1242.960) [-1245.774] * (-1241.542) [-1241.167] (-1243.786) (-1243.599) -- 0:00:49 233000 -- (-1243.809) (-1245.551) [-1243.229] (-1243.168) * (-1241.604) [-1241.885] (-1242.865) (-1241.674) -- 0:00:49 233500 -- [-1242.173] (-1243.156) (-1243.057) (-1242.884) * (-1242.473) (-1241.540) (-1242.504) [-1246.444] -- 0:00:49 234000 -- (-1243.632) (-1244.101) [-1243.843] (-1241.330) * (-1242.046) (-1242.741) [-1242.194] (-1245.243) -- 0:00:52 234500 -- (-1241.200) (-1243.384) (-1242.591) [-1244.748] * [-1243.788] (-1243.962) (-1242.952) (-1242.564) -- 0:00:52 235000 -- [-1242.049] (-1243.583) (-1241.208) (-1245.122) * (-1244.454) [-1244.786] (-1242.308) (-1242.783) -- 0:00:52 Average standard deviation of split frequencies: 0.023970 235500 -- (-1243.907) (-1243.732) [-1244.089] (-1244.089) * [-1242.728] (-1243.362) (-1241.324) (-1244.680) -- 0:00:51 236000 -- [-1241.391] (-1241.925) (-1240.706) (-1245.840) * (-1243.284) (-1242.408) [-1243.514] (-1241.944) -- 0:00:51 236500 -- (-1241.528) (-1244.919) [-1241.819] (-1242.826) * (-1242.475) (-1242.614) [-1243.282] (-1242.916) -- 0:00:51 237000 -- (-1241.521) [-1242.396] (-1241.963) (-1242.375) * (-1245.574) [-1240.738] (-1242.605) (-1243.273) -- 0:00:51 237500 -- [-1242.631] (-1243.653) (-1241.801) (-1242.768) * (-1244.363) [-1242.392] (-1245.160) (-1241.897) -- 0:00:51 238000 -- (-1242.094) [-1241.612] (-1245.256) (-1242.129) * (-1244.319) (-1241.228) [-1241.627] (-1241.051) -- 0:00:51 238500 -- (-1242.269) (-1242.340) (-1245.252) [-1243.523] * (-1243.759) [-1243.698] (-1240.617) (-1241.249) -- 0:00:51 239000 -- (-1243.630) (-1248.969) (-1241.481) [-1243.198] * (-1243.522) (-1242.698) [-1247.850] (-1242.214) -- 0:00:50 239500 -- (-1243.313) (-1244.148) (-1241.463) [-1242.104] * (-1241.210) [-1240.659] (-1250.430) (-1242.449) -- 0:00:50 240000 -- (-1246.172) (-1241.951) (-1241.627) [-1241.655] * [-1242.069] (-1241.220) (-1245.045) (-1245.732) -- 0:00:50 Average standard deviation of split frequencies: 0.023159 240500 -- [-1249.270] (-1241.214) (-1241.474) (-1243.266) * [-1242.478] (-1241.519) (-1245.027) (-1245.239) -- 0:00:50 241000 -- (-1247.999) (-1241.721) (-1244.146) [-1242.333] * (-1246.774) [-1243.477] (-1245.035) (-1244.358) -- 0:00:50 241500 -- (-1245.829) (-1240.926) [-1243.706] (-1243.703) * (-1247.656) [-1241.377] (-1242.140) (-1242.984) -- 0:00:50 242000 -- (-1241.746) (-1245.320) (-1243.581) [-1244.464] * [-1243.279] (-1241.341) (-1241.566) (-1241.898) -- 0:00:50 242500 -- [-1242.108] (-1242.974) (-1240.908) (-1242.935) * [-1245.187] (-1242.999) (-1240.909) (-1241.587) -- 0:00:49 243000 -- [-1241.579] (-1240.889) (-1244.468) (-1240.377) * (-1247.503) (-1246.150) (-1240.562) [-1242.860] -- 0:00:49 243500 -- (-1241.576) (-1242.466) (-1242.613) [-1243.174] * [-1243.183] (-1244.125) (-1241.558) (-1242.100) -- 0:00:49 244000 -- (-1243.027) (-1245.596) (-1244.870) [-1243.530] * (-1241.998) (-1241.484) (-1240.788) [-1242.832] -- 0:00:49 244500 -- (-1241.323) (-1243.057) (-1240.989) [-1242.376] * (-1243.430) [-1241.232] (-1244.347) (-1242.614) -- 0:00:49 245000 -- (-1242.041) [-1244.902] (-1241.331) (-1244.382) * (-1241.092) (-1240.796) (-1244.681) [-1245.778] -- 0:00:49 Average standard deviation of split frequencies: 0.022357 245500 -- (-1243.616) [-1244.892] (-1242.622) (-1243.688) * (-1241.537) (-1241.907) [-1243.981] (-1248.880) -- 0:00:49 246000 -- (-1246.912) (-1241.607) (-1242.364) [-1243.175] * (-1243.329) (-1243.082) [-1242.454] (-1245.412) -- 0:00:49 246500 -- [-1244.839] (-1240.708) (-1241.734) (-1241.369) * (-1243.732) [-1242.643] (-1241.789) (-1243.392) -- 0:00:48 247000 -- [-1244.333] (-1241.916) (-1245.901) (-1241.864) * (-1243.898) [-1244.827] (-1241.369) (-1242.350) -- 0:00:48 247500 -- (-1242.409) [-1241.837] (-1245.427) (-1243.230) * (-1240.537) (-1243.025) [-1245.340] (-1242.305) -- 0:00:48 248000 -- (-1242.917) (-1242.294) (-1245.472) [-1242.101] * (-1244.339) (-1243.023) [-1242.350] (-1243.641) -- 0:00:48 248500 -- (-1241.063) (-1241.530) (-1244.583) [-1241.536] * (-1243.569) (-1241.730) [-1242.325] (-1242.953) -- 0:00:48 249000 -- (-1242.294) (-1241.455) [-1242.835] (-1242.585) * (-1247.483) (-1242.112) (-1241.844) [-1242.410] -- 0:00:48 249500 -- (-1241.083) [-1243.194] (-1243.445) (-1241.991) * (-1245.721) [-1241.384] (-1241.661) (-1243.322) -- 0:00:48 250000 -- (-1244.643) [-1246.409] (-1241.590) (-1241.996) * (-1245.486) (-1241.512) (-1240.836) [-1243.178] -- 0:00:51 Average standard deviation of split frequencies: 0.022149 250500 -- (-1241.792) (-1243.278) [-1243.112] (-1242.079) * [-1243.550] (-1243.387) (-1243.410) (-1248.608) -- 0:00:50 251000 -- [-1241.876] (-1243.202) (-1243.729) (-1240.580) * (-1241.999) [-1244.607] (-1242.225) (-1248.713) -- 0:00:50 251500 -- [-1241.543] (-1242.836) (-1240.976) (-1245.470) * [-1245.257] (-1243.093) (-1241.987) (-1243.244) -- 0:00:50 252000 -- (-1241.168) (-1242.078) [-1242.553] (-1241.923) * (-1242.048) (-1242.882) (-1245.180) [-1244.820] -- 0:00:50 252500 -- [-1241.764] (-1245.293) (-1243.712) (-1241.830) * [-1243.611] (-1242.123) (-1242.463) (-1242.294) -- 0:00:50 253000 -- (-1240.837) [-1244.806] (-1242.295) (-1242.505) * (-1244.694) (-1243.605) (-1241.148) [-1241.186] -- 0:00:50 253500 -- (-1241.252) (-1243.420) [-1247.704] (-1242.315) * (-1243.647) [-1241.772] (-1241.204) (-1242.457) -- 0:00:50 254000 -- (-1242.974) [-1241.496] (-1249.352) (-1245.640) * (-1244.591) [-1245.286] (-1241.065) (-1240.653) -- 0:00:49 254500 -- (-1243.016) (-1240.466) (-1243.552) [-1247.042] * (-1246.054) (-1242.330) [-1241.425] (-1240.619) -- 0:00:49 255000 -- (-1240.523) [-1240.554] (-1241.861) (-1242.177) * [-1251.443] (-1241.984) (-1242.325) (-1240.464) -- 0:00:49 Average standard deviation of split frequencies: 0.021688 255500 -- (-1243.262) (-1242.761) [-1241.464] (-1241.254) * [-1243.455] (-1243.148) (-1242.548) (-1240.592) -- 0:00:49 256000 -- [-1241.051] (-1243.716) (-1246.634) (-1252.010) * (-1242.061) (-1243.390) (-1243.220) [-1240.964] -- 0:00:49 256500 -- (-1241.665) (-1242.901) [-1242.782] (-1245.644) * [-1242.304] (-1251.441) (-1243.133) (-1241.654) -- 0:00:49 257000 -- [-1241.595] (-1244.622) (-1242.995) (-1246.870) * [-1242.765] (-1247.402) (-1247.168) (-1241.586) -- 0:00:49 257500 -- [-1241.056] (-1241.887) (-1241.689) (-1248.533) * [-1241.901] (-1242.650) (-1243.904) (-1241.054) -- 0:00:49 258000 -- [-1240.707] (-1246.214) (-1240.889) (-1246.728) * (-1242.911) (-1243.072) [-1241.054] (-1240.677) -- 0:00:48 258500 -- [-1242.621] (-1246.552) (-1242.686) (-1244.339) * (-1243.558) (-1242.259) [-1240.893] (-1240.814) -- 0:00:48 259000 -- (-1242.787) (-1242.720) [-1240.805] (-1246.883) * (-1243.730) (-1247.825) (-1242.984) [-1241.389] -- 0:00:48 259500 -- (-1244.903) (-1242.227) [-1241.560] (-1245.691) * (-1247.043) (-1246.084) (-1243.001) [-1241.537] -- 0:00:48 260000 -- (-1242.584) (-1247.120) [-1240.983] (-1245.214) * [-1241.104] (-1242.225) (-1243.480) (-1241.963) -- 0:00:48 Average standard deviation of split frequencies: 0.021892 260500 -- (-1244.532) [-1243.776] (-1242.951) (-1242.203) * [-1243.328] (-1244.792) (-1244.480) (-1241.069) -- 0:00:48 261000 -- (-1244.274) [-1241.297] (-1244.291) (-1242.374) * (-1244.871) [-1244.743] (-1243.757) (-1240.467) -- 0:00:48 261500 -- [-1240.973] (-1241.297) (-1241.852) (-1242.265) * (-1243.032) (-1243.297) [-1243.948] (-1240.967) -- 0:00:48 262000 -- [-1240.931] (-1241.156) (-1245.920) (-1241.113) * (-1242.586) (-1241.044) [-1241.911] (-1241.882) -- 0:00:47 262500 -- (-1241.834) (-1241.009) (-1240.920) [-1241.387] * (-1242.361) [-1240.585] (-1250.072) (-1241.157) -- 0:00:47 263000 -- [-1242.176] (-1240.740) (-1241.806) (-1248.630) * (-1242.023) [-1243.110] (-1248.505) (-1244.395) -- 0:00:47 263500 -- (-1241.742) (-1243.788) [-1241.985] (-1246.217) * (-1245.989) [-1243.121] (-1241.749) (-1243.679) -- 0:00:47 264000 -- (-1242.504) [-1241.043] (-1244.704) (-1247.850) * (-1241.851) (-1243.659) [-1242.644] (-1241.437) -- 0:00:47 264500 -- (-1242.598) [-1241.765] (-1244.313) (-1246.516) * (-1244.803) (-1244.364) [-1243.677] (-1243.186) -- 0:00:50 265000 -- (-1240.289) [-1242.155] (-1242.564) (-1243.355) * (-1245.083) [-1242.872] (-1245.774) (-1240.473) -- 0:00:49 Average standard deviation of split frequencies: 0.021919 265500 -- (-1241.970) (-1242.030) (-1243.024) [-1240.403] * (-1243.457) (-1243.332) [-1242.149] (-1241.892) -- 0:00:49 266000 -- (-1241.359) (-1242.825) [-1242.280] (-1244.314) * (-1241.760) (-1243.207) (-1245.168) [-1243.701] -- 0:00:49 266500 -- (-1242.491) (-1243.761) [-1241.187] (-1244.681) * (-1240.994) (-1243.712) (-1244.058) [-1241.807] -- 0:00:49 267000 -- (-1244.083) (-1243.467) (-1242.721) [-1243.990] * (-1243.299) [-1244.761] (-1242.584) (-1242.889) -- 0:00:49 267500 -- [-1243.184] (-1243.887) (-1243.650) (-1241.805) * (-1242.766) (-1241.061) [-1241.212] (-1246.061) -- 0:00:49 268000 -- (-1243.118) [-1243.169] (-1241.191) (-1243.661) * (-1243.997) (-1244.183) [-1243.572] (-1247.753) -- 0:00:49 268500 -- (-1242.802) (-1243.842) [-1242.524] (-1244.805) * [-1243.832] (-1244.623) (-1242.652) (-1242.647) -- 0:00:49 269000 -- (-1242.515) [-1240.857] (-1242.226) (-1241.526) * (-1245.758) (-1242.179) [-1249.137] (-1243.702) -- 0:00:48 269500 -- (-1242.445) (-1241.309) [-1243.630] (-1244.650) * (-1246.978) (-1242.208) [-1244.408] (-1244.008) -- 0:00:48 270000 -- (-1242.149) (-1241.810) [-1245.012] (-1241.059) * [-1245.755] (-1242.862) (-1241.379) (-1241.238) -- 0:00:48 Average standard deviation of split frequencies: 0.021908 270500 -- (-1242.982) [-1245.615] (-1244.620) (-1244.916) * (-1245.659) (-1243.311) (-1241.617) [-1242.392] -- 0:00:48 271000 -- (-1240.781) (-1243.141) (-1242.716) [-1241.374] * (-1244.772) [-1245.576] (-1241.741) (-1246.265) -- 0:00:48 271500 -- (-1240.928) (-1243.452) [-1242.766] (-1242.513) * (-1242.022) (-1245.605) (-1241.104) [-1242.650] -- 0:00:48 272000 -- (-1241.134) (-1244.856) [-1241.825] (-1243.515) * (-1241.541) [-1242.377] (-1243.051) (-1244.252) -- 0:00:48 272500 -- (-1242.004) (-1242.186) (-1242.532) [-1244.185] * (-1241.929) (-1242.779) [-1241.033] (-1242.688) -- 0:00:48 273000 -- [-1241.319] (-1242.451) (-1242.519) (-1240.508) * (-1249.628) (-1243.416) [-1241.447] (-1243.949) -- 0:00:47 273500 -- (-1241.695) (-1242.232) (-1241.273) [-1240.625] * (-1243.302) (-1242.186) (-1241.697) [-1244.187] -- 0:00:47 274000 -- (-1247.552) (-1242.699) (-1240.825) [-1241.917] * (-1242.948) [-1242.619] (-1248.412) (-1242.720) -- 0:00:47 274500 -- [-1242.555] (-1242.700) (-1241.851) (-1242.545) * (-1242.442) (-1240.767) [-1244.717] (-1242.881) -- 0:00:47 275000 -- (-1242.223) [-1243.069] (-1241.740) (-1240.753) * [-1242.223] (-1241.829) (-1244.951) (-1242.409) -- 0:00:47 Average standard deviation of split frequencies: 0.021540 275500 -- [-1244.128] (-1241.671) (-1241.174) (-1241.385) * [-1243.214] (-1241.467) (-1245.056) (-1242.922) -- 0:00:47 276000 -- (-1243.000) [-1247.907] (-1244.285) (-1241.743) * [-1243.870] (-1244.164) (-1242.049) (-1242.153) -- 0:00:47 276500 -- (-1242.703) (-1248.136) [-1249.346] (-1241.789) * [-1246.196] (-1241.359) (-1244.471) (-1243.794) -- 0:00:47 277000 -- [-1241.036] (-1245.282) (-1243.354) (-1241.654) * (-1241.080) [-1242.291] (-1242.016) (-1242.471) -- 0:00:46 277500 -- (-1242.660) (-1246.207) [-1243.559] (-1242.158) * [-1240.560] (-1243.607) (-1245.071) (-1248.628) -- 0:00:46 278000 -- (-1242.862) (-1244.096) (-1242.897) [-1241.802] * (-1242.682) (-1243.151) [-1244.916] (-1245.026) -- 0:00:46 278500 -- (-1244.176) [-1245.993] (-1243.911) (-1243.354) * [-1241.455] (-1241.991) (-1245.738) (-1242.448) -- 0:00:46 279000 -- (-1243.502) (-1244.958) (-1243.265) [-1242.144] * (-1244.023) (-1240.873) [-1243.745] (-1245.916) -- 0:00:46 279500 -- (-1241.579) [-1241.133] (-1240.876) (-1244.590) * (-1243.013) (-1240.486) [-1241.640] (-1243.492) -- 0:00:46 280000 -- (-1242.693) (-1241.339) (-1241.475) [-1244.918] * [-1242.195] (-1243.907) (-1242.267) (-1244.438) -- 0:00:46 Average standard deviation of split frequencies: 0.020342 280500 -- (-1242.752) (-1240.795) (-1241.413) [-1241.650] * (-1242.573) [-1243.148] (-1243.637) (-1241.247) -- 0:00:48 281000 -- (-1241.943) (-1241.415) (-1240.713) [-1244.237] * [-1242.624] (-1242.752) (-1242.860) (-1243.665) -- 0:00:48 281500 -- (-1242.234) (-1242.356) [-1242.923] (-1245.444) * (-1241.313) (-1242.294) (-1244.129) [-1244.253] -- 0:00:48 282000 -- (-1244.037) (-1241.595) (-1242.054) [-1242.129] * (-1243.364) (-1243.596) (-1245.256) [-1242.161] -- 0:00:48 282500 -- (-1244.377) [-1241.444] (-1242.659) (-1242.498) * (-1243.893) (-1241.806) (-1241.207) [-1241.781] -- 0:00:48 283000 -- (-1244.730) (-1241.469) [-1242.389] (-1242.641) * [-1249.356] (-1243.039) (-1241.730) (-1242.515) -- 0:00:48 283500 -- (-1242.416) (-1244.868) [-1242.738] (-1242.322) * (-1245.279) (-1245.253) [-1241.922] (-1247.076) -- 0:00:48 284000 -- (-1240.913) (-1243.215) [-1245.344] (-1244.207) * (-1245.000) (-1242.904) [-1240.709] (-1243.216) -- 0:00:47 284500 -- [-1242.107] (-1241.200) (-1246.701) (-1258.616) * (-1243.360) [-1241.948] (-1241.799) (-1243.062) -- 0:00:47 285000 -- [-1245.545] (-1242.090) (-1246.204) (-1250.159) * (-1243.260) [-1245.751] (-1241.637) (-1244.041) -- 0:00:47 Average standard deviation of split frequencies: 0.020329 285500 -- (-1247.191) [-1242.778] (-1247.977) (-1252.366) * (-1242.931) [-1244.041] (-1243.309) (-1244.621) -- 0:00:47 286000 -- [-1244.206] (-1245.327) (-1245.378) (-1246.197) * [-1242.447] (-1241.017) (-1244.151) (-1249.096) -- 0:00:47 286500 -- (-1242.115) [-1244.885] (-1243.681) (-1244.426) * (-1242.425) [-1241.320] (-1243.087) (-1244.536) -- 0:00:47 287000 -- (-1242.361) [-1246.736] (-1241.153) (-1243.414) * [-1242.235] (-1240.941) (-1242.601) (-1246.909) -- 0:00:47 287500 -- [-1242.131] (-1244.813) (-1240.616) (-1244.895) * (-1245.185) (-1247.119) (-1240.641) [-1244.821] -- 0:00:47 288000 -- (-1241.839) (-1241.101) (-1240.864) [-1243.371] * (-1245.582) (-1244.171) (-1249.713) [-1245.397] -- 0:00:46 288500 -- (-1243.635) (-1245.966) (-1243.788) [-1243.108] * (-1242.174) (-1242.822) (-1245.657) [-1244.315] -- 0:00:46 289000 -- (-1243.799) (-1251.789) [-1244.235] (-1241.546) * (-1241.347) (-1241.285) [-1245.304] (-1245.337) -- 0:00:46 289500 -- [-1241.982] (-1242.881) (-1242.029) (-1250.791) * [-1242.564] (-1242.126) (-1245.755) (-1244.212) -- 0:00:46 290000 -- (-1245.416) [-1242.522] (-1241.699) (-1244.278) * [-1242.294] (-1243.102) (-1242.652) (-1244.315) -- 0:00:46 Average standard deviation of split frequencies: 0.019372 290500 -- (-1243.551) (-1246.151) (-1241.240) [-1242.544] * (-1241.160) (-1241.890) [-1242.273] (-1242.586) -- 0:00:46 291000 -- (-1242.089) [-1242.934] (-1241.645) (-1242.956) * [-1241.079] (-1242.585) (-1242.209) (-1242.614) -- 0:00:46 291500 -- [-1242.451] (-1244.650) (-1242.908) (-1242.357) * [-1241.530] (-1241.940) (-1241.322) (-1241.580) -- 0:00:46 292000 -- (-1241.146) (-1245.841) [-1245.829] (-1242.532) * (-1241.479) (-1241.782) (-1241.107) [-1241.271] -- 0:00:46 292500 -- (-1243.300) [-1244.493] (-1247.109) (-1243.836) * (-1241.347) [-1241.693] (-1242.823) (-1243.733) -- 0:00:45 293000 -- [-1244.258] (-1245.878) (-1245.561) (-1243.762) * (-1241.646) [-1243.290] (-1241.176) (-1241.166) -- 0:00:45 293500 -- [-1241.515] (-1245.222) (-1248.045) (-1241.725) * (-1241.230) [-1243.241] (-1241.195) (-1244.911) -- 0:00:45 294000 -- [-1243.629] (-1243.276) (-1242.557) (-1241.783) * [-1242.023] (-1242.471) (-1243.028) (-1242.755) -- 0:00:45 294500 -- (-1242.068) [-1243.297] (-1243.685) (-1241.542) * [-1241.580] (-1241.248) (-1247.815) (-1246.500) -- 0:00:45 295000 -- (-1241.637) (-1245.236) (-1240.679) [-1241.428] * [-1241.580] (-1242.904) (-1243.506) (-1246.833) -- 0:00:45 Average standard deviation of split frequencies: 0.019996 295500 -- [-1242.784] (-1247.008) (-1241.436) (-1240.973) * (-1242.682) (-1242.174) [-1243.237] (-1242.758) -- 0:00:45 296000 -- (-1243.246) (-1247.224) [-1242.284] (-1243.894) * [-1241.168] (-1243.001) (-1243.740) (-1245.865) -- 0:00:45 296500 -- (-1243.602) (-1251.757) (-1241.445) [-1242.018] * (-1242.603) (-1242.534) [-1244.052] (-1242.455) -- 0:00:45 297000 -- (-1241.390) (-1244.675) [-1241.201] (-1243.173) * (-1241.752) (-1242.281) [-1241.971] (-1242.366) -- 0:00:47 297500 -- (-1240.984) [-1245.718] (-1243.297) (-1243.320) * (-1243.741) [-1242.073] (-1241.595) (-1245.201) -- 0:00:47 298000 -- [-1240.860] (-1240.610) (-1241.589) (-1241.075) * (-1242.931) [-1242.038] (-1242.828) (-1244.219) -- 0:00:47 298500 -- (-1243.103) (-1240.557) (-1241.977) [-1240.730] * (-1241.395) (-1242.489) (-1243.692) [-1245.359] -- 0:00:47 299000 -- [-1244.445] (-1240.738) (-1244.725) (-1240.731) * (-1240.271) [-1241.617] (-1241.696) (-1243.587) -- 0:00:46 299500 -- (-1242.830) (-1248.451) [-1242.059] (-1240.731) * [-1243.036] (-1245.185) (-1242.560) (-1241.505) -- 0:00:46 300000 -- [-1241.530] (-1246.313) (-1242.982) (-1243.062) * (-1240.796) (-1242.116) [-1242.047] (-1244.849) -- 0:00:46 Average standard deviation of split frequencies: 0.019163 300500 -- (-1241.152) (-1246.367) (-1243.890) [-1242.675] * (-1241.750) [-1241.202] (-1241.999) (-1246.489) -- 0:00:46 301000 -- (-1243.404) [-1243.081] (-1242.137) (-1248.354) * [-1241.653] (-1241.004) (-1242.019) (-1241.029) -- 0:00:46 301500 -- (-1241.900) (-1241.523) [-1241.072] (-1246.493) * (-1242.133) (-1244.535) [-1241.660] (-1245.054) -- 0:00:46 302000 -- (-1244.753) (-1244.122) (-1244.525) [-1243.386] * (-1246.351) [-1241.935] (-1241.666) (-1241.022) -- 0:00:46 302500 -- (-1243.518) [-1243.867] (-1249.832) (-1241.833) * [-1243.900] (-1241.435) (-1243.448) (-1242.867) -- 0:00:46 303000 -- (-1242.968) [-1241.612] (-1250.609) (-1243.309) * (-1245.751) [-1242.559] (-1243.399) (-1243.448) -- 0:00:46 303500 -- (-1241.773) [-1241.320] (-1246.505) (-1243.460) * (-1243.171) (-1244.229) [-1241.556] (-1243.741) -- 0:00:45 304000 -- (-1242.112) [-1241.965] (-1241.812) (-1241.744) * (-1241.558) (-1241.073) [-1241.807] (-1243.581) -- 0:00:45 304500 -- (-1241.431) [-1241.442] (-1241.695) (-1240.770) * (-1243.793) (-1241.538) [-1241.488] (-1240.696) -- 0:00:45 305000 -- (-1243.828) (-1241.425) (-1243.935) [-1240.921] * (-1242.750) (-1241.796) (-1242.871) [-1241.002] -- 0:00:45 Average standard deviation of split frequencies: 0.019000 305500 -- (-1243.916) [-1241.443] (-1246.035) (-1241.963) * (-1245.480) (-1245.815) [-1241.140] (-1241.712) -- 0:00:45 306000 -- (-1245.083) [-1242.698] (-1242.802) (-1242.911) * [-1242.032] (-1243.489) (-1242.217) (-1240.766) -- 0:00:45 306500 -- (-1243.962) [-1241.531] (-1241.587) (-1245.124) * (-1246.519) (-1242.611) (-1242.621) [-1241.034] -- 0:00:45 307000 -- (-1249.005) [-1244.578] (-1242.058) (-1244.425) * (-1243.908) [-1241.794] (-1241.794) (-1240.674) -- 0:00:45 307500 -- (-1241.664) (-1243.165) [-1244.216] (-1246.607) * (-1242.803) (-1241.576) (-1242.700) [-1243.252] -- 0:00:45 308000 -- [-1240.655] (-1243.782) (-1243.105) (-1245.493) * [-1243.559] (-1240.919) (-1242.819) (-1245.597) -- 0:00:44 308500 -- (-1242.503) (-1243.452) [-1241.645] (-1242.490) * (-1244.674) (-1242.806) [-1242.420] (-1244.337) -- 0:00:44 309000 -- (-1243.456) (-1245.043) [-1241.171] (-1247.540) * [-1242.632] (-1242.573) (-1243.194) (-1243.063) -- 0:00:44 309500 -- (-1243.668) (-1245.471) (-1244.311) [-1242.151] * (-1243.116) (-1242.809) (-1242.095) [-1242.886] -- 0:00:44 310000 -- [-1243.720] (-1241.481) (-1241.904) (-1241.610) * (-1240.592) (-1241.478) [-1243.060] (-1242.915) -- 0:00:44 Average standard deviation of split frequencies: 0.019191 310500 -- (-1244.421) [-1241.207] (-1248.019) (-1246.428) * (-1242.106) (-1244.399) (-1241.662) [-1246.626] -- 0:00:44 311000 -- (-1242.016) (-1241.461) [-1242.764] (-1241.006) * (-1243.226) [-1243.688] (-1243.564) (-1245.391) -- 0:00:44 311500 -- (-1241.734) (-1241.404) [-1242.217] (-1241.007) * (-1242.750) (-1241.223) [-1245.600] (-1243.878) -- 0:00:44 312000 -- (-1242.463) [-1240.758] (-1242.903) (-1245.487) * (-1243.728) [-1240.793] (-1241.714) (-1244.233) -- 0:00:44 312500 -- (-1244.796) (-1241.542) [-1242.111] (-1243.821) * (-1242.732) (-1242.347) (-1245.983) [-1241.447] -- 0:00:44 313000 -- (-1242.844) [-1241.535] (-1243.237) (-1242.697) * [-1240.957] (-1241.680) (-1242.487) (-1246.011) -- 0:00:46 313500 -- (-1244.796) [-1242.975] (-1246.323) (-1245.594) * [-1241.743] (-1242.487) (-1243.051) (-1242.119) -- 0:00:45 314000 -- (-1247.597) [-1241.984] (-1248.536) (-1245.045) * (-1247.287) [-1243.366] (-1241.203) (-1241.258) -- 0:00:45 314500 -- (-1242.115) [-1241.834] (-1242.581) (-1244.473) * (-1243.107) (-1241.407) (-1241.063) [-1241.888] -- 0:00:45 315000 -- (-1242.033) (-1245.986) [-1243.014] (-1242.647) * (-1242.376) (-1241.026) [-1241.031] (-1244.530) -- 0:00:45 Average standard deviation of split frequencies: 0.017238 315500 -- [-1242.033] (-1242.430) (-1243.582) (-1243.381) * (-1242.456) (-1242.886) [-1244.257] (-1242.184) -- 0:00:45 316000 -- [-1242.460] (-1243.383) (-1242.950) (-1244.478) * (-1243.540) (-1244.083) [-1243.192] (-1241.651) -- 0:00:45 316500 -- (-1244.606) (-1243.859) (-1240.583) [-1241.898] * (-1246.322) [-1242.278] (-1241.951) (-1242.248) -- 0:00:45 317000 -- (-1242.142) (-1244.178) (-1240.608) [-1241.932] * (-1243.312) [-1241.992] (-1240.548) (-1241.712) -- 0:00:45 317500 -- [-1246.408] (-1241.548) (-1240.547) (-1242.871) * (-1242.283) [-1242.129] (-1242.470) (-1242.736) -- 0:00:45 318000 -- (-1242.080) [-1241.840] (-1241.166) (-1245.294) * [-1241.801] (-1242.410) (-1243.110) (-1246.485) -- 0:00:45 318500 -- (-1244.659) (-1242.044) (-1243.916) [-1246.313] * (-1241.464) [-1240.621] (-1243.508) (-1245.000) -- 0:00:44 319000 -- (-1246.651) [-1241.289] (-1242.566) (-1241.446) * [-1241.840] (-1242.907) (-1241.280) (-1242.996) -- 0:00:44 319500 -- (-1243.065) [-1241.629] (-1241.874) (-1242.409) * (-1241.687) [-1241.671] (-1241.279) (-1242.979) -- 0:00:44 320000 -- [-1242.424] (-1243.380) (-1243.056) (-1245.282) * (-1244.611) (-1242.640) [-1242.292] (-1247.264) -- 0:00:44 Average standard deviation of split frequencies: 0.017381 320500 -- (-1241.451) [-1241.626] (-1243.184) (-1243.883) * (-1243.378) [-1242.767] (-1241.656) (-1242.909) -- 0:00:44 321000 -- (-1241.487) [-1240.858] (-1243.628) (-1242.974) * [-1244.072] (-1242.625) (-1241.811) (-1244.268) -- 0:00:44 321500 -- (-1246.472) [-1240.526] (-1242.859) (-1245.427) * (-1244.813) (-1240.970) (-1241.801) [-1242.136] -- 0:00:44 322000 -- (-1244.240) (-1240.357) (-1240.469) [-1241.354] * [-1240.888] (-1240.969) (-1244.225) (-1243.656) -- 0:00:44 322500 -- (-1241.498) (-1242.643) [-1241.947] (-1248.443) * (-1244.073) (-1241.809) [-1241.742] (-1242.820) -- 0:00:44 323000 -- (-1242.157) (-1241.802) (-1241.459) [-1241.509] * [-1242.485] (-1241.653) (-1242.578) (-1243.054) -- 0:00:44 323500 -- (-1241.591) (-1243.794) [-1241.948] (-1242.089) * (-1242.177) (-1242.751) (-1241.077) [-1244.288] -- 0:00:43 324000 -- [-1241.158] (-1241.678) (-1245.202) (-1241.979) * (-1241.939) [-1240.556] (-1241.644) (-1243.917) -- 0:00:43 324500 -- (-1241.009) [-1242.594] (-1243.300) (-1244.405) * (-1244.831) (-1242.866) (-1242.908) [-1243.493] -- 0:00:43 325000 -- [-1242.731] (-1242.146) (-1243.677) (-1247.523) * [-1240.506] (-1242.148) (-1245.141) (-1243.339) -- 0:00:43 Average standard deviation of split frequencies: 0.017513 325500 -- [-1241.732] (-1240.487) (-1241.343) (-1245.193) * [-1240.494] (-1241.699) (-1243.253) (-1246.272) -- 0:00:43 326000 -- (-1243.208) (-1244.678) (-1245.381) [-1244.121] * [-1241.974] (-1243.032) (-1242.154) (-1246.499) -- 0:00:43 326500 -- (-1242.180) (-1242.160) (-1245.623) [-1245.385] * (-1242.807) (-1241.112) (-1242.152) [-1242.271] -- 0:00:43 327000 -- [-1242.197] (-1245.324) (-1242.359) (-1241.752) * (-1241.833) (-1242.254) [-1241.552] (-1241.641) -- 0:00:43 327500 -- (-1241.079) (-1245.328) (-1243.089) [-1242.131] * (-1242.214) (-1243.306) (-1241.419) [-1242.647] -- 0:00:43 328000 -- (-1240.702) (-1247.261) (-1241.092) [-1243.160] * [-1242.028] (-1243.201) (-1243.529) (-1246.069) -- 0:00:43 328500 -- [-1241.368] (-1245.831) (-1241.354) (-1243.903) * (-1240.976) (-1243.028) [-1245.158] (-1242.610) -- 0:00:42 329000 -- [-1246.481] (-1241.827) (-1243.671) (-1243.969) * (-1243.876) [-1241.776] (-1244.854) (-1242.073) -- 0:00:42 329500 -- (-1241.608) (-1241.535) [-1240.505] (-1246.006) * (-1249.966) (-1245.055) (-1244.645) [-1243.550] -- 0:00:44 330000 -- [-1241.467] (-1240.747) (-1241.068) (-1243.387) * (-1244.231) (-1247.154) [-1240.624] (-1241.310) -- 0:00:44 Average standard deviation of split frequencies: 0.016688 330500 -- (-1241.467) [-1243.665] (-1240.939) (-1241.400) * (-1242.432) [-1249.812] (-1245.499) (-1241.351) -- 0:00:44 331000 -- (-1241.491) (-1240.623) [-1241.450] (-1242.121) * (-1241.957) (-1244.271) (-1246.113) [-1243.184] -- 0:00:44 331500 -- [-1246.918] (-1241.290) (-1241.387) (-1244.241) * (-1242.727) (-1244.977) (-1244.738) [-1242.399] -- 0:00:44 332000 -- (-1240.637) (-1241.202) (-1242.195) [-1243.695] * (-1240.386) [-1245.676] (-1241.624) (-1241.477) -- 0:00:44 332500 -- [-1242.264] (-1242.034) (-1246.236) (-1246.562) * (-1242.956) (-1244.621) [-1241.651] (-1241.106) -- 0:00:44 333000 -- (-1242.358) (-1245.158) (-1249.582) [-1242.585] * (-1246.989) (-1249.823) (-1243.520) [-1242.467] -- 0:00:44 333500 -- (-1242.363) (-1243.788) (-1242.331) [-1243.627] * (-1243.814) (-1245.539) [-1243.160] (-1244.270) -- 0:00:43 334000 -- (-1242.319) (-1244.978) (-1242.684) [-1244.182] * [-1242.150] (-1245.766) (-1243.188) (-1243.038) -- 0:00:43 334500 -- (-1241.356) (-1243.167) [-1241.112] (-1242.813) * (-1244.785) [-1243.039] (-1244.377) (-1243.101) -- 0:00:43 335000 -- (-1242.218) (-1243.088) [-1240.727] (-1242.007) * [-1244.231] (-1245.852) (-1242.298) (-1242.869) -- 0:00:43 Average standard deviation of split frequencies: 0.016176 335500 -- (-1245.613) (-1244.049) [-1240.755] (-1242.301) * [-1242.035] (-1252.220) (-1242.251) (-1241.653) -- 0:00:43 336000 -- [-1243.806] (-1244.150) (-1240.783) (-1242.098) * (-1241.734) (-1243.104) (-1240.332) [-1242.791] -- 0:00:43 336500 -- (-1246.188) [-1242.681] (-1242.197) (-1242.098) * (-1242.226) (-1246.055) (-1242.338) [-1242.662] -- 0:00:43 337000 -- (-1244.082) [-1240.953] (-1245.237) (-1241.094) * [-1243.990] (-1244.365) (-1242.437) (-1243.606) -- 0:00:43 337500 -- (-1243.533) (-1242.035) (-1241.496) [-1242.011] * (-1244.447) (-1241.255) (-1241.483) [-1244.506] -- 0:00:43 338000 -- (-1243.349) (-1242.484) (-1246.871) [-1240.893] * [-1244.346] (-1241.968) (-1240.964) (-1243.965) -- 0:00:43 338500 -- (-1242.151) (-1244.256) (-1241.789) [-1240.586] * (-1241.283) [-1244.044] (-1241.590) (-1242.968) -- 0:00:42 339000 -- (-1244.365) (-1246.913) (-1241.224) [-1241.776] * (-1242.111) (-1241.882) (-1242.329) [-1247.589] -- 0:00:42 339500 -- (-1246.964) [-1240.916] (-1243.339) (-1241.614) * (-1241.899) (-1242.980) (-1243.710) [-1241.948] -- 0:00:42 340000 -- (-1245.900) (-1240.654) [-1240.485] (-1243.131) * (-1241.979) (-1242.628) (-1243.646) [-1243.890] -- 0:00:42 Average standard deviation of split frequencies: 0.015221 340500 -- (-1244.027) [-1243.360] (-1244.722) (-1242.631) * (-1241.817) [-1244.794] (-1242.638) (-1242.305) -- 0:00:42 341000 -- (-1244.494) [-1244.810] (-1244.174) (-1242.375) * (-1243.134) (-1242.513) (-1243.426) [-1241.660] -- 0:00:42 341500 -- (-1242.628) (-1245.486) (-1244.566) [-1241.798] * [-1243.264] (-1242.943) (-1244.882) (-1243.529) -- 0:00:42 342000 -- [-1241.106] (-1242.840) (-1242.503) (-1244.272) * [-1240.570] (-1242.035) (-1241.888) (-1242.404) -- 0:00:42 342500 -- (-1240.851) (-1240.533) [-1244.808] (-1243.238) * (-1241.227) [-1242.057] (-1242.681) (-1240.735) -- 0:00:42 343000 -- (-1240.690) (-1242.067) [-1245.308] (-1242.381) * (-1243.189) (-1241.728) [-1241.559] (-1241.863) -- 0:00:42 343500 -- (-1242.152) (-1241.260) [-1241.844] (-1241.093) * (-1242.943) (-1245.219) (-1243.161) [-1240.790] -- 0:00:42 344000 -- (-1241.519) [-1241.459] (-1242.301) (-1241.779) * [-1242.558] (-1245.004) (-1243.389) (-1241.297) -- 0:00:41 344500 -- (-1241.000) (-1242.944) (-1242.558) [-1241.002] * (-1243.078) [-1246.217] (-1242.657) (-1245.989) -- 0:00:41 345000 -- [-1243.321] (-1242.357) (-1243.931) (-1241.904) * (-1244.101) (-1246.599) [-1243.773] (-1243.605) -- 0:00:41 Average standard deviation of split frequencies: 0.016750 345500 -- (-1242.111) (-1242.244) [-1243.543] (-1241.415) * (-1243.296) (-1242.456) [-1242.411] (-1240.939) -- 0:00:43 346000 -- (-1245.925) (-1241.279) (-1242.206) [-1242.018] * (-1247.791) (-1243.165) [-1241.402] (-1243.259) -- 0:00:43 346500 -- [-1242.975] (-1240.567) (-1241.841) (-1241.638) * (-1249.051) (-1244.519) [-1243.441] (-1244.522) -- 0:00:43 347000 -- (-1245.492) (-1243.908) (-1241.965) [-1245.037] * (-1242.001) (-1242.843) [-1241.368] (-1244.189) -- 0:00:43 347500 -- (-1241.807) (-1242.834) (-1241.820) [-1243.942] * (-1241.496) [-1242.872] (-1241.573) (-1242.332) -- 0:00:43 348000 -- (-1245.786) (-1240.658) (-1244.051) [-1242.619] * (-1244.538) (-1242.179) (-1241.285) [-1240.882] -- 0:00:43 348500 -- (-1244.564) [-1242.954] (-1245.289) (-1241.054) * (-1243.895) [-1242.923] (-1241.717) (-1240.809) -- 0:00:42 349000 -- [-1242.501] (-1243.169) (-1242.233) (-1243.275) * [-1242.104] (-1246.785) (-1243.880) (-1242.084) -- 0:00:42 349500 -- (-1242.118) (-1243.773) (-1244.595) [-1241.336] * (-1242.688) [-1245.605] (-1244.079) (-1246.583) -- 0:00:42 350000 -- (-1241.527) (-1243.306) [-1243.354] (-1242.799) * [-1240.838] (-1245.093) (-1243.594) (-1241.883) -- 0:00:42 Average standard deviation of split frequencies: 0.017634 350500 -- (-1241.527) [-1242.005] (-1242.846) (-1242.826) * (-1241.876) (-1250.688) (-1242.797) [-1241.622] -- 0:00:42 351000 -- (-1240.667) [-1243.320] (-1241.421) (-1245.285) * (-1242.475) (-1241.009) [-1241.411] (-1243.760) -- 0:00:42 351500 -- (-1244.734) (-1241.394) [-1243.544] (-1241.191) * (-1241.543) (-1241.209) (-1242.764) [-1243.654] -- 0:00:42 352000 -- (-1244.019) (-1241.396) [-1244.280] (-1247.062) * (-1241.714) (-1241.738) (-1250.250) [-1240.735] -- 0:00:42 352500 -- (-1241.284) (-1242.178) (-1244.023) [-1241.240] * (-1244.500) (-1244.868) (-1244.326) [-1243.652] -- 0:00:42 353000 -- [-1244.158] (-1243.330) (-1243.843) (-1241.760) * (-1242.498) [-1243.510] (-1242.196) (-1241.427) -- 0:00:42 353500 -- [-1242.300] (-1242.169) (-1250.153) (-1243.160) * (-1248.547) (-1243.462) [-1244.428] (-1242.125) -- 0:00:42 354000 -- (-1242.801) (-1240.873) [-1242.944] (-1245.544) * (-1245.431) (-1244.295) [-1244.346] (-1246.460) -- 0:00:41 354500 -- (-1241.723) (-1241.633) (-1241.020) [-1242.795] * (-1242.531) [-1243.624] (-1240.983) (-1246.434) -- 0:00:41 355000 -- [-1241.747] (-1241.354) (-1241.285) (-1242.133) * (-1241.046) (-1245.580) [-1240.641] (-1244.012) -- 0:00:41 Average standard deviation of split frequencies: 0.017214 355500 -- (-1245.613) (-1243.102) (-1240.856) [-1241.148] * [-1240.802] (-1243.683) (-1247.934) (-1242.409) -- 0:00:41 356000 -- (-1243.096) (-1241.189) [-1240.887] (-1241.518) * [-1241.473] (-1245.376) (-1241.897) (-1240.860) -- 0:00:41 356500 -- (-1241.917) [-1241.257] (-1241.742) (-1243.111) * (-1247.523) [-1243.258] (-1241.489) (-1240.741) -- 0:00:41 357000 -- (-1241.900) [-1242.314] (-1242.523) (-1243.294) * [-1241.060] (-1241.650) (-1245.482) (-1242.905) -- 0:00:41 357500 -- (-1243.287) (-1248.408) [-1242.392] (-1242.847) * [-1243.197] (-1244.851) (-1243.254) (-1242.675) -- 0:00:41 358000 -- (-1240.614) [-1244.162] (-1243.150) (-1241.594) * (-1243.230) (-1249.361) (-1241.885) [-1240.524] -- 0:00:41 358500 -- [-1245.142] (-1245.575) (-1243.493) (-1246.995) * (-1242.851) (-1242.094) (-1242.024) [-1242.462] -- 0:00:41 359000 -- [-1242.964] (-1244.091) (-1243.358) (-1241.919) * (-1242.112) (-1245.126) [-1241.462] (-1246.708) -- 0:00:41 359500 -- (-1243.807) (-1241.462) (-1241.444) [-1241.002] * (-1242.007) (-1249.002) (-1244.727) [-1242.869] -- 0:00:40 360000 -- (-1245.816) (-1241.711) [-1240.451] (-1242.321) * (-1248.031) [-1243.234] (-1241.016) (-1242.329) -- 0:00:40 Average standard deviation of split frequencies: 0.015838 360500 -- (-1242.504) [-1241.055] (-1240.996) (-1243.883) * (-1243.306) (-1249.353) (-1242.513) [-1240.774] -- 0:00:40 361000 -- (-1245.855) (-1243.392) (-1242.993) [-1243.630] * (-1241.649) (-1244.598) [-1242.778] (-1240.713) -- 0:00:40 361500 -- (-1241.979) (-1241.456) [-1240.430] (-1241.171) * [-1244.247] (-1240.813) (-1243.811) (-1241.583) -- 0:00:40 362000 -- [-1242.658] (-1242.642) (-1240.669) (-1241.472) * (-1243.106) (-1240.994) (-1241.357) [-1241.378] -- 0:00:42 362500 -- (-1241.477) (-1244.666) [-1241.545] (-1243.842) * [-1241.634] (-1240.913) (-1241.520) (-1241.147) -- 0:00:42 363000 -- (-1240.697) (-1241.462) [-1242.464] (-1243.176) * (-1241.166) [-1241.198] (-1242.633) (-1242.911) -- 0:00:42 363500 -- [-1240.852] (-1240.956) (-1242.698) (-1245.683) * (-1243.201) [-1244.977] (-1242.864) (-1244.496) -- 0:00:42 364000 -- (-1242.116) [-1242.739] (-1246.939) (-1244.960) * [-1241.317] (-1240.644) (-1241.374) (-1242.837) -- 0:00:41 364500 -- (-1242.550) [-1244.745] (-1244.080) (-1246.873) * (-1244.114) [-1240.870] (-1241.250) (-1245.031) -- 0:00:41 365000 -- (-1242.495) [-1240.477] (-1242.490) (-1241.456) * (-1244.180) (-1246.980) [-1240.620] (-1240.444) -- 0:00:41 Average standard deviation of split frequencies: 0.015527 365500 -- (-1241.567) (-1240.963) (-1244.009) [-1244.987] * [-1242.686] (-1246.000) (-1241.796) (-1243.187) -- 0:00:41 366000 -- [-1241.085] (-1241.204) (-1242.446) (-1246.420) * [-1243.466] (-1242.336) (-1242.411) (-1240.470) -- 0:00:41 366500 -- [-1241.680] (-1241.253) (-1243.099) (-1241.747) * [-1241.572] (-1243.430) (-1245.555) (-1244.029) -- 0:00:41 367000 -- (-1242.701) (-1241.930) (-1242.113) [-1242.693] * [-1241.697] (-1243.998) (-1243.219) (-1242.786) -- 0:00:41 367500 -- [-1242.169] (-1241.938) (-1242.169) (-1241.777) * (-1242.027) (-1241.347) (-1243.539) [-1243.965] -- 0:00:41 368000 -- (-1243.038) [-1242.350] (-1242.368) (-1245.599) * (-1243.288) (-1241.333) (-1241.136) [-1243.509] -- 0:00:41 368500 -- [-1241.370] (-1243.383) (-1243.164) (-1242.669) * (-1242.874) [-1240.547] (-1240.846) (-1241.304) -- 0:00:41 369000 -- (-1241.750) [-1241.893] (-1242.888) (-1241.136) * (-1243.953) (-1241.678) (-1241.909) [-1241.298] -- 0:00:41 369500 -- (-1242.272) (-1243.262) (-1241.903) [-1241.816] * (-1243.867) (-1245.618) [-1242.225] (-1242.041) -- 0:00:40 370000 -- (-1243.877) (-1242.585) [-1245.736] (-1247.194) * (-1242.023) (-1243.379) (-1242.221) [-1242.831] -- 0:00:40 Average standard deviation of split frequencies: 0.015060 370500 -- (-1243.847) (-1244.291) [-1240.386] (-1242.575) * (-1243.162) (-1245.552) (-1241.627) [-1241.111] -- 0:00:40 371000 -- (-1242.619) (-1246.280) (-1242.577) [-1243.219] * (-1242.830) [-1241.009] (-1241.560) (-1241.082) -- 0:00:40 371500 -- (-1241.609) (-1242.737) [-1240.851] (-1242.455) * (-1245.329) (-1241.596) [-1242.666] (-1244.477) -- 0:00:40 372000 -- (-1241.868) (-1244.059) (-1241.084) [-1242.486] * [-1240.812] (-1241.352) (-1241.299) (-1244.003) -- 0:00:40 372500 -- (-1242.369) [-1240.504] (-1244.094) (-1244.498) * (-1244.704) (-1240.906) (-1242.106) [-1243.020] -- 0:00:40 373000 -- (-1243.351) (-1243.349) (-1245.414) [-1244.179] * (-1247.566) [-1241.428] (-1246.596) (-1242.417) -- 0:00:40 373500 -- (-1241.961) (-1241.669) (-1244.262) [-1244.908] * (-1242.994) (-1241.017) (-1243.125) [-1243.118] -- 0:00:40 374000 -- (-1244.628) (-1242.514) [-1242.099] (-1242.950) * [-1243.122] (-1242.841) (-1241.595) (-1241.840) -- 0:00:40 374500 -- (-1243.615) (-1244.815) (-1244.294) [-1241.846] * (-1241.790) (-1241.539) [-1241.921] (-1243.529) -- 0:00:40 375000 -- [-1242.958] (-1243.049) (-1243.021) (-1252.122) * [-1241.674] (-1242.646) (-1242.091) (-1243.070) -- 0:00:40 Average standard deviation of split frequencies: 0.014766 375500 -- (-1244.076) [-1242.549] (-1245.378) (-1245.990) * (-1240.819) (-1244.312) (-1242.901) [-1241.977] -- 0:00:39 376000 -- [-1242.022] (-1241.570) (-1243.634) (-1248.280) * (-1243.800) (-1247.576) [-1245.616] (-1242.659) -- 0:00:39 376500 -- (-1244.924) (-1241.960) [-1246.216] (-1247.548) * (-1241.227) [-1243.168] (-1242.917) (-1243.767) -- 0:00:39 377000 -- (-1241.076) (-1241.832) (-1243.657) [-1244.716] * [-1242.462] (-1241.149) (-1247.855) (-1241.335) -- 0:00:39 377500 -- [-1241.145] (-1240.847) (-1243.598) (-1240.589) * (-1246.426) (-1241.315) [-1240.687] (-1240.791) -- 0:00:39 378000 -- [-1241.243] (-1240.808) (-1243.017) (-1240.664) * (-1246.973) [-1241.750] (-1240.772) (-1240.689) -- 0:00:41 378500 -- (-1242.389) (-1241.213) (-1244.063) [-1243.164] * (-1243.768) (-1245.705) [-1240.459] (-1243.746) -- 0:00:41 379000 -- (-1243.192) [-1241.550] (-1242.008) (-1242.701) * (-1242.037) [-1242.828] (-1240.991) (-1244.943) -- 0:00:40 379500 -- (-1242.534) [-1241.504] (-1241.970) (-1241.419) * (-1241.838) (-1242.913) [-1241.865] (-1243.130) -- 0:00:40 380000 -- (-1240.226) (-1240.850) (-1241.194) [-1240.300] * (-1246.217) (-1240.648) (-1240.773) [-1242.851] -- 0:00:40 Average standard deviation of split frequencies: 0.014998 380500 -- (-1242.643) [-1240.762] (-1242.741) (-1240.793) * (-1242.568) [-1241.093] (-1240.934) (-1241.892) -- 0:00:40 381000 -- (-1243.129) (-1240.735) [-1242.367] (-1244.195) * (-1243.245) (-1244.193) [-1241.954] (-1241.110) -- 0:00:40 381500 -- (-1243.608) (-1242.387) (-1244.296) [-1243.394] * (-1244.258) [-1241.869] (-1243.792) (-1240.675) -- 0:00:40 382000 -- (-1242.144) (-1242.894) [-1241.563] (-1243.615) * (-1244.428) (-1243.275) (-1242.902) [-1242.214] -- 0:00:40 382500 -- (-1241.201) (-1245.514) [-1242.141] (-1241.571) * [-1242.263] (-1241.359) (-1242.174) (-1241.101) -- 0:00:40 383000 -- (-1247.404) [-1241.942] (-1240.567) (-1246.973) * (-1242.263) (-1241.797) [-1243.957] (-1243.648) -- 0:00:40 383500 -- [-1241.954] (-1241.884) (-1241.039) (-1246.684) * (-1243.637) (-1242.894) (-1242.580) [-1242.875] -- 0:00:40 384000 -- (-1244.231) (-1241.490) (-1242.092) [-1245.078] * [-1243.446] (-1243.288) (-1242.801) (-1242.799) -- 0:00:40 384500 -- (-1242.812) (-1242.883) [-1240.997] (-1251.986) * (-1241.019) (-1242.014) (-1241.327) [-1243.098] -- 0:00:40 385000 -- (-1245.704) [-1244.686] (-1242.088) (-1240.698) * [-1241.118] (-1241.742) (-1241.269) (-1242.958) -- 0:00:39 Average standard deviation of split frequencies: 0.013884 385500 -- (-1241.099) [-1244.166] (-1248.839) (-1242.995) * (-1240.877) [-1243.399] (-1241.142) (-1248.560) -- 0:00:39 386000 -- (-1241.231) (-1242.405) (-1241.961) [-1243.430] * (-1241.942) [-1243.390] (-1242.076) (-1245.395) -- 0:00:39 386500 -- (-1242.403) (-1241.246) (-1241.590) [-1242.075] * (-1241.684) (-1247.200) (-1242.132) [-1242.380] -- 0:00:39 387000 -- (-1243.316) [-1241.173] (-1242.522) (-1246.106) * (-1244.100) (-1245.361) [-1240.969] (-1242.236) -- 0:00:39 387500 -- (-1244.067) (-1242.541) [-1242.076] (-1243.517) * (-1243.084) [-1245.032] (-1243.776) (-1243.476) -- 0:00:39 388000 -- (-1243.216) (-1240.630) [-1245.463] (-1247.698) * (-1246.115) [-1240.948] (-1243.972) (-1242.522) -- 0:00:39 388500 -- (-1243.259) [-1241.079] (-1244.381) (-1243.323) * (-1242.394) (-1242.514) (-1247.236) [-1241.426] -- 0:00:39 389000 -- (-1241.218) (-1241.135) (-1243.027) [-1243.580] * (-1240.776) (-1247.038) [-1243.834] (-1242.526) -- 0:00:39 389500 -- (-1240.991) (-1240.956) (-1241.366) [-1242.687] * (-1244.495) [-1242.838] (-1244.389) (-1241.788) -- 0:00:39 390000 -- (-1240.940) [-1242.755] (-1242.288) (-1243.450) * [-1243.279] (-1244.235) (-1241.841) (-1242.989) -- 0:00:39 Average standard deviation of split frequencies: 0.014480 390500 -- (-1243.158) [-1241.004] (-1244.562) (-1242.308) * (-1242.112) [-1241.013] (-1244.308) (-1245.536) -- 0:00:39 391000 -- (-1241.858) (-1243.787) [-1247.471] (-1245.728) * (-1243.382) [-1242.181] (-1241.711) (-1241.494) -- 0:00:38 391500 -- (-1244.253) (-1240.885) [-1243.460] (-1245.772) * (-1244.173) (-1244.448) [-1241.405] (-1242.195) -- 0:00:38 392000 -- [-1244.844] (-1240.906) (-1243.733) (-1242.124) * (-1242.478) [-1242.826] (-1242.408) (-1241.210) -- 0:00:38 392500 -- (-1241.945) (-1241.187) [-1243.784] (-1241.973) * [-1242.719] (-1244.704) (-1244.791) (-1242.522) -- 0:00:38 393000 -- (-1242.909) (-1244.105) [-1243.173] (-1242.128) * (-1244.807) (-1244.636) [-1243.002] (-1242.376) -- 0:00:38 393500 -- (-1247.570) (-1240.775) [-1242.143] (-1244.626) * [-1243.708] (-1244.105) (-1251.817) (-1246.105) -- 0:00:38 394000 -- (-1243.569) [-1240.581] (-1242.483) (-1241.963) * (-1241.953) [-1242.984] (-1241.342) (-1245.387) -- 0:00:38 394500 -- (-1241.044) (-1245.732) [-1244.406] (-1242.644) * [-1242.393] (-1245.792) (-1245.962) (-1243.816) -- 0:00:39 395000 -- (-1240.359) (-1246.896) [-1244.108] (-1241.828) * (-1245.177) [-1244.686] (-1241.147) (-1240.583) -- 0:00:39 Average standard deviation of split frequencies: 0.014814 395500 -- (-1240.359) [-1242.703] (-1240.355) (-1240.581) * [-1243.678] (-1244.911) (-1242.806) (-1241.237) -- 0:00:39 396000 -- [-1242.283] (-1245.272) (-1240.360) (-1242.984) * (-1242.143) [-1244.211] (-1241.251) (-1240.346) -- 0:00:39 396500 -- (-1242.848) (-1240.378) [-1240.818] (-1242.140) * (-1242.084) (-1244.305) [-1241.451] (-1245.349) -- 0:00:39 397000 -- (-1242.927) (-1240.838) [-1244.525] (-1241.177) * (-1242.235) (-1242.090) (-1243.316) [-1241.047] -- 0:00:39 397500 -- (-1243.396) [-1240.353] (-1244.995) (-1242.192) * (-1243.844) [-1241.673] (-1242.454) (-1242.057) -- 0:00:39 398000 -- (-1240.733) (-1240.353) (-1244.255) [-1242.250] * (-1244.146) (-1242.124) [-1240.968] (-1241.039) -- 0:00:39 398500 -- (-1240.744) (-1241.340) (-1241.349) [-1241.609] * (-1243.534) (-1241.121) (-1241.631) [-1241.447] -- 0:00:39 399000 -- [-1243.509] (-1240.890) (-1242.279) (-1243.065) * (-1242.850) [-1243.905] (-1241.851) (-1241.149) -- 0:00:39 399500 -- (-1247.702) (-1243.795) [-1242.848] (-1241.149) * (-1246.097) (-1244.844) [-1241.640] (-1241.244) -- 0:00:39 400000 -- (-1244.666) (-1244.117) (-1242.550) [-1242.097] * (-1246.798) (-1241.525) [-1240.454] (-1243.233) -- 0:00:39 Average standard deviation of split frequencies: 0.015230 400500 -- [-1245.494] (-1246.858) (-1242.650) (-1241.359) * [-1245.110] (-1240.776) (-1243.172) (-1242.244) -- 0:00:38 401000 -- (-1243.655) (-1248.105) (-1244.661) [-1242.165] * (-1240.932) (-1240.943) [-1245.352] (-1245.214) -- 0:00:38 401500 -- [-1243.374] (-1242.579) (-1243.075) (-1240.854) * (-1242.631) [-1241.961] (-1244.471) (-1243.059) -- 0:00:38 402000 -- (-1247.546) (-1241.219) (-1246.810) [-1240.664] * (-1246.753) [-1242.091] (-1242.780) (-1240.849) -- 0:00:38 402500 -- (-1244.807) (-1242.327) [-1241.464] (-1240.859) * [-1243.103] (-1244.717) (-1241.168) (-1241.461) -- 0:00:38 403000 -- (-1246.557) (-1242.860) [-1244.834] (-1241.231) * (-1242.999) [-1241.691] (-1242.592) (-1242.828) -- 0:00:38 403500 -- (-1244.149) (-1245.892) [-1246.387] (-1241.168) * (-1242.392) (-1243.180) [-1243.540] (-1240.638) -- 0:00:38 404000 -- [-1242.918] (-1242.421) (-1242.393) (-1240.396) * [-1241.201] (-1243.184) (-1245.007) (-1241.188) -- 0:00:38 404500 -- (-1244.042) (-1240.491) (-1242.051) [-1241.279] * [-1241.800] (-1241.116) (-1243.442) (-1241.770) -- 0:00:38 405000 -- (-1243.819) (-1240.942) [-1241.589] (-1242.604) * (-1240.679) [-1241.215] (-1242.572) (-1242.856) -- 0:00:38 Average standard deviation of split frequencies: 0.015997 405500 -- (-1242.856) [-1242.167] (-1247.935) (-1245.359) * [-1241.169] (-1243.183) (-1242.342) (-1242.035) -- 0:00:38 406000 -- (-1245.255) (-1241.714) (-1245.956) [-1242.667] * [-1242.416] (-1242.484) (-1243.664) (-1243.454) -- 0:00:38 406500 -- (-1243.261) [-1242.927] (-1249.755) (-1240.757) * [-1243.646] (-1241.129) (-1244.553) (-1247.294) -- 0:00:37 407000 -- (-1243.781) (-1240.817) (-1251.707) [-1240.904] * (-1240.884) [-1241.902] (-1242.365) (-1244.669) -- 0:00:37 407500 -- [-1242.778] (-1247.781) (-1257.002) (-1242.199) * [-1240.801] (-1247.660) (-1243.651) (-1243.758) -- 0:00:37 408000 -- (-1243.172) (-1244.086) [-1246.376] (-1242.249) * [-1243.523] (-1248.025) (-1244.565) (-1242.726) -- 0:00:37 408500 -- (-1241.795) (-1244.445) [-1244.257] (-1244.027) * (-1241.784) (-1242.662) [-1242.166] (-1245.735) -- 0:00:37 409000 -- (-1241.312) [-1245.141] (-1244.419) (-1241.274) * [-1243.536] (-1246.609) (-1243.038) (-1241.871) -- 0:00:37 409500 -- [-1241.562] (-1244.559) (-1242.523) (-1241.733) * (-1245.256) (-1246.694) [-1246.496] (-1241.281) -- 0:00:37 410000 -- (-1242.301) (-1243.441) (-1243.032) [-1240.939] * (-1245.156) [-1240.968] (-1241.519) (-1241.180) -- 0:00:37 Average standard deviation of split frequencies: 0.014604 410500 -- (-1242.703) (-1241.882) (-1242.895) [-1241.371] * (-1241.129) (-1240.839) (-1244.769) [-1241.697] -- 0:00:38 411000 -- (-1244.067) [-1244.190] (-1242.044) (-1241.416) * (-1241.598) (-1241.529) [-1243.584] (-1243.494) -- 0:00:38 411500 -- (-1241.289) (-1245.479) (-1242.758) [-1240.990] * [-1241.695] (-1240.708) (-1246.824) (-1244.898) -- 0:00:38 412000 -- (-1241.290) (-1243.572) (-1242.285) [-1240.973] * (-1244.570) (-1242.828) [-1245.387] (-1242.565) -- 0:00:38 412500 -- [-1241.565] (-1244.985) (-1242.592) (-1243.411) * (-1243.090) (-1242.239) [-1244.721] (-1241.667) -- 0:00:38 413000 -- (-1243.171) (-1245.604) [-1243.789] (-1242.254) * (-1245.591) (-1242.669) [-1243.326] (-1241.725) -- 0:00:38 413500 -- (-1246.000) (-1245.168) (-1241.792) [-1242.247] * (-1240.709) (-1240.899) [-1242.105] (-1248.503) -- 0:00:38 414000 -- (-1242.899) (-1241.655) [-1241.310] (-1242.393) * [-1241.990] (-1241.330) (-1241.289) (-1241.389) -- 0:00:38 414500 -- [-1241.162] (-1242.438) (-1241.957) (-1243.261) * [-1240.684] (-1242.018) (-1241.639) (-1244.559) -- 0:00:38 415000 -- (-1242.611) [-1245.461] (-1243.580) (-1241.332) * [-1242.090] (-1243.868) (-1243.861) (-1247.502) -- 0:00:38 Average standard deviation of split frequencies: 0.014417 415500 -- (-1245.957) (-1244.955) [-1241.954] (-1243.442) * (-1242.261) (-1247.586) [-1241.457] (-1251.773) -- 0:00:37 416000 -- (-1243.197) (-1246.536) [-1243.257] (-1240.864) * (-1244.514) (-1245.690) [-1242.380] (-1249.194) -- 0:00:37 416500 -- (-1242.629) (-1243.671) (-1241.236) [-1241.579] * (-1242.147) (-1251.265) (-1241.921) [-1242.677] -- 0:00:37 417000 -- [-1242.580] (-1241.305) (-1240.729) (-1241.286) * [-1241.933] (-1249.373) (-1242.815) (-1241.334) -- 0:00:37 417500 -- [-1243.253] (-1241.644) (-1240.878) (-1241.117) * (-1245.163) (-1245.989) (-1241.157) [-1242.026] -- 0:00:37 418000 -- (-1242.709) (-1245.919) (-1241.479) [-1241.233] * (-1240.635) (-1242.538) [-1242.552] (-1241.447) -- 0:00:37 418500 -- (-1243.646) (-1244.677) [-1241.728] (-1241.533) * (-1240.630) (-1242.570) [-1242.989] (-1242.418) -- 0:00:37 419000 -- (-1243.149) (-1243.186) [-1242.650] (-1242.963) * [-1240.561] (-1240.786) (-1241.000) (-1241.079) -- 0:00:37 419500 -- (-1243.075) (-1242.855) [-1244.349] (-1241.861) * (-1241.291) (-1242.730) [-1241.090] (-1240.947) -- 0:00:37 420000 -- [-1243.920] (-1246.156) (-1244.364) (-1241.690) * (-1241.499) (-1243.139) (-1241.387) [-1242.276] -- 0:00:37 Average standard deviation of split frequencies: 0.014132 420500 -- (-1241.235) (-1245.524) [-1242.772] (-1241.642) * (-1243.221) [-1246.269] (-1243.969) (-1242.494) -- 0:00:37 421000 -- (-1244.333) (-1242.915) [-1242.316] (-1241.396) * (-1243.651) (-1241.326) [-1245.841] (-1241.906) -- 0:00:37 421500 -- (-1242.109) (-1241.304) [-1244.273] (-1241.850) * [-1242.973] (-1243.786) (-1247.528) (-1241.920) -- 0:00:37 422000 -- [-1241.777] (-1241.330) (-1242.558) (-1241.159) * (-1245.214) (-1244.507) (-1242.244) [-1243.882] -- 0:00:36 422500 -- [-1241.201] (-1241.147) (-1247.390) (-1241.900) * (-1242.498) [-1243.500] (-1243.360) (-1243.471) -- 0:00:36 423000 -- (-1241.053) [-1241.050] (-1244.137) (-1242.419) * (-1242.763) [-1241.972] (-1245.330) (-1241.952) -- 0:00:36 423500 -- (-1242.564) (-1242.010) (-1243.326) [-1241.320] * (-1241.618) (-1243.100) (-1242.426) [-1241.148] -- 0:00:36 424000 -- [-1242.860] (-1242.658) (-1245.555) (-1241.544) * (-1242.575) [-1245.729] (-1243.283) (-1240.828) -- 0:00:36 424500 -- (-1241.470) (-1241.210) [-1242.751] (-1244.534) * [-1242.658] (-1243.567) (-1243.813) (-1241.942) -- 0:00:36 425000 -- (-1240.689) [-1244.014] (-1247.325) (-1244.710) * (-1241.352) (-1242.914) [-1242.325] (-1240.461) -- 0:00:36 Average standard deviation of split frequencies: 0.013771 425500 -- [-1241.130] (-1241.084) (-1245.955) (-1240.960) * (-1242.044) [-1246.635] (-1249.048) (-1240.472) -- 0:00:36 426000 -- [-1241.603] (-1241.985) (-1243.227) (-1240.420) * (-1244.234) (-1241.232) [-1243.166] (-1240.597) -- 0:00:36 426500 -- (-1246.083) [-1245.520] (-1242.489) (-1240.422) * (-1243.835) [-1242.835] (-1242.129) (-1245.014) -- 0:00:36 427000 -- [-1244.773] (-1244.861) (-1242.071) (-1240.437) * (-1242.524) (-1242.241) (-1241.805) [-1242.166] -- 0:00:37 427500 -- [-1241.823] (-1248.356) (-1241.522) (-1241.297) * [-1244.075] (-1240.923) (-1240.787) (-1242.753) -- 0:00:37 428000 -- (-1241.385) (-1242.309) (-1245.150) [-1242.106] * (-1245.211) (-1240.923) [-1242.049] (-1241.891) -- 0:00:37 428500 -- (-1241.601) (-1243.739) (-1246.975) [-1241.749] * (-1245.653) (-1244.349) (-1241.802) [-1243.718] -- 0:00:37 429000 -- (-1242.927) (-1241.183) (-1245.938) [-1242.016] * (-1247.429) (-1247.096) [-1240.899] (-1243.883) -- 0:00:37 429500 -- (-1243.418) (-1245.491) [-1242.770] (-1241.097) * (-1246.359) (-1244.286) [-1241.411] (-1243.407) -- 0:00:37 430000 -- (-1242.495) [-1241.348] (-1241.578) (-1242.877) * (-1244.075) (-1246.145) (-1241.402) [-1243.003] -- 0:00:37 Average standard deviation of split frequencies: 0.014777 430500 -- [-1242.119] (-1241.475) (-1245.873) (-1241.888) * (-1242.226) (-1242.893) (-1241.336) [-1242.194] -- 0:00:37 431000 -- (-1241.728) (-1241.535) (-1243.539) [-1241.041] * [-1244.828] (-1241.506) (-1241.353) (-1244.285) -- 0:00:36 431500 -- (-1241.642) (-1241.984) (-1242.390) [-1247.220] * (-1244.553) (-1242.327) (-1242.334) [-1243.453] -- 0:00:36 432000 -- (-1242.577) (-1241.594) (-1241.578) [-1243.406] * (-1244.091) [-1243.422] (-1241.943) (-1242.804) -- 0:00:36 432500 -- [-1245.784] (-1241.602) (-1241.820) (-1242.818) * [-1244.973] (-1244.111) (-1241.302) (-1242.732) -- 0:00:36 433000 -- [-1241.657] (-1242.373) (-1241.788) (-1247.868) * [-1246.916] (-1241.721) (-1245.985) (-1241.078) -- 0:00:36 433500 -- [-1242.779] (-1244.494) (-1242.515) (-1246.591) * (-1240.799) (-1241.846) [-1245.344] (-1242.516) -- 0:00:36 434000 -- [-1241.776] (-1242.197) (-1242.352) (-1254.666) * (-1242.194) (-1241.722) (-1245.206) [-1242.303] -- 0:00:36 434500 -- (-1242.531) (-1246.305) [-1242.426] (-1245.777) * [-1242.705] (-1243.006) (-1242.903) (-1240.993) -- 0:00:36 435000 -- (-1240.825) (-1244.326) [-1242.597] (-1245.641) * [-1241.031] (-1241.617) (-1243.418) (-1241.764) -- 0:00:36 Average standard deviation of split frequencies: 0.014056 435500 -- (-1241.411) [-1241.309] (-1241.850) (-1242.673) * (-1241.381) (-1240.787) (-1243.563) [-1243.802] -- 0:00:36 436000 -- (-1242.086) [-1244.763] (-1243.738) (-1244.746) * (-1242.300) (-1241.974) [-1242.430] (-1240.876) -- 0:00:36 436500 -- (-1246.659) (-1245.799) [-1243.510] (-1241.143) * (-1241.604) (-1241.947) [-1243.855] (-1246.306) -- 0:00:36 437000 -- (-1246.102) (-1241.629) (-1244.347) [-1241.237] * (-1244.784) (-1242.041) (-1241.501) [-1245.175] -- 0:00:36 437500 -- (-1243.232) (-1242.360) (-1243.076) [-1243.782] * (-1244.661) (-1241.477) [-1246.576] (-1244.670) -- 0:00:36 438000 -- (-1243.120) [-1242.019] (-1242.395) (-1241.890) * [-1242.976] (-1241.027) (-1244.095) (-1244.991) -- 0:00:35 438500 -- (-1243.123) [-1241.444] (-1243.179) (-1244.103) * (-1240.803) (-1242.031) [-1243.023] (-1245.971) -- 0:00:35 439000 -- [-1246.138] (-1244.883) (-1243.510) (-1245.445) * [-1241.016] (-1241.998) (-1241.930) (-1242.146) -- 0:00:35 439500 -- (-1242.075) (-1242.024) (-1242.617) [-1241.490] * [-1242.897] (-1240.889) (-1243.759) (-1240.893) -- 0:00:35 440000 -- (-1241.046) (-1246.117) (-1243.185) [-1241.834] * [-1243.099] (-1242.079) (-1241.426) (-1241.969) -- 0:00:35 Average standard deviation of split frequencies: 0.014679 440500 -- (-1241.011) (-1245.684) [-1243.757] (-1242.346) * (-1243.204) (-1242.563) [-1242.318] (-1242.087) -- 0:00:35 441000 -- (-1242.067) (-1242.598) [-1241.915] (-1241.411) * (-1242.745) [-1241.751] (-1241.712) (-1242.957) -- 0:00:35 441500 -- (-1242.905) (-1242.322) [-1241.938] (-1242.471) * (-1244.723) (-1244.517) [-1242.965] (-1244.223) -- 0:00:35 442000 -- (-1242.905) (-1241.433) (-1246.792) [-1242.575] * (-1245.972) (-1241.856) [-1244.727] (-1243.522) -- 0:00:35 442500 -- (-1242.291) [-1242.180] (-1243.472) (-1241.844) * (-1247.989) (-1240.943) (-1242.782) [-1242.871] -- 0:00:35 443000 -- (-1241.245) [-1241.976] (-1243.162) (-1245.418) * (-1243.134) [-1246.256] (-1241.408) (-1243.102) -- 0:00:36 443500 -- [-1242.715] (-1244.709) (-1242.468) (-1243.889) * (-1242.622) (-1245.080) (-1242.434) [-1244.015] -- 0:00:36 444000 -- (-1244.267) (-1244.811) [-1242.293] (-1244.460) * (-1243.783) (-1242.208) (-1243.894) [-1244.015] -- 0:00:36 444500 -- (-1244.970) [-1245.779] (-1245.273) (-1242.341) * [-1245.380] (-1243.777) (-1246.602) (-1242.689) -- 0:00:36 445000 -- [-1241.986] (-1246.290) (-1244.666) (-1242.579) * [-1245.556] (-1243.370) (-1243.718) (-1243.308) -- 0:00:36 Average standard deviation of split frequencies: 0.014386 445500 -- (-1241.358) [-1241.544] (-1247.044) (-1248.502) * (-1246.168) (-1242.050) [-1242.558] (-1245.496) -- 0:00:36 446000 -- (-1241.558) (-1241.456) (-1245.544) [-1242.382] * (-1242.976) (-1242.759) [-1242.072] (-1241.581) -- 0:00:36 446500 -- (-1242.434) [-1242.279] (-1246.628) (-1240.767) * (-1242.425) [-1240.995] (-1249.387) (-1242.913) -- 0:00:35 447000 -- (-1244.955) [-1242.926] (-1242.220) (-1243.216) * [-1240.416] (-1242.389) (-1242.868) (-1242.298) -- 0:00:35 447500 -- (-1241.516) (-1241.879) [-1244.140] (-1240.711) * (-1246.142) (-1241.602) [-1243.893] (-1241.156) -- 0:00:35 448000 -- [-1241.102] (-1245.485) (-1245.480) (-1241.672) * (-1243.672) [-1242.903] (-1241.289) (-1241.826) -- 0:00:35 448500 -- (-1242.030) (-1241.441) (-1247.345) [-1242.943] * (-1243.688) [-1242.235] (-1241.076) (-1241.473) -- 0:00:35 449000 -- (-1241.038) (-1241.092) (-1243.891) [-1242.941] * (-1242.737) [-1241.784] (-1241.812) (-1241.073) -- 0:00:35 449500 -- (-1241.288) (-1241.239) (-1245.426) [-1243.961] * (-1242.623) (-1241.486) [-1241.779] (-1241.420) -- 0:00:35 450000 -- (-1242.267) [-1242.571] (-1244.164) (-1246.541) * (-1242.376) (-1240.552) (-1242.757) [-1241.836] -- 0:00:35 Average standard deviation of split frequencies: 0.014398 450500 -- (-1242.244) (-1242.795) [-1243.740] (-1244.534) * [-1241.647] (-1242.560) (-1242.833) (-1243.089) -- 0:00:35 451000 -- (-1241.002) (-1242.424) [-1243.201] (-1243.787) * (-1242.042) (-1240.927) [-1241.433] (-1241.793) -- 0:00:35 451500 -- (-1242.538) (-1244.464) [-1242.256] (-1242.401) * (-1242.767) (-1243.868) [-1242.228] (-1242.723) -- 0:00:35 452000 -- [-1242.538] (-1242.656) (-1243.532) (-1240.855) * (-1241.809) (-1243.365) (-1246.365) [-1242.169] -- 0:00:35 452500 -- (-1241.852) (-1246.434) (-1242.427) [-1241.669] * (-1244.317) [-1241.389] (-1242.545) (-1242.284) -- 0:00:35 453000 -- [-1241.102] (-1245.521) (-1245.505) (-1242.047) * (-1243.072) (-1241.425) [-1241.562] (-1243.447) -- 0:00:35 453500 -- (-1241.578) (-1244.811) (-1241.899) [-1241.881] * (-1243.034) (-1243.705) (-1243.829) [-1245.592] -- 0:00:34 454000 -- [-1241.247] (-1241.619) (-1241.713) (-1241.733) * (-1242.795) (-1242.365) [-1243.173] (-1241.921) -- 0:00:34 454500 -- (-1242.088) [-1241.416] (-1241.565) (-1244.577) * (-1243.822) [-1242.580] (-1252.781) (-1242.431) -- 0:00:34 455000 -- (-1243.488) (-1243.309) [-1245.142] (-1243.992) * (-1244.565) [-1243.622] (-1242.529) (-1241.393) -- 0:00:34 Average standard deviation of split frequencies: 0.014716 455500 -- (-1241.494) (-1240.371) [-1242.320] (-1241.341) * (-1243.053) (-1244.656) [-1241.759] (-1247.509) -- 0:00:34 456000 -- (-1240.812) (-1240.601) (-1241.265) [-1245.021] * (-1243.728) (-1248.044) [-1240.760] (-1243.692) -- 0:00:34 456500 -- (-1240.385) (-1241.858) (-1241.926) [-1245.478] * (-1243.834) (-1247.031) [-1241.678] (-1242.949) -- 0:00:34 457000 -- (-1241.513) (-1240.927) (-1241.650) [-1242.644] * (-1242.672) (-1241.313) (-1241.388) [-1240.902] -- 0:00:34 457500 -- [-1240.746] (-1243.431) (-1242.863) (-1246.158) * (-1241.978) (-1241.173) [-1244.809] (-1248.532) -- 0:00:34 458000 -- (-1243.109) [-1243.437] (-1243.384) (-1245.608) * (-1242.840) (-1241.070) [-1243.018] (-1243.875) -- 0:00:34 458500 -- [-1245.616] (-1243.597) (-1241.786) (-1242.698) * (-1243.691) (-1241.721) (-1240.722) [-1241.372] -- 0:00:34 459000 -- (-1241.450) [-1243.983] (-1241.034) (-1241.492) * (-1246.354) (-1243.554) (-1242.713) [-1242.844] -- 0:00:34 459500 -- (-1241.158) [-1241.652] (-1241.603) (-1242.739) * (-1245.305) (-1246.782) [-1241.270] (-1242.478) -- 0:00:35 460000 -- (-1240.832) (-1242.309) [-1241.325] (-1242.895) * (-1247.079) [-1240.539] (-1240.757) (-1243.699) -- 0:00:35 Average standard deviation of split frequencies: 0.014326 460500 -- (-1240.896) (-1245.468) [-1243.956] (-1246.062) * [-1242.744] (-1248.145) (-1242.708) (-1243.676) -- 0:00:35 461000 -- (-1242.327) (-1243.813) [-1242.806] (-1241.794) * (-1241.448) [-1243.426] (-1240.831) (-1245.151) -- 0:00:35 461500 -- (-1240.601) (-1241.977) [-1243.271] (-1241.891) * (-1241.508) (-1241.815) [-1242.817] (-1242.042) -- 0:00:35 462000 -- (-1240.809) (-1245.963) (-1240.954) [-1243.572] * [-1241.494] (-1241.937) (-1243.132) (-1244.305) -- 0:00:34 462500 -- (-1241.409) (-1248.076) (-1241.536) [-1243.075] * [-1241.096] (-1242.193) (-1243.968) (-1246.525) -- 0:00:34 463000 -- (-1240.927) (-1245.580) [-1242.247] (-1243.339) * (-1247.302) [-1242.712] (-1245.004) (-1245.190) -- 0:00:34 463500 -- [-1247.388] (-1244.435) (-1240.546) (-1244.064) * (-1241.896) (-1243.485) (-1245.137) [-1242.847] -- 0:00:34 464000 -- [-1241.279] (-1242.274) (-1241.159) (-1243.850) * (-1244.290) (-1242.645) (-1242.243) [-1241.458] -- 0:00:34 464500 -- [-1241.661] (-1241.666) (-1241.882) (-1244.537) * (-1242.377) (-1242.689) [-1245.757] (-1245.497) -- 0:00:34 465000 -- (-1243.515) [-1242.075] (-1242.914) (-1241.688) * [-1241.917] (-1241.720) (-1245.633) (-1243.800) -- 0:00:34 Average standard deviation of split frequencies: 0.014162 465500 -- [-1241.350] (-1243.355) (-1244.025) (-1241.777) * (-1241.297) (-1241.014) [-1243.889] (-1241.298) -- 0:00:34 466000 -- [-1243.276] (-1241.340) (-1240.506) (-1241.717) * [-1241.700] (-1241.016) (-1241.982) (-1241.874) -- 0:00:34 466500 -- (-1242.362) (-1241.019) (-1241.918) [-1241.849] * [-1241.193] (-1241.276) (-1244.315) (-1244.322) -- 0:00:34 467000 -- (-1243.405) [-1242.982] (-1242.940) (-1241.599) * (-1246.233) (-1240.823) [-1242.799] (-1243.838) -- 0:00:34 467500 -- [-1243.444] (-1245.583) (-1241.059) (-1242.677) * (-1246.122) [-1243.250] (-1243.358) (-1241.839) -- 0:00:34 468000 -- (-1242.150) [-1242.643] (-1240.608) (-1242.437) * (-1245.433) (-1240.538) (-1245.068) [-1245.836] -- 0:00:34 468500 -- (-1242.847) (-1244.275) [-1244.999] (-1242.144) * (-1242.401) (-1241.085) (-1243.564) [-1240.810] -- 0:00:34 469000 -- [-1241.347] (-1244.730) (-1241.672) (-1240.577) * [-1242.164] (-1243.227) (-1242.596) (-1245.319) -- 0:00:33 469500 -- (-1242.548) [-1243.065] (-1240.979) (-1241.251) * (-1242.238) [-1241.750] (-1244.005) (-1241.202) -- 0:00:33 470000 -- (-1240.602) [-1243.264] (-1244.529) (-1243.714) * (-1242.082) (-1242.356) (-1241.400) [-1241.175] -- 0:00:33 Average standard deviation of split frequencies: 0.013521 470500 -- (-1242.590) (-1244.478) (-1242.153) [-1241.037] * (-1241.006) (-1242.729) [-1242.356] (-1240.775) -- 0:00:33 471000 -- [-1244.792] (-1246.078) (-1242.330) (-1241.190) * (-1241.987) (-1243.002) [-1241.202] (-1241.617) -- 0:00:33 471500 -- (-1246.122) [-1243.515] (-1242.140) (-1241.398) * (-1242.240) [-1240.978] (-1241.508) (-1242.422) -- 0:00:33 472000 -- (-1241.631) (-1244.169) (-1240.537) [-1242.760] * [-1242.815] (-1240.978) (-1241.928) (-1241.951) -- 0:00:33 472500 -- (-1240.564) [-1244.912] (-1242.360) (-1245.487) * (-1243.216) [-1240.480] (-1242.828) (-1241.897) -- 0:00:33 473000 -- (-1241.447) (-1241.271) [-1241.629] (-1243.743) * [-1241.736] (-1242.185) (-1242.341) (-1241.442) -- 0:00:33 473500 -- (-1240.725) (-1245.766) [-1242.843] (-1245.517) * (-1241.829) (-1243.506) [-1242.539] (-1241.967) -- 0:00:33 474000 -- [-1242.855] (-1244.518) (-1245.963) (-1240.324) * [-1240.541] (-1243.179) (-1243.025) (-1240.914) -- 0:00:33 474500 -- [-1243.723] (-1245.398) (-1241.121) (-1240.368) * [-1241.910] (-1246.048) (-1246.608) (-1243.000) -- 0:00:33 475000 -- (-1243.868) [-1243.547] (-1244.502) (-1240.476) * (-1246.213) (-1244.836) [-1242.610] (-1242.356) -- 0:00:33 Average standard deviation of split frequencies: 0.013480 475500 -- (-1243.222) (-1241.328) [-1244.151] (-1240.967) * (-1245.799) (-1244.477) [-1242.540] (-1243.408) -- 0:00:34 476000 -- (-1243.350) (-1242.659) (-1243.719) [-1243.943] * (-1244.814) (-1245.053) (-1244.120) [-1243.306] -- 0:00:34 476500 -- (-1245.271) (-1240.671) (-1244.898) [-1242.930] * (-1243.745) [-1242.501] (-1242.424) (-1246.072) -- 0:00:34 477000 -- (-1242.677) (-1240.671) [-1243.404] (-1240.887) * (-1243.642) (-1245.322) [-1242.238] (-1242.461) -- 0:00:33 477500 -- (-1242.334) [-1240.671] (-1241.433) (-1242.805) * (-1241.664) [-1240.582] (-1244.010) (-1244.777) -- 0:00:33 478000 -- (-1249.213) [-1241.120] (-1241.220) (-1245.142) * [-1243.317] (-1243.574) (-1243.257) (-1246.907) -- 0:00:33 478500 -- (-1241.716) [-1241.052] (-1242.029) (-1245.205) * [-1244.041] (-1243.356) (-1244.327) (-1247.831) -- 0:00:33 479000 -- (-1241.641) [-1241.247] (-1244.120) (-1242.932) * [-1246.308] (-1244.239) (-1244.825) (-1249.839) -- 0:00:33 479500 -- (-1243.128) [-1243.031] (-1249.263) (-1241.648) * (-1243.152) (-1243.100) [-1242.189] (-1242.487) -- 0:00:33 480000 -- (-1242.872) (-1242.040) (-1241.285) [-1240.737] * (-1244.437) [-1242.537] (-1241.875) (-1242.770) -- 0:00:33 Average standard deviation of split frequencies: 0.013567 480500 -- (-1243.868) (-1243.279) [-1242.513] (-1241.560) * [-1242.324] (-1241.236) (-1243.186) (-1245.712) -- 0:00:33 481000 -- (-1244.117) (-1242.942) (-1245.388) [-1246.902] * (-1241.272) (-1249.305) (-1242.021) [-1242.977] -- 0:00:33 481500 -- (-1243.037) (-1244.477) [-1242.879] (-1244.740) * (-1242.371) (-1244.423) (-1243.787) [-1241.401] -- 0:00:33 482000 -- (-1241.590) [-1244.694] (-1243.595) (-1241.763) * (-1242.371) [-1242.069] (-1242.618) (-1243.300) -- 0:00:33 482500 -- (-1241.327) [-1243.216] (-1244.257) (-1240.888) * (-1241.441) (-1242.838) [-1241.571] (-1242.370) -- 0:00:33 483000 -- (-1242.279) (-1242.153) [-1243.176] (-1244.991) * [-1243.221] (-1242.946) (-1242.764) (-1240.421) -- 0:00:33 483500 -- [-1245.295] (-1242.452) (-1242.348) (-1242.856) * (-1242.655) (-1249.894) (-1242.924) [-1242.303] -- 0:00:33 484000 -- (-1241.317) [-1245.895] (-1242.043) (-1243.526) * (-1241.633) (-1246.838) (-1251.029) [-1243.607] -- 0:00:33 484500 -- (-1241.624) (-1241.228) [-1243.106] (-1242.313) * (-1240.948) (-1244.222) (-1241.074) [-1241.341] -- 0:00:32 485000 -- [-1241.328] (-1241.214) (-1247.086) (-1240.925) * (-1242.457) (-1243.315) (-1240.940) [-1243.355] -- 0:00:32 Average standard deviation of split frequencies: 0.013472 485500 -- (-1243.232) (-1242.837) (-1243.685) [-1240.817] * (-1245.031) [-1243.315] (-1242.281) (-1243.792) -- 0:00:32 486000 -- (-1240.455) [-1241.358] (-1242.946) (-1241.564) * [-1243.510] (-1241.700) (-1244.361) (-1250.656) -- 0:00:32 486500 -- (-1241.193) [-1244.644] (-1243.894) (-1242.905) * [-1241.932] (-1242.562) (-1242.455) (-1246.952) -- 0:00:32 487000 -- [-1241.527] (-1241.664) (-1242.793) (-1241.489) * (-1242.359) (-1242.511) [-1242.082] (-1241.214) -- 0:00:32 487500 -- (-1241.338) [-1242.465] (-1242.858) (-1244.222) * (-1240.600) (-1241.471) [-1242.265] (-1241.097) -- 0:00:32 488000 -- (-1246.807) [-1242.551] (-1241.543) (-1241.847) * (-1243.602) [-1240.447] (-1241.087) (-1244.822) -- 0:00:32 488500 -- [-1241.649] (-1241.814) (-1243.404) (-1243.037) * [-1241.327] (-1242.792) (-1241.105) (-1244.735) -- 0:00:32 489000 -- (-1242.387) (-1241.753) (-1241.248) [-1243.671] * (-1242.216) (-1242.363) [-1242.011] (-1249.874) -- 0:00:32 489500 -- (-1242.889) [-1240.748] (-1243.309) (-1243.495) * [-1242.860] (-1244.427) (-1241.514) (-1241.149) -- 0:00:32 490000 -- (-1241.316) [-1241.373] (-1244.291) (-1243.182) * (-1244.545) (-1242.442) (-1244.020) [-1243.296] -- 0:00:32 Average standard deviation of split frequencies: 0.012917 490500 -- [-1241.682] (-1245.240) (-1245.211) (-1241.741) * (-1244.426) [-1242.247] (-1241.038) (-1247.904) -- 0:00:32 491000 -- (-1240.370) (-1241.273) (-1243.436) [-1241.344] * (-1245.698) (-1244.303) (-1241.206) [-1243.619] -- 0:00:32 491500 -- (-1244.488) (-1246.056) [-1241.974] (-1243.262) * (-1240.286) (-1247.825) [-1241.625] (-1243.820) -- 0:00:33 492000 -- [-1241.294] (-1242.802) (-1240.805) (-1241.863) * (-1240.405) (-1244.985) (-1243.190) [-1242.600] -- 0:00:33 492500 -- (-1242.447) (-1242.873) [-1240.769] (-1240.743) * [-1240.648] (-1242.868) (-1242.471) (-1242.519) -- 0:00:32 493000 -- (-1244.134) (-1242.290) [-1241.983] (-1242.583) * (-1241.520) (-1242.957) [-1241.011] (-1245.488) -- 0:00:32 493500 -- (-1244.554) (-1243.087) (-1240.873) [-1241.753] * [-1241.747] (-1245.649) (-1242.622) (-1243.865) -- 0:00:32 494000 -- [-1245.717] (-1242.508) (-1240.716) (-1246.689) * [-1242.120] (-1246.428) (-1246.414) (-1245.081) -- 0:00:32 494500 -- (-1248.583) [-1241.792] (-1243.759) (-1242.427) * [-1242.225] (-1245.601) (-1244.329) (-1241.542) -- 0:00:32 495000 -- (-1243.958) (-1241.768) (-1240.635) [-1244.656] * (-1240.814) (-1242.548) (-1246.020) [-1246.134] -- 0:00:32 Average standard deviation of split frequencies: 0.012883 495500 -- [-1244.389] (-1241.656) (-1242.605) (-1245.264) * (-1241.773) (-1247.114) (-1244.397) [-1241.469] -- 0:00:32 496000 -- (-1242.430) (-1244.442) (-1243.809) [-1242.095] * (-1243.276) [-1242.420] (-1240.773) (-1242.824) -- 0:00:32 496500 -- (-1242.822) (-1245.725) (-1245.605) [-1243.317] * (-1244.206) (-1242.675) (-1241.264) [-1243.115] -- 0:00:32 497000 -- (-1249.850) (-1242.321) (-1243.504) [-1242.714] * (-1242.113) [-1241.013] (-1243.267) (-1241.836) -- 0:00:32 497500 -- (-1243.273) (-1240.569) (-1241.561) [-1242.155] * (-1242.598) [-1241.013] (-1244.903) (-1242.938) -- 0:00:32 498000 -- (-1241.426) (-1240.882) [-1241.215] (-1242.851) * (-1242.099) (-1243.179) [-1244.620] (-1241.274) -- 0:00:32 498500 -- (-1241.441) (-1240.602) [-1240.979] (-1245.636) * (-1241.505) [-1241.411] (-1242.928) (-1241.860) -- 0:00:32 499000 -- (-1241.518) (-1246.928) [-1240.939] (-1243.800) * (-1242.417) (-1241.763) (-1242.022) [-1243.528] -- 0:00:32 499500 -- [-1243.198] (-1244.832) (-1241.519) (-1245.283) * (-1245.029) (-1241.881) [-1240.893] (-1242.068) -- 0:00:32 500000 -- (-1241.760) (-1245.984) (-1243.043) [-1243.799] * (-1244.340) [-1243.479] (-1241.366) (-1242.725) -- 0:00:32 Average standard deviation of split frequencies: 0.012868 500500 -- (-1242.515) (-1243.148) [-1242.043] (-1241.795) * (-1243.222) [-1241.592] (-1245.571) (-1243.531) -- 0:00:31 501000 -- (-1242.243) (-1241.174) [-1242.818] (-1243.892) * (-1244.830) (-1242.868) [-1242.288] (-1240.962) -- 0:00:31 501500 -- (-1241.573) (-1247.294) [-1242.136] (-1243.607) * [-1241.899] (-1241.501) (-1243.540) (-1241.635) -- 0:00:31 502000 -- [-1240.946] (-1242.854) (-1242.979) (-1242.291) * (-1243.224) (-1242.354) [-1241.806] (-1243.457) -- 0:00:31 502500 -- (-1241.722) (-1240.953) [-1244.823] (-1241.252) * [-1245.570] (-1240.889) (-1242.790) (-1241.219) -- 0:00:31 503000 -- (-1246.539) [-1242.016] (-1246.521) (-1242.190) * (-1243.302) (-1243.630) (-1245.323) [-1240.750] -- 0:00:31 503500 -- [-1241.844] (-1243.317) (-1244.141) (-1244.575) * (-1242.341) (-1245.644) (-1246.390) [-1241.192] -- 0:00:31 504000 -- [-1241.874] (-1241.699) (-1240.739) (-1241.866) * (-1241.028) (-1242.435) [-1241.953] (-1240.758) -- 0:00:31 504500 -- (-1241.540) (-1240.647) [-1241.864] (-1241.954) * (-1241.334) (-1241.298) (-1242.654) [-1243.705] -- 0:00:31 505000 -- (-1242.182) (-1243.256) [-1240.782] (-1241.101) * (-1241.359) [-1242.301] (-1241.679) (-1241.386) -- 0:00:31 Average standard deviation of split frequencies: 0.012732 505500 -- (-1245.495) (-1241.917) (-1252.192) [-1240.695] * (-1242.862) (-1241.876) [-1241.628] (-1241.218) -- 0:00:31 506000 -- (-1243.618) (-1243.620) (-1241.274) [-1241.088] * (-1243.809) [-1241.424] (-1242.133) (-1242.058) -- 0:00:31 506500 -- (-1243.434) (-1242.536) (-1242.706) [-1242.097] * (-1242.417) (-1243.970) [-1244.563] (-1245.488) -- 0:00:31 507000 -- (-1241.629) (-1242.430) [-1242.437] (-1243.394) * (-1242.763) (-1241.794) (-1242.939) [-1243.356] -- 0:00:32 507500 -- (-1241.247) (-1241.937) [-1242.224] (-1243.322) * (-1246.060) (-1246.287) [-1241.723] (-1243.763) -- 0:00:32 508000 -- (-1241.900) [-1242.510] (-1244.553) (-1242.761) * (-1241.851) [-1241.814] (-1243.400) (-1243.406) -- 0:00:31 508500 -- (-1242.692) [-1242.371] (-1247.487) (-1244.397) * (-1242.134) (-1243.979) [-1243.806] (-1243.082) -- 0:00:31 509000 -- (-1241.887) (-1244.060) (-1247.783) [-1242.745] * [-1245.759] (-1244.674) (-1242.936) (-1242.553) -- 0:00:31 509500 -- [-1244.694] (-1243.783) (-1241.381) (-1242.287) * (-1241.449) [-1242.860] (-1244.722) (-1242.457) -- 0:00:31 510000 -- (-1242.309) [-1244.523] (-1243.106) (-1243.202) * (-1245.126) (-1244.191) [-1242.845] (-1242.207) -- 0:00:31 Average standard deviation of split frequencies: 0.012435 510500 -- (-1241.957) [-1244.245] (-1241.797) (-1242.287) * (-1243.922) [-1242.877] (-1247.602) (-1241.183) -- 0:00:31 511000 -- [-1242.058] (-1243.386) (-1244.002) (-1245.684) * [-1246.505] (-1241.461) (-1245.942) (-1242.164) -- 0:00:31 511500 -- (-1241.313) (-1241.761) [-1241.548] (-1244.702) * [-1243.985] (-1245.068) (-1245.697) (-1242.141) -- 0:00:31 512000 -- (-1243.037) (-1240.813) [-1243.523] (-1242.202) * (-1244.587) (-1245.107) [-1245.899] (-1245.953) -- 0:00:31 512500 -- (-1242.584) [-1241.390] (-1244.190) (-1242.424) * (-1243.726) (-1245.059) [-1243.882] (-1240.623) -- 0:00:31 513000 -- (-1241.576) (-1241.608) (-1241.918) [-1242.445] * (-1243.891) [-1246.015] (-1243.616) (-1240.590) -- 0:00:31 513500 -- [-1241.495] (-1241.986) (-1244.503) (-1249.525) * (-1244.355) [-1243.238] (-1241.476) (-1241.441) -- 0:00:31 514000 -- [-1244.734] (-1240.782) (-1242.189) (-1246.309) * (-1245.753) (-1241.693) [-1242.959] (-1241.618) -- 0:00:31 514500 -- (-1243.691) (-1242.382) (-1245.843) [-1247.077] * (-1243.610) [-1241.292] (-1242.688) (-1241.383) -- 0:00:31 515000 -- (-1244.007) [-1244.420] (-1253.634) (-1243.459) * (-1241.939) (-1242.513) (-1242.574) [-1241.252] -- 0:00:31 Average standard deviation of split frequencies: 0.011930 515500 -- [-1241.748] (-1242.384) (-1243.648) (-1241.292) * [-1243.013] (-1242.979) (-1243.545) (-1241.240) -- 0:00:31 516000 -- [-1241.741] (-1242.078) (-1243.039) (-1242.903) * [-1243.612] (-1243.897) (-1242.850) (-1242.651) -- 0:00:30 516500 -- (-1244.210) [-1241.728] (-1240.479) (-1242.128) * (-1243.330) [-1242.426] (-1242.719) (-1243.608) -- 0:00:30 517000 -- (-1244.958) (-1244.809) (-1241.505) [-1241.433] * (-1242.610) [-1241.211] (-1241.397) (-1246.882) -- 0:00:30 517500 -- (-1244.686) (-1243.056) [-1243.708] (-1243.853) * [-1240.572] (-1240.732) (-1244.948) (-1248.027) -- 0:00:30 518000 -- (-1242.133) [-1244.019] (-1241.483) (-1244.208) * (-1243.786) [-1242.322] (-1250.818) (-1242.388) -- 0:00:30 518500 -- (-1241.010) [-1248.088] (-1242.923) (-1244.680) * (-1241.168) (-1244.473) [-1241.805] (-1240.847) -- 0:00:30 519000 -- (-1243.783) (-1241.669) [-1241.781] (-1246.870) * (-1243.482) [-1245.547] (-1241.761) (-1240.680) -- 0:00:30 519500 -- [-1245.651] (-1243.900) (-1243.219) (-1244.234) * (-1245.455) [-1241.558] (-1241.672) (-1241.401) -- 0:00:30 520000 -- (-1245.640) (-1242.955) [-1241.288] (-1244.887) * (-1242.805) (-1244.999) (-1242.153) [-1241.489] -- 0:00:30 Average standard deviation of split frequencies: 0.011504 520500 -- (-1241.157) (-1245.200) [-1242.260] (-1242.886) * (-1241.428) (-1241.923) (-1242.105) [-1242.603] -- 0:00:30 521000 -- (-1244.520) (-1245.266) (-1244.818) [-1242.803] * (-1241.575) [-1242.068] (-1243.511) (-1241.175) -- 0:00:30 521500 -- (-1244.630) [-1241.624] (-1242.891) (-1241.072) * (-1240.606) (-1245.696) [-1245.726] (-1244.425) -- 0:00:31 522000 -- (-1246.556) (-1242.314) [-1241.368] (-1243.906) * (-1240.494) [-1242.559] (-1242.713) (-1241.246) -- 0:00:31 522500 -- [-1243.323] (-1242.330) (-1242.642) (-1243.122) * [-1240.903] (-1246.070) (-1244.435) (-1242.758) -- 0:00:31 523000 -- (-1242.585) (-1244.632) (-1241.630) [-1241.826] * [-1241.728] (-1245.806) (-1245.734) (-1241.394) -- 0:00:31 523500 -- (-1243.536) [-1241.737] (-1241.836) (-1242.777) * [-1242.118] (-1244.205) (-1242.092) (-1241.394) -- 0:00:30 524000 -- (-1244.014) (-1242.500) [-1242.069] (-1244.715) * [-1241.113] (-1241.256) (-1243.812) (-1244.391) -- 0:00:30 524500 -- (-1241.401) (-1243.278) (-1241.062) [-1243.708] * (-1240.300) [-1241.195] (-1242.690) (-1241.367) -- 0:00:30 525000 -- [-1241.416] (-1240.882) (-1242.517) (-1246.651) * (-1241.861) [-1241.583] (-1242.291) (-1241.017) -- 0:00:30 Average standard deviation of split frequencies: 0.010807 525500 -- (-1247.977) [-1241.432] (-1241.815) (-1248.415) * (-1245.261) [-1241.410] (-1243.099) (-1242.637) -- 0:00:30 526000 -- (-1247.011) (-1243.906) [-1243.960] (-1246.030) * [-1247.013] (-1244.781) (-1241.695) (-1241.992) -- 0:00:30 526500 -- (-1241.970) (-1241.820) (-1241.714) [-1242.255] * (-1241.409) (-1243.589) (-1244.551) [-1248.816] -- 0:00:30 527000 -- (-1240.830) [-1241.699] (-1241.983) (-1240.793) * (-1241.737) (-1243.929) (-1244.683) [-1242.042] -- 0:00:30 527500 -- [-1242.479] (-1241.976) (-1245.581) (-1240.793) * (-1241.193) [-1243.043] (-1242.182) (-1243.246) -- 0:00:30 528000 -- (-1243.730) (-1240.917) (-1247.945) [-1241.006] * (-1246.249) (-1242.717) (-1241.400) [-1241.430] -- 0:00:30 528500 -- (-1245.788) (-1241.279) [-1242.363] (-1243.496) * (-1242.776) (-1242.994) (-1242.462) [-1244.975] -- 0:00:30 529000 -- (-1244.328) [-1241.342] (-1241.496) (-1243.018) * [-1241.552] (-1244.877) (-1241.396) (-1244.407) -- 0:00:30 529500 -- (-1243.586) (-1244.791) [-1243.164] (-1244.668) * (-1242.106) (-1241.224) (-1241.230) [-1243.126] -- 0:00:30 530000 -- (-1243.641) (-1244.789) [-1242.447] (-1245.536) * (-1243.072) (-1242.093) (-1241.873) [-1241.881] -- 0:00:30 Average standard deviation of split frequencies: 0.010608 530500 -- [-1242.584] (-1242.608) (-1242.635) (-1246.707) * (-1242.568) (-1245.990) (-1240.655) [-1240.903] -- 0:00:30 531000 -- (-1245.837) [-1242.990] (-1241.336) (-1241.646) * [-1245.689] (-1243.143) (-1241.216) (-1245.857) -- 0:00:30 531500 -- (-1245.261) [-1242.374] (-1244.633) (-1246.230) * (-1243.053) (-1242.620) (-1241.208) [-1240.353] -- 0:00:29 532000 -- (-1242.648) [-1242.306] (-1246.163) (-1244.993) * (-1241.923) (-1246.921) (-1241.988) [-1240.818] -- 0:00:29 532500 -- (-1245.518) [-1240.914] (-1246.291) (-1241.821) * (-1240.742) (-1243.107) [-1242.909] (-1240.808) -- 0:00:29 533000 -- [-1242.024] (-1243.249) (-1243.538) (-1240.809) * (-1241.184) (-1244.087) [-1242.768] (-1242.026) -- 0:00:29 533500 -- [-1242.196] (-1247.013) (-1245.031) (-1241.599) * [-1241.717] (-1242.218) (-1243.066) (-1245.609) -- 0:00:29 534000 -- [-1241.986] (-1245.002) (-1242.943) (-1241.946) * (-1241.712) (-1245.189) (-1245.226) [-1243.655] -- 0:00:29 534500 -- [-1241.968] (-1246.249) (-1242.254) (-1242.024) * (-1247.302) [-1248.709] (-1242.241) (-1240.626) -- 0:00:29 535000 -- (-1245.768) (-1241.820) [-1241.175] (-1242.041) * (-1243.659) (-1245.322) [-1241.865] (-1242.314) -- 0:00:29 Average standard deviation of split frequencies: 0.010192 535500 -- (-1243.809) (-1245.441) [-1245.043] (-1241.733) * [-1244.729] (-1243.535) (-1244.628) (-1242.119) -- 0:00:29 536000 -- [-1242.555] (-1241.758) (-1241.910) (-1240.864) * (-1244.543) (-1246.521) [-1242.866] (-1243.515) -- 0:00:29 536500 -- (-1240.593) (-1242.566) (-1244.397) [-1240.974] * [-1244.074] (-1247.094) (-1243.306) (-1242.147) -- 0:00:29 537000 -- [-1242.622] (-1241.370) (-1242.922) (-1240.873) * (-1244.487) (-1248.771) [-1242.723] (-1244.542) -- 0:00:29 537500 -- [-1242.047] (-1241.559) (-1246.180) (-1244.111) * (-1242.806) (-1241.399) [-1244.071] (-1243.411) -- 0:00:30 538000 -- [-1241.309] (-1242.205) (-1243.002) (-1242.245) * (-1241.860) [-1244.417] (-1245.926) (-1242.197) -- 0:00:30 538500 -- (-1241.437) (-1242.978) [-1242.968] (-1241.513) * (-1242.190) [-1241.466] (-1245.626) (-1241.124) -- 0:00:29 539000 -- (-1244.905) [-1240.896] (-1245.635) (-1242.092) * (-1244.245) (-1242.319) [-1242.701] (-1242.768) -- 0:00:29 539500 -- (-1241.405) [-1243.358] (-1245.043) (-1243.324) * (-1243.713) (-1243.131) [-1243.422] (-1241.331) -- 0:00:29 540000 -- (-1241.546) [-1240.846] (-1242.724) (-1241.633) * (-1241.376) (-1241.845) (-1243.738) [-1240.897] -- 0:00:29 Average standard deviation of split frequencies: 0.010668 540500 -- [-1241.967] (-1243.208) (-1243.669) (-1242.366) * [-1242.827] (-1241.817) (-1245.563) (-1243.544) -- 0:00:29 541000 -- (-1241.620) [-1242.413] (-1242.331) (-1242.103) * (-1247.526) [-1243.192] (-1242.239) (-1245.031) -- 0:00:29 541500 -- (-1243.439) (-1242.864) (-1244.840) [-1242.122] * (-1249.086) (-1242.604) [-1242.958] (-1241.971) -- 0:00:29 542000 -- (-1243.566) [-1241.612] (-1243.840) (-1241.693) * (-1243.453) (-1241.592) [-1244.067] (-1242.560) -- 0:00:29 542500 -- (-1247.010) (-1242.666) [-1243.183] (-1241.934) * [-1241.025] (-1241.140) (-1240.886) (-1244.323) -- 0:00:29 543000 -- [-1241.604] (-1243.251) (-1242.121) (-1243.214) * [-1243.348] (-1240.377) (-1242.152) (-1243.745) -- 0:00:29 543500 -- (-1240.765) [-1243.170] (-1243.519) (-1242.116) * (-1240.718) [-1240.385] (-1243.997) (-1244.130) -- 0:00:29 544000 -- (-1240.573) (-1241.445) (-1242.165) [-1241.828] * [-1242.344] (-1240.471) (-1243.367) (-1243.922) -- 0:00:29 544500 -- [-1240.413] (-1242.562) (-1240.782) (-1243.054) * (-1243.793) [-1243.120] (-1242.612) (-1248.139) -- 0:00:29 545000 -- (-1240.958) (-1241.061) (-1241.208) [-1243.059] * (-1243.541) [-1242.080] (-1245.175) (-1242.576) -- 0:00:29 Average standard deviation of split frequencies: 0.010310 545500 -- (-1242.221) (-1245.239) [-1242.413] (-1244.437) * (-1243.829) [-1241.729] (-1245.219) (-1241.465) -- 0:00:29 546000 -- (-1245.703) (-1246.121) (-1245.278) [-1245.578] * (-1243.674) [-1240.951] (-1246.599) (-1241.530) -- 0:00:29 546500 -- [-1242.674] (-1241.474) (-1243.515) (-1247.627) * (-1242.655) [-1247.082] (-1246.555) (-1245.211) -- 0:00:29 547000 -- (-1243.870) (-1241.033) [-1241.428] (-1242.931) * (-1242.055) (-1246.426) (-1242.445) [-1242.552] -- 0:00:28 547500 -- [-1242.496] (-1242.286) (-1242.728) (-1241.259) * (-1244.456) [-1243.462] (-1241.230) (-1242.344) -- 0:00:28 548000 -- (-1245.205) (-1244.636) (-1243.679) [-1243.538] * (-1243.668) (-1242.045) [-1241.037] (-1244.978) -- 0:00:28 548500 -- (-1243.914) (-1244.119) (-1242.234) [-1247.190] * (-1242.270) [-1241.644] (-1241.646) (-1242.408) -- 0:00:28 549000 -- (-1243.542) (-1244.893) (-1241.435) [-1249.304] * (-1247.358) (-1244.235) [-1247.547] (-1240.700) -- 0:00:28 549500 -- (-1242.953) (-1243.030) [-1241.459] (-1243.461) * (-1242.980) (-1240.837) (-1244.232) [-1241.557] -- 0:00:28 550000 -- (-1243.370) (-1241.981) (-1241.834) [-1243.690] * (-1241.869) [-1242.807] (-1246.800) (-1243.691) -- 0:00:28 Average standard deviation of split frequencies: 0.010978 550500 -- [-1242.024] (-1241.629) (-1244.852) (-1245.661) * (-1241.610) [-1241.312] (-1242.458) (-1244.337) -- 0:00:28 551000 -- (-1241.990) (-1241.568) (-1242.818) [-1242.900] * [-1241.766] (-1241.404) (-1244.461) (-1248.559) -- 0:00:28 551500 -- [-1241.204] (-1240.930) (-1244.258) (-1241.651) * (-1241.447) [-1241.666] (-1240.965) (-1244.754) -- 0:00:28 552000 -- (-1240.624) (-1243.178) [-1240.873] (-1242.639) * [-1243.333] (-1242.079) (-1244.675) (-1241.029) -- 0:00:28 552500 -- (-1243.302) [-1242.447] (-1243.613) (-1241.166) * (-1241.197) (-1244.001) [-1242.195] (-1240.923) -- 0:00:28 553000 -- (-1242.029) (-1245.693) (-1242.716) [-1243.464] * (-1243.792) (-1243.542) (-1243.387) [-1241.873] -- 0:00:29 553500 -- (-1242.274) (-1242.685) [-1242.492] (-1242.280) * (-1242.871) (-1247.312) [-1248.611] (-1243.317) -- 0:00:29 554000 -- (-1243.756) (-1244.160) (-1245.649) [-1242.556] * (-1242.573) (-1242.151) [-1244.771] (-1243.366) -- 0:00:28 554500 -- (-1245.344) (-1241.479) [-1245.642] (-1241.379) * (-1242.509) (-1241.500) [-1240.987] (-1242.994) -- 0:00:28 555000 -- (-1244.495) (-1241.832) (-1240.900) [-1240.934] * (-1243.860) (-1242.101) [-1241.986] (-1244.202) -- 0:00:28 Average standard deviation of split frequencies: 0.011321 555500 -- (-1241.004) (-1241.832) (-1241.956) [-1242.726] * (-1245.870) [-1243.387] (-1244.027) (-1241.143) -- 0:00:28 556000 -- [-1243.382] (-1243.834) (-1245.230) (-1249.896) * (-1243.265) (-1242.696) (-1242.311) [-1240.756] -- 0:00:28 556500 -- [-1240.674] (-1241.928) (-1244.885) (-1243.735) * (-1244.043) (-1242.654) (-1242.956) [-1242.118] -- 0:00:28 557000 -- [-1240.674] (-1243.824) (-1241.202) (-1244.518) * (-1242.413) [-1242.041] (-1245.769) (-1241.001) -- 0:00:28 557500 -- (-1241.002) (-1243.765) (-1244.209) [-1242.057] * [-1242.041] (-1244.760) (-1241.265) (-1243.547) -- 0:00:28 558000 -- (-1240.406) (-1244.229) (-1241.058) [-1242.939] * [-1244.022] (-1246.995) (-1241.267) (-1242.178) -- 0:00:28 558500 -- (-1240.410) (-1248.660) (-1243.109) [-1242.246] * (-1243.251) (-1246.448) (-1243.546) [-1242.154] -- 0:00:28 559000 -- [-1241.733] (-1242.614) (-1244.595) (-1240.970) * (-1240.557) [-1241.374] (-1243.044) (-1241.831) -- 0:00:28 559500 -- (-1243.023) [-1248.249] (-1245.228) (-1243.042) * (-1241.234) [-1241.998] (-1242.304) (-1242.464) -- 0:00:28 560000 -- [-1244.284] (-1248.684) (-1242.535) (-1241.046) * [-1241.980] (-1242.804) (-1244.228) (-1241.734) -- 0:00:28 Average standard deviation of split frequencies: 0.011623 560500 -- (-1243.379) [-1245.727] (-1240.352) (-1241.244) * (-1240.616) (-1243.742) [-1241.288] (-1243.824) -- 0:00:28 561000 -- (-1245.705) [-1242.759] (-1246.149) (-1241.678) * (-1240.616) [-1244.733] (-1242.448) (-1242.470) -- 0:00:28 561500 -- (-1244.179) [-1242.258] (-1244.643) (-1244.738) * (-1240.616) (-1247.526) [-1241.658] (-1243.039) -- 0:00:28 562000 -- (-1245.405) (-1242.443) (-1242.656) [-1243.648] * (-1241.920) (-1248.658) (-1243.434) [-1241.644] -- 0:00:28 562500 -- (-1247.071) (-1243.332) (-1244.547) [-1242.350] * [-1241.950] (-1243.411) (-1244.901) (-1241.470) -- 0:00:28 563000 -- (-1244.748) [-1242.137] (-1247.507) (-1245.010) * (-1242.267) (-1245.262) [-1242.010] (-1241.632) -- 0:00:27 563500 -- (-1248.149) [-1240.558] (-1242.197) (-1244.418) * (-1242.169) (-1242.222) (-1248.327) [-1241.887] -- 0:00:27 564000 -- (-1244.697) (-1241.903) [-1240.626] (-1250.346) * (-1243.184) (-1242.503) [-1241.631] (-1241.637) -- 0:00:27 564500 -- (-1243.521) [-1244.779] (-1241.192) (-1247.233) * (-1243.964) (-1243.915) (-1245.161) [-1241.062] -- 0:00:27 565000 -- (-1244.294) (-1242.734) [-1240.925] (-1242.917) * (-1241.924) (-1242.601) (-1244.646) [-1241.416] -- 0:00:27 Average standard deviation of split frequencies: 0.011121 565500 -- (-1242.495) (-1241.231) [-1243.702] (-1241.447) * (-1246.163) [-1241.061] (-1244.525) (-1241.915) -- 0:00:27 566000 -- (-1240.869) [-1245.564] (-1243.509) (-1243.307) * [-1244.579] (-1240.437) (-1241.251) (-1243.256) -- 0:00:27 566500 -- (-1241.240) (-1244.679) [-1242.677] (-1244.489) * (-1250.107) [-1241.669] (-1244.233) (-1242.911) -- 0:00:27 567000 -- (-1241.278) (-1242.157) [-1244.364] (-1243.986) * (-1242.067) (-1244.322) (-1245.064) [-1244.447] -- 0:00:27 567500 -- (-1243.616) (-1242.088) (-1243.065) [-1240.912] * (-1242.096) (-1240.602) [-1241.090] (-1241.663) -- 0:00:27 568000 -- [-1243.510] (-1241.148) (-1242.140) (-1241.541) * (-1241.145) [-1242.552] (-1241.129) (-1242.095) -- 0:00:27 568500 -- (-1242.592) (-1241.318) [-1242.848] (-1242.655) * (-1242.251) (-1243.638) (-1242.810) [-1241.577] -- 0:00:27 569000 -- [-1241.278] (-1242.439) (-1251.007) (-1241.745) * (-1243.110) (-1242.933) (-1243.812) [-1242.711] -- 0:00:27 569500 -- (-1241.506) [-1244.022] (-1246.320) (-1242.336) * (-1241.880) (-1242.944) [-1244.264] (-1243.567) -- 0:00:27 570000 -- (-1246.666) (-1244.999) [-1244.186] (-1241.539) * (-1246.009) [-1243.742] (-1241.591) (-1243.361) -- 0:00:27 Average standard deviation of split frequencies: 0.010836 570500 -- [-1243.233] (-1243.740) (-1244.672) (-1243.328) * [-1244.026] (-1243.514) (-1245.033) (-1242.659) -- 0:00:27 571000 -- (-1244.144) [-1241.867] (-1243.157) (-1241.192) * [-1243.635] (-1243.396) (-1242.772) (-1242.580) -- 0:00:27 571500 -- (-1243.975) (-1241.893) (-1245.765) [-1245.206] * (-1240.993) (-1245.210) (-1241.527) [-1242.112] -- 0:00:27 572000 -- (-1242.858) (-1242.626) (-1241.020) [-1245.594] * (-1242.685) (-1243.033) (-1242.728) [-1242.073] -- 0:00:27 572500 -- [-1240.953] (-1242.276) (-1242.171) (-1242.515) * (-1241.208) [-1242.316] (-1241.914) (-1246.525) -- 0:00:27 573000 -- (-1244.541) (-1244.977) [-1249.101] (-1246.209) * (-1243.257) (-1244.696) [-1241.613] (-1241.106) -- 0:00:27 573500 -- [-1241.889] (-1244.770) (-1244.696) (-1246.319) * (-1242.088) [-1241.791] (-1242.590) (-1241.845) -- 0:00:27 574000 -- (-1244.426) (-1245.170) [-1241.133] (-1240.904) * [-1241.941] (-1243.007) (-1242.461) (-1241.893) -- 0:00:27 574500 -- (-1247.832) (-1242.832) (-1244.853) [-1241.563] * [-1244.738] (-1242.854) (-1247.066) (-1242.276) -- 0:00:27 575000 -- (-1247.555) (-1242.099) [-1243.115] (-1242.247) * (-1242.866) (-1244.892) (-1244.532) [-1243.553] -- 0:00:27 Average standard deviation of split frequencies: 0.011121 575500 -- (-1243.865) (-1242.546) (-1244.759) [-1245.344] * (-1244.400) [-1244.104] (-1241.899) (-1241.369) -- 0:00:27 576000 -- (-1242.492) (-1243.687) [-1244.115] (-1241.800) * (-1245.169) (-1241.024) (-1242.648) [-1240.515] -- 0:00:27 576500 -- (-1242.942) (-1247.184) (-1242.909) [-1243.640] * (-1242.708) [-1240.698] (-1243.201) (-1246.625) -- 0:00:27 577000 -- (-1245.431) (-1243.818) [-1246.031] (-1245.348) * (-1242.026) (-1245.478) [-1243.771] (-1242.812) -- 0:00:27 577500 -- [-1241.625] (-1248.073) (-1242.175) (-1241.816) * (-1241.344) (-1243.618) (-1243.096) [-1242.484] -- 0:00:27 578000 -- [-1240.833] (-1243.971) (-1241.904) (-1243.714) * (-1241.990) (-1242.501) [-1245.860] (-1242.548) -- 0:00:27 578500 -- (-1240.844) (-1243.915) [-1242.255] (-1244.002) * (-1242.775) (-1241.383) [-1244.203] (-1241.846) -- 0:00:26 579000 -- (-1243.458) [-1240.813] (-1242.844) (-1244.919) * (-1241.163) (-1243.418) (-1245.819) [-1242.215] -- 0:00:26 579500 -- [-1243.551] (-1244.457) (-1244.897) (-1242.139) * (-1242.383) [-1242.860] (-1241.153) (-1244.589) -- 0:00:26 580000 -- (-1247.497) [-1242.823] (-1245.609) (-1242.236) * (-1241.054) [-1242.170] (-1242.170) (-1242.875) -- 0:00:26 Average standard deviation of split frequencies: 0.010506 580500 -- (-1241.760) (-1245.446) (-1242.542) [-1246.809] * [-1241.237] (-1241.546) (-1244.146) (-1245.904) -- 0:00:26 581000 -- (-1244.189) (-1247.704) (-1241.050) [-1244.516] * (-1242.671) (-1242.678) [-1241.922] (-1243.883) -- 0:00:26 581500 -- (-1243.975) [-1240.960] (-1243.338) (-1241.210) * [-1245.918] (-1243.251) (-1246.699) (-1243.241) -- 0:00:26 582000 -- (-1244.623) (-1240.941) [-1242.073] (-1243.691) * (-1249.841) [-1241.140] (-1243.831) (-1242.705) -- 0:00:26 582500 -- [-1241.346] (-1240.962) (-1241.970) (-1241.701) * (-1243.530) [-1242.000] (-1243.377) (-1241.920) -- 0:00:26 583000 -- (-1243.000) [-1241.743] (-1244.454) (-1245.965) * [-1244.438] (-1242.015) (-1243.706) (-1242.206) -- 0:00:26 583500 -- (-1245.112) [-1241.795] (-1247.173) (-1244.026) * [-1243.361] (-1243.576) (-1243.759) (-1244.090) -- 0:00:26 584000 -- (-1242.766) (-1248.323) (-1241.014) [-1241.309] * [-1241.597] (-1247.327) (-1243.116) (-1241.483) -- 0:00:26 584500 -- [-1242.734] (-1241.937) (-1241.234) (-1243.760) * (-1242.924) (-1247.637) [-1241.549] (-1241.495) -- 0:00:26 585000 -- (-1242.524) [-1240.799] (-1244.331) (-1242.422) * [-1243.021] (-1243.916) (-1241.311) (-1241.487) -- 0:00:26 Average standard deviation of split frequencies: 0.009511 585500 -- (-1243.949) [-1241.077] (-1241.447) (-1242.522) * [-1243.639] (-1244.891) (-1241.095) (-1241.326) -- 0:00:26 586000 -- [-1243.167] (-1244.529) (-1243.846) (-1242.759) * [-1242.558] (-1242.698) (-1241.360) (-1243.431) -- 0:00:26 586500 -- (-1241.754) (-1241.656) [-1247.553] (-1243.737) * (-1244.414) [-1241.972] (-1241.405) (-1244.440) -- 0:00:26 587000 -- (-1242.151) (-1241.318) [-1244.214] (-1244.357) * (-1242.562) [-1244.719] (-1241.340) (-1242.500) -- 0:00:26 587500 -- (-1241.806) (-1242.413) (-1242.822) [-1245.400] * [-1242.957] (-1244.262) (-1242.165) (-1244.945) -- 0:00:26 588000 -- [-1243.725] (-1243.710) (-1250.138) (-1246.618) * [-1241.207] (-1248.235) (-1243.254) (-1243.090) -- 0:00:26 588500 -- (-1241.067) (-1242.499) [-1244.761] (-1241.953) * (-1242.108) [-1242.752] (-1241.899) (-1243.266) -- 0:00:26 589000 -- (-1241.170) [-1244.237] (-1248.919) (-1241.993) * (-1241.516) (-1243.748) (-1241.905) [-1241.069] -- 0:00:26 589500 -- [-1243.721] (-1243.905) (-1243.258) (-1244.861) * (-1241.353) (-1243.658) (-1243.692) [-1240.577] -- 0:00:26 590000 -- (-1242.582) (-1244.201) (-1241.783) [-1243.406] * [-1240.910] (-1245.990) (-1244.779) (-1241.776) -- 0:00:26 Average standard deviation of split frequencies: 0.009859 590500 -- (-1251.191) (-1246.346) (-1243.081) [-1243.778] * [-1242.635] (-1247.727) (-1242.689) (-1242.578) -- 0:00:26 591000 -- [-1241.975] (-1242.749) (-1246.687) (-1244.184) * (-1241.673) (-1243.132) (-1242.972) [-1241.821] -- 0:00:26 591500 -- (-1240.627) (-1242.071) [-1244.708] (-1242.096) * (-1242.906) (-1242.689) [-1242.769] (-1242.061) -- 0:00:26 592000 -- [-1241.946] (-1246.616) (-1243.014) (-1241.741) * (-1243.670) (-1241.853) (-1240.528) [-1242.713] -- 0:00:26 592500 -- [-1240.961] (-1241.472) (-1242.237) (-1247.230) * (-1244.502) [-1242.348] (-1241.543) (-1241.588) -- 0:00:26 593000 -- (-1246.984) (-1242.421) (-1242.794) [-1242.124] * [-1242.838] (-1243.845) (-1241.285) (-1243.148) -- 0:00:26 593500 -- (-1241.159) (-1242.653) [-1241.434] (-1241.886) * [-1243.712] (-1242.511) (-1241.765) (-1244.432) -- 0:00:26 594000 -- (-1242.333) (-1244.730) (-1242.251) [-1241.736] * [-1240.788] (-1244.577) (-1241.564) (-1246.097) -- 0:00:25 594500 -- (-1242.915) [-1245.453] (-1242.584) (-1246.339) * (-1241.690) (-1243.110) (-1245.580) [-1241.400] -- 0:00:25 595000 -- [-1243.159] (-1241.812) (-1240.600) (-1241.608) * (-1242.082) (-1244.039) [-1243.123] (-1241.428) -- 0:00:25 Average standard deviation of split frequencies: 0.010035 595500 -- [-1243.214] (-1243.981) (-1240.656) (-1240.630) * (-1247.473) (-1242.763) (-1241.546) [-1240.984] -- 0:00:25 596000 -- (-1241.755) (-1241.063) (-1242.982) [-1243.133] * (-1241.979) (-1250.566) [-1241.652] (-1242.154) -- 0:00:25 596500 -- (-1242.141) [-1240.840] (-1245.150) (-1243.755) * (-1243.166) (-1246.915) [-1242.646] (-1242.061) -- 0:00:25 597000 -- (-1247.628) (-1247.343) (-1241.285) [-1241.710] * (-1248.070) (-1243.424) [-1242.358] (-1241.674) -- 0:00:25 597500 -- (-1243.349) [-1243.849] (-1242.394) (-1241.498) * (-1246.491) (-1241.259) [-1241.620] (-1246.201) -- 0:00:25 598000 -- [-1240.989] (-1240.627) (-1240.787) (-1240.935) * [-1245.285] (-1241.693) (-1242.039) (-1243.451) -- 0:00:25 598500 -- (-1242.057) (-1241.598) [-1240.882] (-1243.302) * (-1245.218) [-1241.949] (-1242.372) (-1242.103) -- 0:00:25 599000 -- [-1241.626] (-1245.169) (-1241.636) (-1241.648) * [-1244.240] (-1242.280) (-1241.351) (-1242.017) -- 0:00:25 599500 -- (-1244.446) (-1243.007) (-1240.515) [-1241.418] * [-1243.719] (-1241.643) (-1241.144) (-1240.976) -- 0:00:25 600000 -- [-1243.657] (-1243.916) (-1241.248) (-1244.703) * [-1246.675] (-1243.901) (-1241.275) (-1242.584) -- 0:00:25 Average standard deviation of split frequencies: 0.010055 600500 -- (-1241.997) (-1241.956) [-1242.718] (-1240.949) * (-1240.952) (-1246.036) [-1241.110] (-1244.275) -- 0:00:25 601000 -- (-1245.491) (-1245.210) (-1242.986) [-1240.957] * (-1241.315) [-1243.140] (-1242.791) (-1241.454) -- 0:00:25 601500 -- (-1241.147) (-1245.150) [-1242.824] (-1242.780) * [-1242.894] (-1243.281) (-1243.134) (-1242.623) -- 0:00:25 602000 -- (-1246.282) [-1240.668] (-1245.369) (-1243.617) * (-1242.617) (-1243.022) [-1241.653] (-1242.191) -- 0:00:25 602500 -- [-1241.415] (-1241.033) (-1242.971) (-1242.464) * (-1241.555) (-1242.710) (-1243.747) [-1245.430] -- 0:00:25 603000 -- (-1241.882) [-1240.575] (-1242.700) (-1240.876) * [-1240.575] (-1245.363) (-1241.299) (-1242.108) -- 0:00:25 603500 -- (-1244.121) [-1243.031] (-1243.904) (-1241.276) * (-1242.051) [-1242.709] (-1242.460) (-1242.773) -- 0:00:25 604000 -- (-1240.877) [-1240.659] (-1242.303) (-1242.983) * (-1244.059) [-1242.074] (-1242.514) (-1244.077) -- 0:00:25 604500 -- (-1244.444) (-1241.179) (-1242.347) [-1243.018] * [-1242.392] (-1244.273) (-1241.844) (-1241.887) -- 0:00:25 605000 -- [-1242.005] (-1244.425) (-1245.716) (-1245.317) * [-1241.634] (-1244.353) (-1241.822) (-1240.864) -- 0:00:25 Average standard deviation of split frequencies: 0.010356 605500 -- (-1241.188) (-1240.867) [-1245.795] (-1241.559) * [-1241.012] (-1245.229) (-1241.378) (-1243.625) -- 0:00:25 606000 -- [-1242.659] (-1241.723) (-1240.731) (-1244.369) * [-1241.565] (-1246.499) (-1242.796) (-1243.405) -- 0:00:25 606500 -- (-1241.400) (-1243.726) (-1242.855) [-1245.417] * [-1240.537] (-1246.018) (-1245.357) (-1243.681) -- 0:00:25 607000 -- (-1242.431) [-1243.646] (-1242.366) (-1243.820) * (-1242.915) (-1241.653) (-1244.705) [-1249.208] -- 0:00:25 607500 -- (-1244.195) (-1241.760) (-1240.569) [-1242.722] * (-1241.614) [-1242.977] (-1247.248) (-1251.038) -- 0:00:25 608000 -- [-1240.404] (-1248.953) (-1241.228) (-1242.373) * [-1241.049] (-1242.479) (-1244.263) (-1247.061) -- 0:00:25 608500 -- (-1241.141) [-1240.743] (-1241.403) (-1242.448) * (-1243.869) (-1242.050) [-1243.288] (-1243.584) -- 0:00:25 609000 -- (-1240.787) (-1244.366) [-1242.634] (-1242.629) * (-1244.987) (-1242.522) (-1242.258) [-1243.121] -- 0:00:25 609500 -- [-1240.753] (-1244.374) (-1242.749) (-1242.419) * (-1243.060) (-1241.288) (-1242.037) [-1244.826] -- 0:00:24 610000 -- (-1240.842) (-1241.734) [-1244.159] (-1241.590) * (-1244.713) (-1242.026) (-1241.940) [-1241.798] -- 0:00:24 Average standard deviation of split frequencies: 0.009939 610500 -- (-1241.674) (-1241.022) (-1244.883) [-1242.148] * [-1241.099] (-1243.401) (-1244.397) (-1241.482) -- 0:00:24 611000 -- (-1246.273) (-1241.529) (-1241.444) [-1243.098] * (-1246.090) (-1243.770) [-1242.844] (-1241.550) -- 0:00:24 611500 -- (-1244.135) (-1243.568) [-1242.013] (-1244.983) * (-1241.408) (-1244.878) (-1242.956) [-1241.334] -- 0:00:24 612000 -- (-1242.847) (-1243.861) (-1244.772) [-1241.835] * (-1241.476) (-1243.568) [-1245.364] (-1241.486) -- 0:00:24 612500 -- (-1242.995) (-1243.663) (-1244.602) [-1241.833] * (-1243.604) (-1241.948) [-1246.068] (-1241.468) -- 0:00:24 613000 -- (-1242.069) (-1241.687) (-1242.668) [-1242.641] * (-1243.778) [-1241.562] (-1241.793) (-1241.291) -- 0:00:24 613500 -- (-1240.419) (-1241.494) (-1244.851) [-1241.212] * (-1243.111) [-1243.235] (-1242.394) (-1241.390) -- 0:00:24 614000 -- (-1240.401) (-1242.622) (-1243.786) [-1241.249] * (-1245.010) (-1241.777) [-1242.810] (-1242.060) -- 0:00:24 614500 -- [-1241.451] (-1246.896) (-1246.331) (-1241.180) * (-1245.824) (-1241.734) (-1241.201) [-1241.994] -- 0:00:24 615000 -- (-1244.753) (-1243.980) (-1242.202) [-1242.929] * (-1242.865) [-1241.892] (-1242.019) (-1241.222) -- 0:00:24 Average standard deviation of split frequencies: 0.010140 615500 -- (-1242.194) (-1246.303) (-1246.337) [-1243.161] * (-1242.951) (-1241.730) [-1240.567] (-1241.665) -- 0:00:24 616000 -- (-1244.157) [-1243.145] (-1241.394) (-1240.663) * [-1246.001] (-1249.206) (-1248.643) (-1245.089) -- 0:00:24 616500 -- (-1244.333) (-1244.893) [-1241.741] (-1241.066) * (-1248.395) (-1243.479) (-1241.386) [-1243.045] -- 0:00:24 617000 -- (-1247.112) (-1242.266) (-1243.874) [-1242.693] * [-1245.650] (-1244.156) (-1241.922) (-1244.609) -- 0:00:24 617500 -- (-1243.106) [-1240.405] (-1242.963) (-1244.595) * (-1245.583) (-1242.553) [-1241.083] (-1244.200) -- 0:00:24 618000 -- (-1241.851) [-1243.925] (-1244.293) (-1241.844) * (-1242.735) [-1243.177] (-1240.534) (-1243.648) -- 0:00:24 618500 -- (-1242.014) (-1242.291) [-1243.466] (-1243.757) * (-1246.802) [-1242.062] (-1241.275) (-1243.865) -- 0:00:24 619000 -- (-1243.505) [-1244.026] (-1241.132) (-1242.118) * (-1241.918) (-1245.395) [-1241.279] (-1245.089) -- 0:00:24 619500 -- (-1245.122) (-1240.958) [-1242.827] (-1240.469) * (-1244.994) [-1244.455] (-1241.206) (-1241.510) -- 0:00:24 620000 -- (-1244.256) (-1241.340) (-1244.193) [-1243.649] * (-1242.979) (-1243.288) (-1243.893) [-1242.513] -- 0:00:24 Average standard deviation of split frequencies: 0.010396 620500 -- (-1247.145) (-1241.162) (-1241.388) [-1245.186] * (-1245.491) (-1243.180) [-1246.327] (-1241.136) -- 0:00:24 621000 -- (-1243.203) [-1240.874] (-1241.854) (-1242.726) * (-1243.930) (-1242.371) (-1248.222) [-1241.031] -- 0:00:24 621500 -- [-1242.289] (-1240.397) (-1244.919) (-1243.050) * (-1242.364) [-1244.422] (-1243.486) (-1241.000) -- 0:00:24 622000 -- (-1243.713) (-1241.029) [-1246.916] (-1243.008) * (-1243.295) [-1242.165] (-1243.249) (-1242.085) -- 0:00:24 622500 -- (-1242.840) [-1244.276] (-1242.145) (-1240.490) * [-1241.920] (-1242.363) (-1242.344) (-1241.724) -- 0:00:24 623000 -- (-1243.749) (-1243.220) (-1243.052) [-1244.842] * (-1243.089) (-1242.127) [-1241.131] (-1242.513) -- 0:00:24 623500 -- (-1249.141) [-1242.455] (-1241.113) (-1242.288) * [-1241.967] (-1241.937) (-1241.236) (-1242.890) -- 0:00:24 624000 -- (-1247.266) (-1245.069) [-1242.152] (-1240.677) * (-1243.988) (-1241.949) [-1240.883] (-1242.157) -- 0:00:24 624500 -- (-1244.709) (-1241.594) [-1242.781] (-1240.553) * (-1242.849) [-1241.661] (-1240.745) (-1243.794) -- 0:00:24 625000 -- (-1244.917) [-1244.469] (-1244.039) (-1240.596) * (-1245.967) (-1244.685) (-1243.911) [-1243.761] -- 0:00:24 Average standard deviation of split frequencies: 0.010731 625500 -- (-1241.259) (-1245.153) [-1242.539] (-1242.339) * (-1242.240) (-1243.147) [-1243.290] (-1242.398) -- 0:00:23 626000 -- (-1240.669) (-1248.166) [-1241.849] (-1241.091) * (-1241.930) [-1242.461] (-1245.244) (-1242.303) -- 0:00:23 626500 -- [-1241.839] (-1244.577) (-1241.434) (-1241.449) * (-1244.129) [-1240.997] (-1240.617) (-1240.641) -- 0:00:23 627000 -- [-1243.332] (-1243.078) (-1243.722) (-1248.580) * (-1244.433) [-1241.385] (-1242.972) (-1240.722) -- 0:00:23 627500 -- (-1242.834) (-1242.571) (-1245.675) [-1240.727] * (-1242.825) (-1243.565) [-1241.028] (-1242.496) -- 0:00:23 628000 -- (-1244.903) (-1242.369) (-1241.896) [-1240.724] * (-1244.669) (-1242.128) (-1240.837) [-1242.167] -- 0:00:23 628500 -- (-1241.708) (-1242.163) (-1242.032) [-1240.465] * (-1243.823) (-1242.255) [-1241.099] (-1243.864) -- 0:00:23 629000 -- (-1245.160) [-1242.328] (-1242.474) (-1241.883) * (-1246.784) (-1243.380) (-1245.370) [-1242.511] -- 0:00:23 629500 -- (-1242.619) (-1242.464) (-1241.883) [-1241.842] * (-1243.441) (-1243.943) (-1246.493) [-1243.476] -- 0:00:23 630000 -- [-1241.729] (-1241.125) (-1245.927) (-1248.983) * (-1243.431) (-1244.840) [-1242.383] (-1242.533) -- 0:00:23 Average standard deviation of split frequencies: 0.010315 630500 -- (-1243.542) [-1241.915] (-1244.645) (-1244.418) * (-1244.557) [-1247.582] (-1244.509) (-1241.877) -- 0:00:23 631000 -- (-1242.994) (-1241.315) [-1242.819] (-1242.334) * [-1240.703] (-1247.308) (-1246.134) (-1241.602) -- 0:00:23 631500 -- (-1240.934) [-1241.993] (-1243.026) (-1241.294) * (-1241.665) (-1244.935) [-1244.859] (-1243.324) -- 0:00:23 632000 -- (-1241.117) (-1241.398) [-1243.931] (-1244.595) * (-1242.528) (-1241.678) [-1242.910] (-1242.097) -- 0:00:23 632500 -- (-1241.364) (-1242.303) (-1242.516) [-1242.168] * (-1241.954) (-1241.359) [-1243.044] (-1241.369) -- 0:00:23 633000 -- (-1243.115) [-1241.772] (-1245.888) (-1241.864) * (-1245.703) (-1242.158) [-1245.205] (-1247.061) -- 0:00:23 633500 -- (-1242.967) (-1245.581) [-1241.755] (-1248.876) * [-1243.015] (-1246.330) (-1240.563) (-1243.583) -- 0:00:23 634000 -- (-1242.918) (-1242.584) (-1242.357) [-1242.793] * [-1240.995] (-1245.028) (-1242.802) (-1242.517) -- 0:00:23 634500 -- (-1240.469) [-1242.793] (-1245.285) (-1243.200) * (-1240.385) (-1241.964) (-1241.279) [-1245.406] -- 0:00:23 635000 -- (-1240.326) (-1242.853) [-1241.038] (-1246.949) * (-1241.064) [-1241.815] (-1241.299) (-1242.970) -- 0:00:23 Average standard deviation of split frequencies: 0.010278 635500 -- (-1240.792) (-1243.624) [-1243.284] (-1245.915) * [-1241.062] (-1242.749) (-1246.655) (-1241.887) -- 0:00:23 636000 -- [-1246.547] (-1242.270) (-1242.951) (-1242.951) * (-1241.423) (-1243.585) [-1241.302] (-1241.581) -- 0:00:23 636500 -- [-1243.450] (-1241.852) (-1254.147) (-1241.395) * (-1244.780) [-1243.719] (-1240.784) (-1244.332) -- 0:00:23 637000 -- [-1240.968] (-1242.036) (-1244.831) (-1243.585) * (-1241.378) (-1242.349) [-1241.111] (-1241.911) -- 0:00:23 637500 -- (-1242.052) [-1241.741] (-1244.466) (-1243.521) * (-1241.917) [-1242.149] (-1247.447) (-1242.819) -- 0:00:23 638000 -- (-1244.981) (-1241.794) [-1243.291] (-1241.669) * [-1241.506] (-1242.433) (-1240.562) (-1245.686) -- 0:00:23 638500 -- (-1243.440) (-1244.410) [-1242.794] (-1243.665) * [-1241.601] (-1241.599) (-1242.612) (-1241.880) -- 0:00:23 639000 -- [-1243.601] (-1242.325) (-1242.642) (-1244.772) * (-1241.598) [-1241.209] (-1241.486) (-1240.386) -- 0:00:23 639500 -- [-1244.750] (-1242.578) (-1242.804) (-1242.216) * (-1244.359) (-1241.454) [-1244.723] (-1241.250) -- 0:00:23 640000 -- (-1241.456) (-1241.203) [-1243.100] (-1243.370) * (-1243.488) (-1244.432) [-1250.324] (-1242.600) -- 0:00:23 Average standard deviation of split frequencies: 0.010252 640500 -- (-1242.018) [-1241.117] (-1243.882) (-1245.000) * (-1241.172) (-1244.491) [-1247.648] (-1241.447) -- 0:00:23 641000 -- [-1241.593] (-1242.571) (-1245.903) (-1246.725) * (-1241.339) (-1246.911) (-1247.358) [-1242.322] -- 0:00:22 641500 -- (-1243.284) [-1242.073] (-1245.601) (-1243.222) * (-1242.130) (-1252.171) [-1242.538] (-1243.852) -- 0:00:22 642000 -- [-1243.015] (-1243.567) (-1244.106) (-1243.631) * (-1243.433) [-1247.293] (-1244.476) (-1242.231) -- 0:00:22 642500 -- (-1243.390) (-1245.982) (-1243.624) [-1240.694] * (-1245.383) (-1247.690) [-1241.593] (-1241.750) -- 0:00:22 643000 -- (-1240.831) (-1241.987) (-1242.216) [-1242.296] * (-1243.583) (-1244.605) [-1241.593] (-1241.286) -- 0:00:22 643500 -- (-1242.969) (-1245.978) (-1240.854) [-1243.028] * (-1244.035) (-1248.090) [-1246.600] (-1241.033) -- 0:00:22 644000 -- (-1248.161) (-1243.713) [-1242.233] (-1244.073) * (-1245.367) (-1243.176) (-1244.622) [-1241.966] -- 0:00:22 644500 -- [-1242.248] (-1244.034) (-1241.967) (-1242.098) * (-1243.881) (-1243.764) (-1243.418) [-1242.928] -- 0:00:22 645000 -- [-1243.963] (-1244.229) (-1240.982) (-1241.631) * (-1243.094) (-1245.511) (-1242.915) [-1244.913] -- 0:00:22 Average standard deviation of split frequencies: 0.010313 645500 -- (-1248.211) (-1242.922) (-1244.209) [-1241.465] * (-1241.819) (-1243.348) (-1241.639) [-1243.030] -- 0:00:22 646000 -- (-1244.185) (-1242.251) (-1243.468) [-1240.961] * (-1241.632) (-1240.945) [-1242.900] (-1242.707) -- 0:00:22 646500 -- (-1241.472) (-1243.211) [-1241.839] (-1241.238) * [-1242.488] (-1244.341) (-1240.454) (-1240.793) -- 0:00:22 647000 -- (-1242.174) (-1241.773) (-1241.738) [-1241.947] * (-1240.664) (-1244.662) [-1241.567] (-1241.606) -- 0:00:22 647500 -- [-1242.184] (-1244.019) (-1241.913) (-1245.023) * (-1242.382) (-1242.875) (-1240.794) [-1241.579] -- 0:00:22 648000 -- (-1246.609) (-1245.561) (-1243.198) [-1244.470] * (-1240.547) [-1241.981] (-1243.008) (-1243.695) -- 0:00:22 648500 -- (-1244.828) (-1243.700) (-1245.092) [-1244.473] * (-1241.735) [-1243.474] (-1241.707) (-1242.467) -- 0:00:22 649000 -- (-1245.605) [-1242.916] (-1243.545) (-1244.506) * (-1244.866) (-1243.391) (-1241.283) [-1245.340] -- 0:00:22 649500 -- (-1243.631) (-1242.427) (-1241.730) [-1242.403] * (-1242.517) (-1244.665) [-1242.267] (-1247.988) -- 0:00:22 650000 -- (-1242.923) (-1242.655) [-1241.714] (-1242.232) * (-1242.237) (-1242.200) [-1241.525] (-1242.738) -- 0:00:22 Average standard deviation of split frequencies: 0.009708 650500 -- (-1243.958) [-1243.544] (-1245.184) (-1241.985) * (-1241.415) (-1244.191) (-1241.379) [-1242.581] -- 0:00:22 651000 -- [-1248.458] (-1242.110) (-1244.266) (-1241.788) * (-1241.724) (-1241.493) (-1243.848) [-1240.627] -- 0:00:22 651500 -- (-1242.264) [-1241.620] (-1241.701) (-1240.738) * (-1245.236) (-1243.148) (-1241.806) [-1241.668] -- 0:00:22 652000 -- [-1243.631] (-1243.751) (-1241.870) (-1240.780) * (-1242.594) (-1243.537) (-1241.931) [-1242.579] -- 0:00:22 652500 -- (-1244.579) (-1242.040) (-1242.547) [-1241.423] * (-1242.749) [-1243.053] (-1242.704) (-1243.818) -- 0:00:22 653000 -- (-1244.318) [-1242.603] (-1242.755) (-1242.084) * (-1241.814) [-1242.861] (-1245.393) (-1241.155) -- 0:00:22 653500 -- (-1241.541) (-1241.691) [-1241.937] (-1242.023) * (-1241.380) (-1242.138) [-1241.859] (-1242.330) -- 0:00:22 654000 -- (-1244.168) (-1242.370) (-1243.140) [-1243.743] * [-1243.894] (-1242.033) (-1241.225) (-1246.429) -- 0:00:22 654500 -- (-1240.978) (-1243.956) [-1241.130] (-1241.528) * (-1244.075) (-1242.435) [-1243.147] (-1246.522) -- 0:00:22 655000 -- (-1241.923) (-1241.922) [-1242.260] (-1244.624) * (-1241.364) (-1240.817) [-1242.179] (-1241.934) -- 0:00:22 Average standard deviation of split frequencies: 0.009965 655500 -- (-1243.072) [-1243.624] (-1241.811) (-1241.341) * [-1241.506] (-1243.500) (-1244.680) (-1242.717) -- 0:00:22 656000 -- (-1245.046) (-1243.818) [-1244.267] (-1245.182) * (-1242.106) (-1246.630) [-1241.714] (-1240.950) -- 0:00:22 656500 -- (-1245.338) (-1241.101) (-1240.599) [-1241.352] * (-1244.406) (-1250.822) (-1242.482) [-1241.160] -- 0:00:21 657000 -- (-1242.660) (-1247.603) [-1241.584] (-1241.910) * (-1243.809) (-1243.718) (-1242.044) [-1242.833] -- 0:00:21 657500 -- (-1242.916) [-1242.090] (-1245.741) (-1242.307) * [-1242.332] (-1241.474) (-1240.673) (-1244.571) -- 0:00:21 658000 -- [-1242.399] (-1240.967) (-1246.226) (-1242.301) * (-1245.273) (-1242.650) [-1241.512] (-1244.869) -- 0:00:21 658500 -- [-1244.219] (-1241.281) (-1245.002) (-1244.741) * [-1246.569] (-1244.414) (-1244.450) (-1246.899) -- 0:00:21 659000 -- (-1241.547) [-1243.320] (-1243.794) (-1243.102) * [-1240.690] (-1241.752) (-1241.543) (-1241.010) -- 0:00:21 659500 -- (-1247.885) (-1244.276) [-1240.497] (-1242.230) * [-1243.801] (-1242.099) (-1242.354) (-1244.285) -- 0:00:21 660000 -- [-1241.871] (-1243.711) (-1244.753) (-1242.372) * (-1240.820) (-1241.880) (-1242.107) [-1241.729] -- 0:00:21 Average standard deviation of split frequencies: 0.009894 660500 -- (-1242.880) (-1243.663) (-1242.270) [-1241.362] * (-1246.286) (-1243.614) [-1243.039] (-1245.122) -- 0:00:21 661000 -- [-1242.966] (-1244.039) (-1244.707) (-1242.452) * [-1243.677] (-1242.337) (-1246.037) (-1242.417) -- 0:00:21 661500 -- [-1242.686] (-1243.394) (-1242.789) (-1243.764) * (-1242.616) (-1243.333) (-1243.040) [-1241.179] -- 0:00:21 662000 -- [-1243.071] (-1243.251) (-1242.901) (-1243.353) * (-1243.712) (-1243.414) [-1240.847] (-1244.788) -- 0:00:21 662500 -- [-1242.190] (-1243.595) (-1245.152) (-1247.295) * (-1242.702) [-1245.951] (-1240.396) (-1251.264) -- 0:00:21 663000 -- (-1242.520) (-1241.694) [-1246.964] (-1245.688) * [-1242.909] (-1243.453) (-1241.073) (-1241.311) -- 0:00:21 663500 -- [-1240.693] (-1242.094) (-1242.929) (-1242.884) * (-1241.627) [-1241.384] (-1244.127) (-1241.533) -- 0:00:21 664000 -- (-1240.800) [-1242.118] (-1241.054) (-1243.084) * [-1245.237] (-1242.514) (-1242.720) (-1245.007) -- 0:00:21 664500 -- [-1240.675] (-1243.338) (-1241.600) (-1243.909) * (-1247.735) (-1242.495) [-1242.249] (-1241.323) -- 0:00:21 665000 -- (-1241.718) (-1242.292) (-1242.400) [-1242.608] * (-1242.991) [-1240.780] (-1246.429) (-1241.110) -- 0:00:21 Average standard deviation of split frequencies: 0.010334 665500 -- (-1241.718) [-1243.071] (-1241.634) (-1242.019) * (-1243.749) (-1240.872) [-1244.239] (-1242.387) -- 0:00:21 666000 -- (-1241.332) (-1240.674) [-1243.736] (-1244.488) * (-1241.040) (-1245.619) [-1243.710] (-1240.673) -- 0:00:21 666500 -- (-1241.299) (-1242.523) (-1242.849) [-1242.657] * (-1241.898) [-1246.091] (-1242.962) (-1241.135) -- 0:00:21 667000 -- (-1244.073) (-1248.205) [-1242.761] (-1242.853) * (-1242.276) (-1243.068) [-1243.155] (-1242.799) -- 0:00:21 667500 -- (-1244.556) (-1245.476) (-1241.575) [-1241.765] * (-1242.806) (-1243.592) [-1245.708] (-1242.333) -- 0:00:21 668000 -- (-1242.374) (-1243.100) [-1241.878] (-1248.340) * (-1247.934) [-1242.017] (-1241.779) (-1244.655) -- 0:00:21 668500 -- [-1244.806] (-1243.238) (-1243.661) (-1245.512) * [-1244.183] (-1243.943) (-1240.986) (-1242.468) -- 0:00:21 669000 -- (-1242.031) (-1243.263) [-1242.356] (-1245.134) * (-1242.804) (-1241.567) (-1243.054) [-1241.578] -- 0:00:21 669500 -- (-1242.521) (-1241.198) (-1241.752) [-1243.878] * (-1243.788) (-1241.926) [-1243.774] (-1241.730) -- 0:00:21 670000 -- [-1242.632] (-1243.414) (-1241.482) (-1245.168) * (-1242.821) (-1245.408) [-1241.831] (-1242.822) -- 0:00:21 Average standard deviation of split frequencies: 0.010122 670500 -- [-1243.207] (-1243.977) (-1242.646) (-1241.652) * [-1241.362] (-1243.491) (-1242.300) (-1241.899) -- 0:00:21 671000 -- (-1242.068) [-1243.359] (-1241.346) (-1242.761) * [-1241.813] (-1241.800) (-1243.539) (-1242.625) -- 0:00:21 671500 -- (-1241.065) (-1243.621) [-1242.184] (-1242.890) * (-1243.121) (-1240.950) (-1248.822) [-1246.293] -- 0:00:21 672000 -- (-1242.188) (-1242.630) (-1242.378) [-1245.383] * (-1243.288) [-1241.567] (-1246.943) (-1241.127) -- 0:00:20 672500 -- (-1243.189) (-1243.694) (-1241.447) [-1241.581] * (-1241.796) (-1245.306) [-1242.190] (-1243.194) -- 0:00:20 673000 -- (-1241.165) (-1242.471) (-1241.499) [-1241.948] * (-1244.146) [-1242.350] (-1240.490) (-1242.881) -- 0:00:20 673500 -- (-1243.367) (-1242.268) (-1242.633) [-1241.504] * [-1243.318] (-1242.980) (-1240.898) (-1241.185) -- 0:00:20 674000 -- (-1242.371) (-1244.052) (-1246.690) [-1244.824] * (-1240.571) (-1241.808) (-1242.924) [-1240.524] -- 0:00:20 674500 -- (-1243.643) [-1241.111] (-1245.275) (-1244.024) * [-1240.672] (-1242.477) (-1241.210) (-1241.251) -- 0:00:20 675000 -- (-1244.176) [-1240.640] (-1248.012) (-1249.108) * (-1240.836) [-1246.305] (-1243.130) (-1241.808) -- 0:00:20 Average standard deviation of split frequencies: 0.009902 675500 -- (-1243.638) (-1247.121) (-1250.733) [-1243.997] * (-1243.926) (-1249.838) (-1242.493) [-1241.593] -- 0:00:20 676000 -- (-1245.088) (-1244.751) (-1244.360) [-1241.957] * (-1241.996) [-1242.475] (-1242.815) (-1241.994) -- 0:00:20 676500 -- [-1242.842] (-1242.633) (-1245.918) (-1241.713) * (-1243.543) [-1242.884] (-1242.301) (-1241.888) -- 0:00:20 677000 -- [-1246.362] (-1242.531) (-1243.101) (-1248.486) * (-1244.743) (-1244.233) (-1242.929) [-1243.392] -- 0:00:20 677500 -- (-1242.545) (-1241.996) [-1242.798] (-1242.906) * [-1243.414] (-1240.989) (-1245.232) (-1241.269) -- 0:00:20 678000 -- (-1241.985) (-1240.902) (-1241.296) [-1242.852] * [-1241.639] (-1242.557) (-1248.986) (-1241.633) -- 0:00:20 678500 -- [-1243.429] (-1240.964) (-1241.462) (-1242.199) * (-1244.129) [-1242.711] (-1249.324) (-1246.452) -- 0:00:20 679000 -- [-1242.386] (-1241.348) (-1243.897) (-1249.837) * (-1244.685) (-1242.614) (-1242.055) [-1244.230] -- 0:00:20 679500 -- [-1242.080] (-1241.959) (-1243.496) (-1243.002) * (-1243.898) (-1243.492) [-1241.640] (-1246.530) -- 0:00:20 680000 -- (-1246.544) (-1247.198) [-1242.452] (-1240.680) * (-1243.023) [-1241.059] (-1243.286) (-1241.076) -- 0:00:20 Average standard deviation of split frequencies: 0.009696 680500 -- (-1243.383) (-1241.211) [-1241.644] (-1244.830) * [-1242.950] (-1243.039) (-1241.397) (-1242.456) -- 0:00:20 681000 -- [-1243.026] (-1240.737) (-1241.893) (-1242.390) * [-1242.312] (-1246.592) (-1242.108) (-1242.176) -- 0:00:20 681500 -- (-1243.582) (-1241.847) (-1246.879) [-1242.099] * [-1242.768] (-1242.659) (-1243.843) (-1244.292) -- 0:00:20 682000 -- (-1241.594) (-1242.163) [-1241.989] (-1241.254) * (-1246.789) (-1244.110) (-1242.696) [-1241.641] -- 0:00:20 682500 -- (-1241.842) (-1242.372) (-1243.145) [-1242.230] * (-1241.380) (-1241.427) (-1240.763) [-1245.271] -- 0:00:20 683000 -- (-1243.380) (-1245.805) [-1242.619] (-1243.110) * [-1243.905] (-1242.709) (-1242.941) (-1245.211) -- 0:00:20 683500 -- [-1242.634] (-1243.458) (-1243.407) (-1241.196) * (-1243.289) [-1244.144] (-1242.116) (-1243.459) -- 0:00:20 684000 -- [-1241.749] (-1242.603) (-1242.246) (-1244.229) * [-1246.189] (-1241.854) (-1241.283) (-1242.837) -- 0:00:20 684500 -- (-1244.096) (-1241.900) [-1244.817] (-1246.334) * [-1243.493] (-1243.518) (-1243.374) (-1244.103) -- 0:00:20 685000 -- (-1244.779) [-1242.293] (-1241.069) (-1241.457) * [-1243.047] (-1241.715) (-1244.541) (-1245.089) -- 0:00:20 Average standard deviation of split frequencies: 0.009666 685500 -- [-1241.590] (-1242.505) (-1241.743) (-1243.220) * [-1245.924] (-1241.635) (-1242.822) (-1247.023) -- 0:00:20 686000 -- (-1242.978) [-1243.484] (-1244.075) (-1242.059) * [-1245.090] (-1241.275) (-1241.866) (-1243.210) -- 0:00:20 686500 -- (-1245.089) [-1245.737] (-1242.621) (-1241.289) * (-1242.316) (-1245.671) (-1245.438) [-1243.284] -- 0:00:20 687000 -- (-1244.251) (-1245.429) [-1242.260] (-1240.484) * [-1241.710] (-1241.819) (-1244.014) (-1243.682) -- 0:00:20 687500 -- (-1245.264) (-1245.382) (-1244.204) [-1243.267] * (-1244.572) [-1241.612] (-1248.498) (-1250.756) -- 0:00:20 688000 -- (-1244.237) (-1247.412) (-1243.639) [-1245.255] * (-1243.176) [-1243.216] (-1242.680) (-1247.805) -- 0:00:19 688500 -- (-1248.488) (-1245.377) [-1242.350] (-1242.295) * (-1244.714) (-1241.799) [-1243.691] (-1246.171) -- 0:00:19 689000 -- (-1245.546) (-1243.806) [-1240.906] (-1242.080) * [-1243.884] (-1241.128) (-1242.995) (-1242.796) -- 0:00:19 689500 -- [-1240.975] (-1243.805) (-1243.102) (-1243.467) * (-1241.460) (-1241.058) (-1244.295) [-1242.763] -- 0:00:19 690000 -- (-1242.379) (-1243.962) (-1244.990) [-1240.469] * (-1241.530) (-1242.359) (-1242.911) [-1243.056] -- 0:00:19 Average standard deviation of split frequencies: 0.010451 690500 -- (-1245.750) (-1242.534) [-1242.589] (-1242.939) * (-1245.574) (-1243.970) (-1242.376) [-1241.873] -- 0:00:19 691000 -- (-1244.823) [-1243.706] (-1243.021) (-1243.031) * [-1244.088] (-1242.680) (-1242.576) (-1242.635) -- 0:00:19 691500 -- [-1247.687] (-1242.123) (-1243.320) (-1241.695) * (-1244.535) (-1242.170) (-1241.528) [-1244.416] -- 0:00:19 692000 -- (-1243.931) (-1243.489) (-1246.641) [-1241.816] * (-1245.407) [-1244.630] (-1241.408) (-1244.898) -- 0:00:19 692500 -- (-1243.206) [-1241.999] (-1244.987) (-1242.745) * (-1246.417) (-1242.403) [-1242.579] (-1244.658) -- 0:00:19 693000 -- (-1242.185) (-1240.540) (-1247.785) [-1245.888] * (-1242.206) [-1241.606] (-1243.193) (-1241.588) -- 0:00:19 693500 -- [-1243.599] (-1244.699) (-1243.311) (-1244.640) * [-1246.908] (-1241.061) (-1243.351) (-1243.616) -- 0:00:19 694000 -- (-1241.409) (-1246.073) [-1242.595] (-1242.687) * (-1242.673) (-1241.552) (-1245.830) [-1244.271] -- 0:00:19 694500 -- (-1241.327) [-1243.118] (-1241.700) (-1243.305) * [-1245.514] (-1241.593) (-1241.945) (-1243.602) -- 0:00:19 695000 -- (-1243.090) [-1245.095] (-1241.964) (-1243.567) * (-1242.927) (-1244.524) (-1241.690) [-1243.417] -- 0:00:19 Average standard deviation of split frequencies: 0.010541 695500 -- (-1244.057) [-1241.247] (-1243.212) (-1242.538) * [-1242.130] (-1243.849) (-1242.317) (-1243.056) -- 0:00:19 696000 -- (-1250.933) (-1241.793) [-1244.076] (-1243.635) * [-1240.748] (-1242.020) (-1240.683) (-1241.099) -- 0:00:19 696500 -- [-1242.380] (-1241.910) (-1241.389) (-1242.003) * (-1241.030) (-1242.528) (-1243.098) [-1241.358] -- 0:00:19 697000 -- (-1241.183) (-1242.250) (-1241.431) [-1242.518] * (-1242.790) (-1243.291) [-1242.520] (-1243.596) -- 0:00:19 697500 -- (-1241.110) (-1245.012) [-1241.264] (-1241.562) * (-1240.994) (-1243.893) [-1245.723] (-1242.928) -- 0:00:19 698000 -- (-1243.398) [-1241.686] (-1241.073) (-1244.949) * (-1241.753) (-1243.312) (-1243.402) [-1242.337] -- 0:00:19 698500 -- (-1242.242) [-1245.448] (-1242.349) (-1244.489) * (-1240.947) (-1245.678) [-1246.071] (-1241.379) -- 0:00:19 699000 -- [-1242.408] (-1240.608) (-1246.081) (-1242.175) * (-1243.782) (-1246.727) [-1248.259] (-1241.113) -- 0:00:19 699500 -- (-1240.437) (-1242.814) (-1242.030) [-1241.326] * (-1245.249) (-1245.364) (-1247.317) [-1241.223] -- 0:00:19 700000 -- (-1243.454) (-1242.822) [-1242.434] (-1241.885) * (-1249.310) (-1242.169) (-1245.482) [-1243.962] -- 0:00:19 Average standard deviation of split frequencies: 0.010723 700500 -- [-1242.176] (-1243.820) (-1241.235) (-1246.684) * (-1252.214) (-1246.248) (-1243.215) [-1243.696] -- 0:00:19 701000 -- (-1243.279) (-1241.370) (-1246.282) [-1242.156] * [-1246.187] (-1243.523) (-1241.799) (-1245.791) -- 0:00:19 701500 -- (-1243.889) (-1241.797) [-1243.497] (-1245.328) * [-1241.552] (-1242.392) (-1242.942) (-1248.289) -- 0:00:19 702000 -- (-1243.260) (-1240.984) (-1243.797) [-1240.691] * (-1242.864) [-1241.723] (-1245.145) (-1243.269) -- 0:00:19 702500 -- (-1241.745) (-1243.688) [-1244.343] (-1241.446) * (-1243.999) (-1241.982) (-1245.965) [-1241.489] -- 0:00:19 703000 -- [-1242.308] (-1240.474) (-1242.122) (-1247.249) * (-1244.125) [-1242.933] (-1242.061) (-1240.925) -- 0:00:19 703500 -- (-1246.538) (-1243.032) (-1243.552) [-1242.252] * (-1246.117) (-1245.245) [-1242.319] (-1243.187) -- 0:00:18 704000 -- (-1244.927) (-1245.789) (-1242.805) [-1242.790] * (-1244.050) (-1242.988) (-1248.928) [-1241.965] -- 0:00:18 704500 -- (-1241.299) (-1244.646) (-1241.872) [-1243.138] * [-1241.841] (-1243.965) (-1243.814) (-1246.073) -- 0:00:18 705000 -- [-1243.116] (-1243.024) (-1242.505) (-1242.683) * [-1245.378] (-1242.042) (-1243.251) (-1247.207) -- 0:00:18 Average standard deviation of split frequencies: 0.010308 705500 -- (-1241.690) [-1242.886] (-1242.207) (-1246.702) * [-1242.429] (-1243.597) (-1241.512) (-1246.606) -- 0:00:18 706000 -- (-1242.596) (-1241.527) [-1245.438] (-1245.300) * [-1241.033] (-1247.113) (-1241.318) (-1245.469) -- 0:00:18 706500 -- [-1242.453] (-1241.748) (-1243.629) (-1242.724) * (-1244.204) (-1245.096) [-1244.514] (-1242.130) -- 0:00:18 707000 -- [-1242.316] (-1243.686) (-1245.486) (-1241.388) * (-1243.512) (-1242.897) (-1245.904) [-1241.692] -- 0:00:18 707500 -- (-1241.808) [-1242.612] (-1253.199) (-1242.122) * (-1244.364) (-1242.276) [-1243.267] (-1243.712) -- 0:00:18 708000 -- (-1241.365) (-1242.948) (-1247.152) [-1242.348] * (-1247.551) (-1244.050) [-1242.813] (-1241.102) -- 0:00:18 708500 -- (-1242.949) [-1241.184] (-1249.246) (-1242.491) * (-1245.180) (-1242.877) [-1243.185] (-1241.304) -- 0:00:18 709000 -- (-1242.754) [-1243.922] (-1245.542) (-1244.116) * (-1242.067) (-1242.561) (-1242.491) [-1245.157] -- 0:00:18 709500 -- (-1242.050) (-1244.243) (-1244.049) [-1241.038] * (-1240.718) (-1242.378) [-1243.243] (-1249.889) -- 0:00:18 710000 -- (-1240.703) [-1242.387] (-1245.225) (-1241.390) * (-1244.477) (-1242.808) [-1242.058] (-1245.397) -- 0:00:18 Average standard deviation of split frequencies: 0.010116 710500 -- (-1242.817) [-1242.469] (-1244.341) (-1245.470) * (-1243.520) [-1247.357] (-1241.788) (-1247.701) -- 0:00:18 711000 -- [-1242.265] (-1241.999) (-1242.537) (-1242.983) * [-1241.777] (-1243.196) (-1245.185) (-1241.713) -- 0:00:18 711500 -- (-1243.729) (-1241.982) [-1241.372] (-1243.126) * (-1242.365) (-1243.396) [-1243.891] (-1241.672) -- 0:00:18 712000 -- (-1246.990) (-1244.008) (-1242.121) [-1244.274] * (-1242.412) (-1243.519) [-1241.681] (-1243.050) -- 0:00:18 712500 -- [-1244.686] (-1245.378) (-1242.647) (-1242.868) * (-1243.422) (-1246.535) (-1241.927) [-1246.629] -- 0:00:18 713000 -- (-1241.534) (-1244.368) [-1242.502] (-1244.250) * (-1241.236) (-1244.475) (-1243.701) [-1244.595] -- 0:00:18 713500 -- (-1242.176) [-1242.426] (-1241.246) (-1241.976) * [-1241.003] (-1242.064) (-1242.931) (-1245.978) -- 0:00:18 714000 -- [-1242.021] (-1246.064) (-1244.680) (-1241.275) * [-1242.649] (-1244.272) (-1245.517) (-1241.888) -- 0:00:18 714500 -- (-1242.254) (-1244.685) (-1244.667) [-1242.266] * (-1241.124) [-1245.135] (-1242.513) (-1242.581) -- 0:00:18 715000 -- (-1247.120) (-1243.499) (-1245.402) [-1242.912] * [-1242.034] (-1242.801) (-1246.662) (-1249.849) -- 0:00:18 Average standard deviation of split frequencies: 0.009629 715500 -- [-1241.130] (-1242.481) (-1242.193) (-1242.668) * [-1242.203] (-1243.726) (-1246.080) (-1242.646) -- 0:00:18 716000 -- [-1243.170] (-1241.938) (-1243.405) (-1243.590) * [-1240.814] (-1244.648) (-1245.414) (-1248.168) -- 0:00:18 716500 -- [-1242.619] (-1241.930) (-1242.469) (-1242.005) * (-1242.781) [-1242.899] (-1241.549) (-1241.094) -- 0:00:18 717000 -- (-1243.348) (-1241.910) (-1242.527) [-1240.842] * (-1243.907) [-1242.841] (-1240.982) (-1242.829) -- 0:00:18 717500 -- (-1242.422) (-1242.684) [-1242.636] (-1240.990) * [-1245.778] (-1242.473) (-1245.196) (-1245.038) -- 0:00:18 718000 -- (-1243.095) (-1242.564) [-1242.626] (-1242.008) * (-1245.305) (-1246.669) (-1242.145) [-1241.790] -- 0:00:18 718500 -- (-1244.162) (-1243.402) [-1241.657] (-1243.003) * (-1243.696) (-1247.862) (-1241.071) [-1240.987] -- 0:00:18 719000 -- (-1242.332) [-1243.240] (-1243.059) (-1242.756) * (-1247.117) (-1242.549) (-1245.050) [-1243.345] -- 0:00:17 719500 -- (-1243.192) (-1244.617) (-1243.521) [-1244.116] * [-1242.233] (-1241.173) (-1244.292) (-1243.660) -- 0:00:17 720000 -- (-1242.764) (-1245.126) (-1241.217) [-1240.856] * (-1245.364) (-1240.688) [-1242.804] (-1242.802) -- 0:00:17 Average standard deviation of split frequencies: 0.009321 720500 -- [-1242.394] (-1243.612) (-1242.895) (-1241.106) * (-1242.973) [-1240.709] (-1244.076) (-1243.133) -- 0:00:17 721000 -- (-1242.214) (-1243.409) (-1244.695) [-1241.315] * (-1241.769) (-1252.460) (-1243.694) [-1243.325] -- 0:00:17 721500 -- (-1242.847) [-1242.871] (-1241.976) (-1240.990) * (-1243.610) (-1242.687) [-1242.410] (-1241.335) -- 0:00:17 722000 -- [-1240.787] (-1242.941) (-1240.858) (-1243.113) * [-1243.249] (-1242.620) (-1245.058) (-1241.530) -- 0:00:17 722500 -- (-1242.226) (-1241.065) (-1242.497) [-1241.893] * (-1245.604) [-1242.596] (-1244.850) (-1247.001) -- 0:00:17 723000 -- (-1241.978) (-1242.270) (-1241.692) [-1241.409] * [-1242.528] (-1244.416) (-1245.830) (-1244.331) -- 0:00:17 723500 -- (-1242.291) (-1243.299) [-1242.202] (-1240.506) * (-1242.034) [-1244.163] (-1243.103) (-1243.493) -- 0:00:17 724000 -- (-1243.325) (-1245.594) (-1241.903) [-1240.502] * (-1242.040) (-1244.850) (-1241.473) [-1243.594] -- 0:00:17 724500 -- (-1245.684) (-1242.513) (-1241.941) [-1242.293] * (-1241.699) (-1244.447) [-1242.049] (-1241.540) -- 0:00:17 725000 -- (-1245.328) (-1248.285) [-1242.600] (-1243.636) * (-1243.286) [-1246.198] (-1242.513) (-1242.295) -- 0:00:17 Average standard deviation of split frequencies: 0.009172 725500 -- (-1242.347) (-1246.018) (-1245.070) [-1240.733] * (-1244.241) (-1242.186) (-1242.038) [-1242.679] -- 0:00:17 726000 -- [-1241.249] (-1243.644) (-1243.565) (-1244.336) * (-1242.336) [-1241.503] (-1243.883) (-1243.034) -- 0:00:17 726500 -- [-1241.163] (-1243.756) (-1242.114) (-1244.313) * (-1243.096) (-1245.876) (-1242.933) [-1242.128] -- 0:00:17 727000 -- [-1242.884] (-1242.433) (-1244.301) (-1244.008) * (-1242.820) [-1245.111] (-1247.963) (-1242.707) -- 0:00:17 727500 -- (-1241.342) [-1242.418] (-1243.016) (-1241.555) * (-1243.084) [-1243.350] (-1241.777) (-1243.529) -- 0:00:17 728000 -- (-1242.974) (-1241.926) (-1244.389) [-1244.154] * (-1243.503) [-1242.049] (-1241.186) (-1242.178) -- 0:00:17 728500 -- (-1245.182) (-1241.102) (-1241.824) [-1240.607] * (-1241.190) (-1241.045) (-1243.123) [-1241.689] -- 0:00:17 729000 -- (-1247.570) (-1242.092) (-1243.171) [-1241.186] * (-1242.615) (-1242.125) (-1241.630) [-1240.514] -- 0:00:17 729500 -- [-1241.026] (-1249.289) (-1243.128) (-1242.426) * (-1245.723) (-1241.409) (-1242.132) [-1241.240] -- 0:00:17 730000 -- (-1242.330) [-1241.218] (-1243.580) (-1243.578) * (-1245.057) (-1241.672) (-1242.917) [-1243.721] -- 0:00:17 Average standard deviation of split frequencies: 0.009153 730500 -- (-1241.075) (-1244.883) [-1242.153] (-1240.992) * (-1241.444) (-1245.034) (-1244.926) [-1242.724] -- 0:00:17 731000 -- (-1240.793) (-1244.324) (-1242.704) [-1243.816] * (-1246.523) (-1244.859) [-1243.208] (-1242.917) -- 0:00:17 731500 -- (-1240.734) (-1241.030) (-1245.682) [-1240.917] * (-1242.590) (-1243.593) [-1243.940] (-1246.144) -- 0:00:17 732000 -- (-1248.437) (-1243.176) (-1245.171) [-1242.877] * [-1242.484] (-1242.238) (-1242.018) (-1241.883) -- 0:00:17 732500 -- (-1248.710) (-1242.131) (-1241.633) [-1243.455] * (-1245.221) [-1241.994] (-1244.472) (-1242.442) -- 0:00:17 733000 -- (-1249.570) [-1241.002] (-1242.338) (-1243.068) * (-1244.533) (-1244.554) (-1242.111) [-1242.660] -- 0:00:17 733500 -- (-1241.128) (-1243.677) [-1241.708] (-1245.330) * (-1241.229) [-1243.123] (-1246.263) (-1242.717) -- 0:00:17 734000 -- [-1242.017] (-1242.692) (-1244.769) (-1245.007) * (-1243.408) [-1244.100] (-1240.817) (-1240.805) -- 0:00:17 734500 -- (-1244.748) (-1241.763) [-1241.832] (-1245.606) * (-1245.034) [-1241.967] (-1243.988) (-1241.149) -- 0:00:16 735000 -- (-1242.537) (-1243.471) [-1240.811] (-1245.279) * (-1241.996) [-1242.292] (-1241.160) (-1240.989) -- 0:00:16 Average standard deviation of split frequencies: 0.008882 735500 -- (-1242.095) [-1242.375] (-1242.483) (-1243.137) * [-1241.572] (-1243.686) (-1241.025) (-1242.424) -- 0:00:16 736000 -- (-1243.373) (-1246.262) (-1243.229) [-1240.646] * [-1246.513] (-1243.113) (-1242.266) (-1241.244) -- 0:00:16 736500 -- [-1242.782] (-1249.941) (-1242.451) (-1241.802) * (-1243.890) (-1242.742) [-1243.036] (-1241.832) -- 0:00:16 737000 -- (-1241.525) (-1240.701) (-1240.463) [-1242.643] * (-1243.041) [-1243.596] (-1243.281) (-1243.792) -- 0:00:16 737500 -- (-1242.546) (-1244.366) (-1240.577) [-1240.654] * [-1244.478] (-1241.254) (-1242.694) (-1244.656) -- 0:00:16 738000 -- (-1241.751) (-1242.393) (-1240.576) [-1242.142] * (-1244.226) (-1241.863) [-1242.784] (-1241.919) -- 0:00:16 738500 -- (-1241.008) (-1241.165) (-1241.105) [-1240.829] * (-1241.898) (-1247.330) [-1241.854] (-1242.119) -- 0:00:16 739000 -- (-1243.367) [-1243.784] (-1243.225) (-1243.490) * (-1244.228) (-1246.536) (-1242.294) [-1242.013] -- 0:00:16 739500 -- (-1244.756) (-1242.078) [-1243.224] (-1243.930) * (-1242.690) [-1242.896] (-1243.690) (-1240.707) -- 0:00:16 740000 -- (-1243.883) (-1243.215) (-1241.206) [-1242.129] * [-1240.921] (-1242.633) (-1241.481) (-1241.063) -- 0:00:16 Average standard deviation of split frequencies: 0.009420 740500 -- (-1241.618) (-1246.515) (-1242.943) [-1241.769] * (-1245.943) (-1240.709) [-1246.172] (-1241.462) -- 0:00:16 741000 -- (-1243.019) (-1252.385) [-1244.721] (-1241.486) * (-1250.433) (-1246.187) [-1243.298] (-1243.622) -- 0:00:16 741500 -- (-1241.549) (-1246.771) (-1243.303) [-1247.633] * (-1244.591) (-1243.593) (-1245.004) [-1240.951] -- 0:00:16 742000 -- (-1240.851) (-1244.126) (-1248.098) [-1245.615] * [-1244.473] (-1240.881) (-1243.096) (-1242.182) -- 0:00:16 742500 -- [-1240.917] (-1243.946) (-1245.331) (-1242.204) * (-1246.330) [-1240.758] (-1242.518) (-1242.645) -- 0:00:16 743000 -- (-1244.292) (-1242.798) [-1241.961] (-1241.638) * (-1249.422) (-1242.709) [-1243.338] (-1241.496) -- 0:00:16 743500 -- (-1245.055) [-1241.714] (-1242.490) (-1243.122) * (-1243.880) (-1242.394) [-1241.361] (-1240.900) -- 0:00:16 744000 -- (-1242.981) (-1242.111) [-1241.575] (-1243.737) * (-1244.929) (-1241.343) (-1240.984) [-1243.185] -- 0:00:16 744500 -- (-1242.921) (-1245.361) [-1241.982] (-1242.817) * [-1240.435] (-1243.566) (-1243.376) (-1241.465) -- 0:00:16 745000 -- (-1240.758) (-1244.616) [-1240.298] (-1244.591) * (-1240.435) (-1241.502) [-1244.040] (-1243.122) -- 0:00:16 Average standard deviation of split frequencies: 0.009479 745500 -- (-1244.747) (-1246.664) [-1242.115] (-1244.435) * (-1240.773) (-1244.113) [-1243.103] (-1245.245) -- 0:00:16 746000 -- (-1242.505) (-1245.228) [-1240.682] (-1243.615) * (-1240.850) (-1241.557) (-1242.255) [-1241.717] -- 0:00:16 746500 -- (-1241.312) (-1243.397) (-1240.921) [-1242.207] * (-1242.966) (-1242.285) (-1242.970) [-1244.243] -- 0:00:16 747000 -- (-1242.177) (-1241.319) [-1242.491] (-1241.042) * (-1240.996) (-1250.275) [-1241.507] (-1242.376) -- 0:00:16 747500 -- (-1242.728) (-1243.276) (-1242.518) [-1241.738] * [-1241.362] (-1243.132) (-1242.200) (-1243.417) -- 0:00:16 748000 -- (-1241.945) (-1241.556) (-1241.157) [-1240.651] * [-1241.424] (-1241.264) (-1241.191) (-1245.137) -- 0:00:16 748500 -- (-1244.156) [-1241.504] (-1242.284) (-1243.226) * [-1240.473] (-1243.647) (-1245.727) (-1245.433) -- 0:00:16 749000 -- (-1246.419) [-1241.455] (-1243.097) (-1249.927) * [-1240.870] (-1242.065) (-1244.566) (-1244.717) -- 0:00:16 749500 -- (-1247.965) (-1241.581) (-1243.498) [-1241.983] * (-1240.772) (-1242.344) (-1242.805) [-1242.298] -- 0:00:16 750000 -- (-1244.741) (-1243.722) [-1243.628] (-1242.246) * (-1243.070) (-1243.427) [-1243.685] (-1241.093) -- 0:00:16 Average standard deviation of split frequencies: 0.009671 750500 -- (-1247.579) (-1245.268) (-1241.820) [-1242.347] * (-1241.130) (-1241.846) (-1245.018) [-1252.103] -- 0:00:15 751000 -- (-1244.024) (-1243.906) [-1242.028] (-1240.849) * (-1241.160) (-1243.120) (-1245.778) [-1247.319] -- 0:00:15 751500 -- (-1244.728) [-1242.647] (-1243.546) (-1240.964) * (-1250.201) (-1242.240) (-1247.036) [-1242.641] -- 0:00:15 752000 -- (-1242.147) [-1240.586] (-1241.835) (-1242.017) * (-1241.562) [-1241.817] (-1247.735) (-1244.036) -- 0:00:15 752500 -- (-1245.114) [-1240.789] (-1243.062) (-1240.890) * (-1241.970) (-1241.335) [-1242.067] (-1245.406) -- 0:00:15 753000 -- (-1242.311) (-1240.596) [-1243.538] (-1246.303) * (-1240.555) [-1241.393] (-1240.959) (-1244.703) -- 0:00:15 753500 -- [-1241.664] (-1242.313) (-1246.584) (-1247.698) * (-1241.176) [-1240.842] (-1241.700) (-1240.846) -- 0:00:15 754000 -- (-1241.163) (-1242.375) (-1245.389) [-1244.823] * (-1243.728) [-1242.141] (-1241.992) (-1242.072) -- 0:00:15 754500 -- (-1241.780) (-1243.222) (-1240.508) [-1242.937] * (-1241.390) (-1247.392) [-1241.289] (-1243.593) -- 0:00:15 755000 -- [-1240.931] (-1247.583) (-1244.385) (-1243.314) * (-1242.689) (-1244.471) (-1241.919) [-1242.880] -- 0:00:15 Average standard deviation of split frequencies: 0.009436 755500 -- [-1241.682] (-1243.084) (-1240.919) (-1246.471) * (-1242.607) (-1243.607) (-1245.325) [-1241.927] -- 0:00:15 756000 -- (-1243.457) [-1242.611] (-1242.609) (-1242.885) * [-1241.721] (-1242.944) (-1244.595) (-1243.252) -- 0:00:15 756500 -- [-1244.073] (-1241.990) (-1242.128) (-1241.288) * (-1240.778) (-1244.842) (-1244.381) [-1241.407] -- 0:00:15 757000 -- (-1244.746) (-1242.182) (-1244.881) [-1242.368] * [-1240.969] (-1244.058) (-1243.327) (-1241.032) -- 0:00:15 757500 -- [-1243.199] (-1243.312) (-1243.385) (-1241.771) * (-1242.278) (-1247.962) (-1245.888) [-1241.218] -- 0:00:15 758000 -- (-1240.683) (-1241.265) (-1246.274) [-1244.550] * (-1243.695) (-1247.659) [-1241.718] (-1241.717) -- 0:00:15 758500 -- (-1241.181) (-1242.236) (-1245.835) [-1245.590] * [-1240.930] (-1246.628) (-1242.386) (-1241.688) -- 0:00:15 759000 -- (-1241.084) (-1241.330) [-1244.108] (-1241.109) * (-1242.972) [-1244.377] (-1243.927) (-1242.441) -- 0:00:15 759500 -- [-1240.432] (-1245.772) (-1245.414) (-1241.543) * (-1242.415) (-1240.839) [-1240.987] (-1243.805) -- 0:00:15 760000 -- (-1242.143) (-1250.685) (-1241.491) [-1242.257] * (-1241.972) (-1240.466) (-1241.982) [-1244.119] -- 0:00:15 Average standard deviation of split frequencies: 0.009296 760500 -- (-1245.170) (-1245.285) [-1241.473] (-1241.445) * (-1242.788) [-1240.519] (-1242.996) (-1243.477) -- 0:00:15 761000 -- (-1243.461) [-1241.397] (-1244.145) (-1241.666) * (-1241.615) [-1241.576] (-1244.537) (-1242.902) -- 0:00:15 761500 -- (-1244.150) (-1243.194) [-1244.970] (-1242.073) * [-1244.378] (-1246.864) (-1243.928) (-1243.907) -- 0:00:15 762000 -- (-1243.287) (-1243.994) [-1243.398] (-1243.242) * (-1241.944) (-1240.635) (-1242.326) [-1242.719] -- 0:00:15 762500 -- (-1241.795) [-1245.148] (-1242.409) (-1243.739) * (-1243.931) (-1240.363) [-1242.215] (-1241.354) -- 0:00:15 763000 -- [-1244.176] (-1243.911) (-1242.520) (-1241.340) * (-1242.600) [-1241.121] (-1243.094) (-1241.151) -- 0:00:15 763500 -- (-1241.596) [-1243.673] (-1246.201) (-1243.646) * [-1243.546] (-1246.568) (-1242.270) (-1243.876) -- 0:00:15 764000 -- [-1240.680] (-1242.462) (-1243.903) (-1242.354) * (-1242.972) (-1242.296) [-1241.370] (-1242.254) -- 0:00:15 764500 -- (-1243.011) (-1242.466) [-1244.575] (-1245.963) * (-1241.349) (-1246.194) [-1241.792] (-1242.254) -- 0:00:15 765000 -- (-1243.604) (-1241.338) [-1243.818] (-1242.285) * (-1243.907) [-1242.947] (-1242.821) (-1243.218) -- 0:00:15 Average standard deviation of split frequencies: 0.008985 765500 -- (-1247.077) (-1241.877) (-1243.221) [-1243.953] * (-1244.429) [-1243.564] (-1243.361) (-1240.808) -- 0:00:15 766000 -- (-1240.266) (-1244.568) (-1244.695) [-1247.391] * (-1245.696) (-1244.038) (-1248.706) [-1244.722] -- 0:00:14 766500 -- (-1240.680) (-1241.227) [-1246.511] (-1242.937) * (-1245.046) (-1248.487) [-1241.097] (-1245.704) -- 0:00:14 767000 -- [-1241.660] (-1241.924) (-1245.056) (-1243.809) * (-1242.793) [-1247.610] (-1243.386) (-1245.705) -- 0:00:14 767500 -- (-1241.556) (-1244.825) (-1244.770) [-1243.074] * (-1241.482) (-1247.070) (-1248.964) [-1242.328] -- 0:00:14 768000 -- [-1241.508] (-1247.708) (-1241.686) (-1246.423) * (-1242.394) (-1244.629) (-1242.465) [-1242.132] -- 0:00:14 768500 -- (-1246.762) [-1241.732] (-1240.785) (-1240.997) * (-1242.393) [-1241.535] (-1242.767) (-1241.280) -- 0:00:14 769000 -- [-1242.621] (-1241.677) (-1241.827) (-1243.091) * [-1242.258] (-1242.199) (-1247.568) (-1242.298) -- 0:00:14 769500 -- (-1242.522) (-1243.045) [-1243.713] (-1241.500) * [-1241.464] (-1243.242) (-1244.587) (-1245.881) -- 0:00:14 770000 -- (-1243.096) (-1245.392) (-1241.751) [-1241.467] * [-1241.870] (-1241.803) (-1244.538) (-1241.469) -- 0:00:14 Average standard deviation of split frequencies: 0.008604 770500 -- (-1241.214) (-1241.329) (-1241.718) [-1243.452] * [-1241.689] (-1241.106) (-1241.613) (-1247.590) -- 0:00:14 771000 -- (-1243.174) [-1243.566] (-1241.049) (-1242.551) * (-1245.358) (-1242.352) (-1241.734) [-1243.592] -- 0:00:14 771500 -- (-1241.250) (-1244.135) [-1242.638] (-1240.462) * [-1242.243] (-1242.248) (-1242.435) (-1246.051) -- 0:00:14 772000 -- (-1242.042) (-1243.244) (-1242.522) [-1241.592] * (-1242.236) [-1242.838] (-1242.025) (-1245.054) -- 0:00:14 772500 -- (-1241.261) (-1243.352) (-1242.512) [-1241.492] * (-1243.316) (-1243.692) [-1245.337] (-1245.758) -- 0:00:14 773000 -- (-1248.122) [-1244.285] (-1242.029) (-1244.869) * (-1245.260) [-1244.213] (-1243.285) (-1247.858) -- 0:00:14 773500 -- (-1242.638) (-1243.260) [-1241.459] (-1242.531) * (-1242.672) [-1243.862] (-1243.574) (-1245.595) -- 0:00:14 774000 -- [-1241.921] (-1242.613) (-1243.681) (-1241.376) * (-1247.196) (-1243.406) (-1243.677) [-1243.887] -- 0:00:14 774500 -- (-1243.679) (-1242.655) (-1241.880) [-1241.435] * (-1243.578) (-1241.420) [-1240.991] (-1245.221) -- 0:00:14 775000 -- [-1241.722] (-1242.959) (-1241.165) (-1241.003) * (-1244.431) [-1241.757] (-1241.193) (-1243.249) -- 0:00:14 Average standard deviation of split frequencies: 0.008950 775500 -- [-1243.848] (-1242.727) (-1241.301) (-1244.623) * (-1243.816) [-1241.328] (-1248.568) (-1240.852) -- 0:00:14 776000 -- [-1243.431] (-1242.386) (-1244.017) (-1242.962) * (-1246.188) [-1241.148] (-1242.874) (-1240.651) -- 0:00:14 776500 -- [-1243.174] (-1241.935) (-1242.377) (-1248.815) * [-1244.219] (-1243.167) (-1243.398) (-1242.174) -- 0:00:14 777000 -- (-1242.071) [-1245.228] (-1242.736) (-1246.536) * (-1244.042) [-1242.745] (-1242.227) (-1242.613) -- 0:00:14 777500 -- (-1241.446) (-1241.687) [-1241.306] (-1245.469) * (-1244.921) (-1244.124) [-1243.604] (-1240.594) -- 0:00:14 778000 -- (-1243.207) (-1242.208) [-1241.940] (-1245.960) * (-1241.893) [-1244.591] (-1244.157) (-1240.790) -- 0:00:14 778500 -- (-1242.927) (-1243.793) [-1242.818] (-1245.722) * (-1241.232) [-1242.338] (-1246.013) (-1242.601) -- 0:00:14 779000 -- (-1247.603) (-1242.911) [-1240.905] (-1248.957) * (-1240.589) [-1244.936] (-1246.635) (-1245.367) -- 0:00:14 779500 -- (-1243.421) [-1244.942] (-1246.111) (-1242.579) * (-1246.695) (-1240.725) [-1243.686] (-1245.271) -- 0:00:14 780000 -- (-1244.220) (-1242.854) [-1243.865] (-1241.849) * (-1241.338) [-1241.909] (-1244.126) (-1241.241) -- 0:00:14 Average standard deviation of split frequencies: 0.008695 780500 -- (-1243.695) (-1243.305) (-1246.499) [-1242.378] * (-1249.025) (-1243.110) [-1242.004] (-1243.212) -- 0:00:14 781000 -- (-1244.678) (-1240.354) [-1243.466] (-1241.348) * (-1241.904) (-1245.690) (-1243.002) [-1241.393] -- 0:00:14 781500 -- (-1242.634) (-1241.417) [-1242.686] (-1241.636) * [-1242.265] (-1248.062) (-1241.202) (-1243.869) -- 0:00:13 782000 -- (-1243.993) (-1240.917) [-1245.144] (-1242.699) * (-1243.081) (-1242.147) (-1241.652) [-1243.755] -- 0:00:13 782500 -- (-1248.118) (-1242.601) (-1248.000) [-1240.641] * (-1247.422) (-1240.810) [-1241.142] (-1242.283) -- 0:00:13 783000 -- (-1244.708) (-1243.589) [-1241.697] (-1241.337) * (-1241.109) (-1241.499) (-1242.781) [-1241.912] -- 0:00:13 783500 -- (-1244.104) (-1241.498) (-1247.378) [-1242.382] * (-1241.329) (-1241.136) (-1240.779) [-1242.506] -- 0:00:13 784000 -- (-1242.290) (-1242.545) (-1244.828) [-1244.197] * (-1242.814) (-1243.541) [-1244.596] (-1240.658) -- 0:00:13 784500 -- (-1242.743) (-1242.496) (-1244.504) [-1244.200] * (-1243.691) (-1242.331) (-1243.244) [-1242.525] -- 0:00:13 785000 -- (-1241.891) (-1241.468) [-1250.633] (-1241.950) * (-1241.775) [-1247.787] (-1242.494) (-1242.554) -- 0:00:13 Average standard deviation of split frequencies: 0.008756 785500 -- (-1241.161) (-1242.615) [-1243.749] (-1243.533) * (-1244.675) [-1243.393] (-1242.623) (-1244.343) -- 0:00:13 786000 -- (-1245.740) (-1245.174) (-1242.657) [-1245.868] * [-1242.916] (-1242.800) (-1241.978) (-1245.337) -- 0:00:13 786500 -- [-1241.235] (-1244.853) (-1241.570) (-1242.821) * (-1242.303) (-1242.429) [-1242.147] (-1245.414) -- 0:00:13 787000 -- (-1245.353) (-1241.039) [-1241.307] (-1242.748) * (-1243.473) [-1242.099] (-1240.544) (-1244.240) -- 0:00:13 787500 -- (-1243.304) [-1240.887] (-1242.495) (-1241.543) * [-1241.208] (-1244.886) (-1240.945) (-1243.297) -- 0:00:13 788000 -- (-1244.593) (-1240.698) [-1242.130] (-1243.925) * (-1241.106) (-1243.164) [-1241.561] (-1243.170) -- 0:00:13 788500 -- (-1241.828) (-1242.616) (-1241.433) [-1243.912] * [-1242.667] (-1242.700) (-1246.093) (-1242.356) -- 0:00:13 789000 -- (-1242.223) [-1242.091] (-1243.808) (-1244.654) * (-1245.280) (-1244.491) (-1246.809) [-1240.810] -- 0:00:13 789500 -- [-1245.175] (-1243.550) (-1241.875) (-1244.495) * (-1241.491) [-1244.041] (-1251.571) (-1244.874) -- 0:00:13 790000 -- (-1242.939) (-1242.820) (-1244.606) [-1241.203] * [-1242.039] (-1244.921) (-1241.261) (-1241.682) -- 0:00:13 Average standard deviation of split frequencies: 0.008546 790500 -- (-1243.154) (-1241.135) (-1244.027) [-1241.455] * (-1243.782) (-1242.939) (-1241.420) [-1244.451] -- 0:00:13 791000 -- (-1244.008) [-1241.783] (-1243.814) (-1246.603) * (-1244.072) [-1243.065] (-1241.886) (-1242.234) -- 0:00:13 791500 -- (-1241.306) (-1243.215) [-1241.668] (-1252.463) * [-1243.436] (-1241.307) (-1244.626) (-1241.665) -- 0:00:13 792000 -- (-1241.066) (-1240.558) (-1242.554) [-1243.269] * [-1243.727] (-1244.290) (-1244.733) (-1246.090) -- 0:00:13 792500 -- (-1241.491) (-1241.607) [-1242.515] (-1245.080) * (-1245.532) (-1242.261) (-1247.021) [-1240.867] -- 0:00:13 793000 -- (-1245.510) (-1240.681) (-1243.775) [-1246.880] * (-1244.348) [-1244.813] (-1242.832) (-1242.333) -- 0:00:13 793500 -- [-1242.115] (-1242.305) (-1243.794) (-1245.768) * (-1246.886) (-1243.728) [-1241.911] (-1241.393) -- 0:00:13 794000 -- (-1241.558) [-1245.412] (-1241.225) (-1245.757) * (-1246.526) (-1243.295) [-1244.223] (-1241.001) -- 0:00:13 794500 -- (-1242.773) (-1244.742) [-1241.735] (-1242.489) * [-1241.723] (-1242.608) (-1243.518) (-1243.204) -- 0:00:13 795000 -- (-1242.181) [-1243.667] (-1243.554) (-1242.668) * (-1243.537) (-1241.468) (-1245.944) [-1243.046] -- 0:00:13 Average standard deviation of split frequencies: 0.008133 795500 -- [-1242.152] (-1243.785) (-1241.096) (-1243.535) * (-1243.241) (-1245.161) [-1245.013] (-1241.112) -- 0:00:13 796000 -- [-1243.480] (-1240.968) (-1241.736) (-1246.782) * (-1243.195) [-1242.657] (-1245.936) (-1242.106) -- 0:00:13 796500 -- (-1245.310) [-1243.304] (-1243.086) (-1249.297) * (-1247.056) (-1242.376) (-1243.997) [-1242.190] -- 0:00:13 797000 -- (-1244.426) (-1243.012) [-1241.827] (-1247.583) * (-1242.166) (-1240.885) (-1244.204) [-1243.258] -- 0:00:12 797500 -- [-1242.627] (-1242.746) (-1244.485) (-1243.082) * (-1241.384) [-1241.592] (-1245.110) (-1241.714) -- 0:00:12 798000 -- (-1244.327) (-1243.956) [-1241.661] (-1243.232) * [-1242.345] (-1241.861) (-1242.647) (-1242.225) -- 0:00:12 798500 -- (-1244.906) [-1242.317] (-1241.369) (-1241.997) * (-1247.808) (-1243.858) [-1240.655] (-1245.198) -- 0:00:12 799000 -- (-1241.703) (-1242.598) [-1242.170] (-1243.876) * (-1245.863) [-1244.190] (-1242.992) (-1249.203) -- 0:00:12 799500 -- [-1241.590] (-1243.318) (-1241.062) (-1241.305) * (-1245.294) (-1242.611) [-1242.825] (-1243.201) -- 0:00:12 800000 -- [-1242.654] (-1243.323) (-1241.010) (-1242.241) * (-1242.203) [-1243.117] (-1242.722) (-1244.465) -- 0:00:12 Average standard deviation of split frequencies: 0.008086 800500 -- (-1244.255) (-1247.018) [-1241.323] (-1244.343) * (-1241.837) [-1241.958] (-1243.187) (-1240.915) -- 0:00:12 801000 -- [-1244.029] (-1246.954) (-1242.289) (-1241.271) * [-1244.091] (-1242.011) (-1241.509) (-1244.490) -- 0:00:12 801500 -- [-1245.953] (-1243.403) (-1242.367) (-1250.232) * [-1241.268] (-1244.164) (-1247.943) (-1240.846) -- 0:00:12 802000 -- (-1241.784) (-1244.266) [-1241.185] (-1244.142) * [-1240.478] (-1242.170) (-1247.833) (-1242.427) -- 0:00:12 802500 -- (-1241.511) (-1242.727) [-1241.592] (-1243.327) * [-1243.473] (-1243.908) (-1246.918) (-1243.102) -- 0:00:12 803000 -- (-1243.541) [-1242.921] (-1241.682) (-1243.082) * (-1243.985) [-1243.108] (-1242.534) (-1242.123) -- 0:00:12 803500 -- [-1240.816] (-1242.144) (-1242.097) (-1244.531) * (-1243.824) (-1242.223) (-1241.515) [-1241.472] -- 0:00:12 804000 -- (-1240.356) [-1243.368] (-1242.296) (-1243.730) * (-1246.199) (-1241.173) [-1241.982] (-1243.479) -- 0:00:12 804500 -- [-1240.357] (-1240.888) (-1245.481) (-1243.856) * (-1245.072) (-1243.440) [-1241.361] (-1244.363) -- 0:00:12 805000 -- (-1240.895) [-1243.520] (-1241.378) (-1241.136) * (-1245.484) (-1242.771) (-1241.404) [-1241.550] -- 0:00:12 Average standard deviation of split frequencies: 0.008005 805500 -- (-1243.174) (-1245.469) [-1242.679] (-1243.506) * (-1250.193) (-1242.633) [-1242.222] (-1242.027) -- 0:00:12 806000 -- [-1243.803] (-1242.099) (-1242.521) (-1242.728) * (-1240.873) (-1242.771) (-1241.155) [-1242.049] -- 0:00:12 806500 -- (-1243.332) (-1241.609) (-1241.068) [-1242.785] * (-1241.812) (-1242.446) (-1243.102) [-1248.218] -- 0:00:12 807000 -- [-1244.904] (-1243.087) (-1241.816) (-1242.744) * (-1243.765) (-1244.625) [-1241.624] (-1246.674) -- 0:00:12 807500 -- [-1240.973] (-1244.112) (-1242.835) (-1240.790) * (-1241.515) (-1241.783) [-1242.144] (-1245.050) -- 0:00:12 808000 -- [-1241.253] (-1244.937) (-1242.172) (-1243.134) * [-1241.277] (-1244.095) (-1241.310) (-1241.555) -- 0:00:12 808500 -- (-1241.288) [-1242.471] (-1241.917) (-1244.663) * [-1240.994] (-1243.969) (-1244.031) (-1242.925) -- 0:00:12 809000 -- (-1242.304) [-1242.000] (-1242.349) (-1244.552) * [-1241.248] (-1242.377) (-1244.034) (-1241.966) -- 0:00:12 809500 -- [-1241.361] (-1242.183) (-1242.655) (-1245.710) * (-1242.794) (-1243.092) [-1243.317] (-1241.693) -- 0:00:12 810000 -- (-1242.095) [-1244.882] (-1243.150) (-1244.450) * (-1241.486) (-1245.448) (-1244.263) [-1241.586] -- 0:00:12 Average standard deviation of split frequencies: 0.007850 810500 -- (-1243.010) (-1242.375) (-1240.623) [-1242.996] * [-1242.949] (-1245.027) (-1245.326) (-1244.455) -- 0:00:12 811000 -- (-1241.778) (-1241.276) [-1242.930] (-1242.059) * (-1241.514) (-1243.354) (-1243.907) [-1240.759] -- 0:00:12 811500 -- (-1241.926) [-1241.714] (-1241.525) (-1243.917) * (-1243.644) (-1242.306) (-1244.557) [-1243.565] -- 0:00:12 812000 -- (-1242.073) (-1241.314) [-1242.316] (-1241.755) * (-1242.027) [-1240.776] (-1240.560) (-1242.502) -- 0:00:12 812500 -- [-1242.650] (-1241.255) (-1243.115) (-1242.627) * (-1242.922) [-1240.537] (-1242.501) (-1242.993) -- 0:00:12 813000 -- [-1243.556] (-1242.084) (-1247.303) (-1243.040) * (-1241.299) [-1241.694] (-1245.455) (-1242.561) -- 0:00:11 813500 -- [-1242.159] (-1242.243) (-1241.498) (-1243.904) * (-1242.245) (-1241.198) (-1246.482) [-1241.740] -- 0:00:11 814000 -- (-1242.233) [-1242.249] (-1242.474) (-1244.001) * [-1240.956] (-1242.485) (-1241.133) (-1243.204) -- 0:00:11 814500 -- (-1242.570) (-1241.706) [-1244.714] (-1245.106) * (-1244.521) [-1242.016] (-1240.547) (-1247.498) -- 0:00:11 815000 -- [-1243.544] (-1241.713) (-1244.406) (-1243.151) * (-1245.597) (-1243.647) (-1240.707) [-1247.576] -- 0:00:11 Average standard deviation of split frequencies: 0.007972 815500 -- (-1248.912) (-1242.070) [-1243.841] (-1242.107) * (-1241.495) [-1241.949] (-1241.741) (-1247.952) -- 0:00:11 816000 -- [-1246.531] (-1241.565) (-1241.413) (-1245.232) * [-1245.245] (-1242.482) (-1242.844) (-1246.161) -- 0:00:11 816500 -- [-1240.980] (-1243.109) (-1242.842) (-1245.053) * (-1242.875) [-1241.568] (-1244.977) (-1248.507) -- 0:00:11 817000 -- (-1240.960) [-1240.878] (-1246.414) (-1244.555) * (-1241.651) (-1241.823) [-1241.686] (-1243.494) -- 0:00:11 817500 -- (-1241.009) (-1242.938) (-1241.669) [-1246.127] * (-1242.684) (-1240.839) [-1243.923] (-1242.277) -- 0:00:11 818000 -- [-1241.753] (-1244.693) (-1242.298) (-1245.344) * [-1242.111] (-1241.410) (-1244.060) (-1243.578) -- 0:00:11 818500 -- (-1242.650) (-1241.914) (-1242.843) [-1241.109] * [-1241.500] (-1241.254) (-1244.129) (-1242.561) -- 0:00:11 819000 -- (-1240.795) (-1241.429) (-1246.049) [-1242.589] * (-1241.056) (-1243.640) (-1243.819) [-1243.199] -- 0:00:11 819500 -- [-1243.307] (-1243.309) (-1242.840) (-1242.434) * (-1241.056) (-1240.655) (-1244.170) [-1243.917] -- 0:00:11 820000 -- (-1245.845) (-1242.677) (-1243.810) [-1242.031] * [-1241.735] (-1243.034) (-1241.115) (-1245.742) -- 0:00:11 Average standard deviation of split frequencies: 0.008293 820500 -- (-1244.228) [-1243.397] (-1242.156) (-1241.856) * (-1241.403) (-1243.923) [-1243.037] (-1241.609) -- 0:00:11 821000 -- (-1241.863) [-1241.473] (-1246.758) (-1240.853) * (-1240.995) [-1241.943] (-1243.439) (-1243.466) -- 0:00:11 821500 -- [-1242.046] (-1241.247) (-1250.607) (-1241.882) * (-1241.142) (-1242.183) (-1241.352) [-1244.886] -- 0:00:11 822000 -- (-1241.918) (-1244.255) [-1246.943] (-1241.120) * [-1241.152] (-1241.523) (-1244.314) (-1241.636) -- 0:00:11 822500 -- (-1242.367) (-1240.542) [-1240.938] (-1245.355) * (-1241.920) (-1242.464) (-1244.647) [-1241.486] -- 0:00:11 823000 -- [-1242.100] (-1243.141) (-1242.592) (-1245.070) * (-1241.335) (-1242.390) (-1242.191) [-1243.639] -- 0:00:11 823500 -- (-1241.391) (-1242.213) [-1241.205] (-1242.953) * (-1241.338) [-1243.566] (-1243.783) (-1242.221) -- 0:00:11 824000 -- (-1242.411) (-1243.945) [-1244.020] (-1246.168) * [-1243.154] (-1242.579) (-1241.337) (-1243.684) -- 0:00:11 824500 -- (-1245.724) [-1245.205] (-1240.952) (-1243.596) * (-1240.808) [-1244.136] (-1242.656) (-1245.042) -- 0:00:11 825000 -- (-1241.402) [-1241.317] (-1242.154) (-1241.717) * (-1241.661) [-1243.826] (-1242.367) (-1246.313) -- 0:00:11 Average standard deviation of split frequencies: 0.008168 825500 -- (-1243.036) (-1242.301) [-1242.751] (-1243.552) * (-1241.338) [-1241.221] (-1242.315) (-1243.202) -- 0:00:10 826000 -- (-1241.391) [-1241.529] (-1240.873) (-1248.782) * (-1242.377) (-1241.773) (-1241.928) [-1240.884] -- 0:00:11 826500 -- (-1242.978) [-1245.520] (-1242.833) (-1245.618) * [-1242.498] (-1241.924) (-1242.712) (-1241.177) -- 0:00:11 827000 -- [-1242.648] (-1241.847) (-1243.234) (-1242.727) * (-1243.282) [-1240.891] (-1242.300) (-1242.040) -- 0:00:11 827500 -- [-1244.493] (-1244.182) (-1241.099) (-1243.467) * [-1245.127] (-1241.293) (-1243.807) (-1241.562) -- 0:00:11 828000 -- [-1242.954] (-1241.726) (-1245.093) (-1240.622) * (-1242.767) [-1241.610] (-1243.420) (-1242.873) -- 0:00:11 828500 -- (-1244.418) (-1242.987) (-1241.442) [-1240.521] * (-1244.148) [-1241.823] (-1245.233) (-1241.484) -- 0:00:10 829000 -- (-1243.065) (-1243.269) [-1240.661] (-1243.421) * [-1240.764] (-1244.025) (-1243.332) (-1241.320) -- 0:00:10 829500 -- (-1241.603) [-1243.091] (-1243.063) (-1243.588) * [-1240.997] (-1242.586) (-1243.829) (-1246.547) -- 0:00:10 830000 -- (-1247.016) (-1244.687) [-1242.826] (-1243.994) * (-1242.777) (-1242.376) (-1241.877) [-1244.084] -- 0:00:10 Average standard deviation of split frequencies: 0.008016 830500 -- [-1244.752] (-1243.237) (-1244.974) (-1241.565) * (-1242.946) (-1242.101) [-1242.476] (-1243.186) -- 0:00:10 831000 -- [-1244.022] (-1241.216) (-1245.806) (-1243.678) * (-1244.748) (-1246.104) [-1242.173] (-1241.956) -- 0:00:10 831500 -- (-1242.759) (-1244.525) (-1243.309) [-1244.253] * (-1246.237) (-1248.184) [-1240.711] (-1241.419) -- 0:00:10 832000 -- (-1242.248) (-1241.427) [-1243.136] (-1241.016) * (-1248.692) (-1245.679) [-1241.734] (-1242.160) -- 0:00:10 832500 -- (-1242.504) [-1241.540] (-1244.025) (-1242.050) * (-1248.921) [-1247.767] (-1244.623) (-1243.605) -- 0:00:10 833000 -- (-1242.160) [-1242.598] (-1242.728) (-1242.517) * (-1243.073) (-1242.662) (-1242.538) [-1243.652] -- 0:00:10 833500 -- [-1242.072] (-1242.029) (-1243.766) (-1246.583) * (-1243.508) (-1244.051) (-1240.562) [-1243.465] -- 0:00:10 834000 -- (-1244.654) (-1243.666) [-1242.516] (-1242.026) * (-1242.888) [-1242.940] (-1241.162) (-1243.238) -- 0:00:10 834500 -- (-1245.230) [-1243.672] (-1240.805) (-1241.854) * (-1243.859) [-1240.813] (-1241.023) (-1241.925) -- 0:00:10 835000 -- (-1242.047) (-1241.039) [-1243.118] (-1241.584) * (-1243.964) (-1240.886) (-1246.374) [-1242.820] -- 0:00:10 Average standard deviation of split frequencies: 0.008212 835500 -- (-1244.700) (-1244.817) (-1243.533) [-1241.027] * (-1245.138) (-1244.434) [-1243.623] (-1244.087) -- 0:00:10 836000 -- (-1243.576) (-1242.780) [-1243.120] (-1240.979) * (-1244.482) (-1243.449) (-1241.683) [-1240.422] -- 0:00:10 836500 -- [-1242.089] (-1242.081) (-1242.607) (-1241.704) * (-1245.499) [-1241.272] (-1246.199) (-1241.664) -- 0:00:10 837000 -- (-1240.962) (-1240.478) (-1244.222) [-1240.874] * (-1241.328) [-1243.444] (-1243.471) (-1240.713) -- 0:00:10 837500 -- (-1248.504) (-1241.191) [-1242.087] (-1243.488) * (-1240.980) [-1243.444] (-1247.670) (-1240.558) -- 0:00:10 838000 -- [-1243.344] (-1243.122) (-1244.932) (-1241.026) * [-1241.251] (-1240.405) (-1247.838) (-1241.073) -- 0:00:10 838500 -- (-1246.215) (-1242.528) [-1242.612] (-1242.656) * (-1245.783) [-1241.700] (-1244.230) (-1241.069) -- 0:00:10 839000 -- (-1243.232) [-1243.826] (-1243.750) (-1244.324) * (-1243.608) [-1241.984] (-1244.429) (-1242.298) -- 0:00:10 839500 -- (-1244.862) (-1244.447) (-1242.199) [-1241.418] * [-1240.972] (-1243.768) (-1244.457) (-1243.669) -- 0:00:10 840000 -- (-1245.857) [-1240.701] (-1240.372) (-1242.191) * (-1243.522) (-1241.049) [-1245.749] (-1241.944) -- 0:00:10 Average standard deviation of split frequencies: 0.007815 840500 -- [-1241.555] (-1242.276) (-1240.404) (-1242.833) * (-1244.006) (-1240.889) [-1242.043] (-1240.848) -- 0:00:10 841000 -- (-1240.864) [-1241.234] (-1244.858) (-1244.705) * (-1240.786) [-1240.565] (-1242.922) (-1242.728) -- 0:00:10 841500 -- [-1241.955] (-1241.338) (-1243.483) (-1242.988) * (-1242.261) (-1241.090) [-1243.099] (-1241.861) -- 0:00:09 842000 -- (-1244.090) (-1241.393) [-1244.349] (-1241.172) * (-1241.278) (-1241.566) [-1243.029] (-1241.471) -- 0:00:09 842500 -- [-1243.177] (-1241.962) (-1241.766) (-1243.062) * (-1244.280) (-1245.636) (-1243.818) [-1241.922] -- 0:00:10 843000 -- (-1243.889) [-1242.845] (-1245.985) (-1242.378) * [-1241.847] (-1244.805) (-1241.861) (-1243.948) -- 0:00:10 843500 -- [-1242.987] (-1242.323) (-1241.284) (-1242.533) * (-1242.245) (-1244.407) (-1242.256) [-1245.044] -- 0:00:10 844000 -- (-1243.479) (-1245.332) [-1241.931] (-1242.709) * (-1244.276) [-1242.757] (-1246.525) (-1242.226) -- 0:00:09 844500 -- (-1243.077) [-1242.256] (-1242.398) (-1245.775) * [-1245.447] (-1242.512) (-1242.930) (-1247.439) -- 0:00:09 845000 -- (-1243.320) [-1243.107] (-1243.122) (-1242.231) * (-1245.165) [-1241.851] (-1247.072) (-1243.938) -- 0:00:09 Average standard deviation of split frequencies: 0.008114 845500 -- (-1244.203) [-1249.419] (-1243.651) (-1241.258) * [-1240.597] (-1246.137) (-1249.781) (-1241.559) -- 0:00:09 846000 -- [-1243.252] (-1246.551) (-1244.615) (-1241.919) * (-1244.066) (-1241.866) (-1243.424) [-1241.636] -- 0:00:09 846500 -- (-1243.046) (-1242.647) [-1242.678] (-1241.646) * (-1241.724) (-1241.900) (-1242.018) [-1242.648] -- 0:00:09 847000 -- [-1241.972] (-1242.939) (-1242.022) (-1242.332) * (-1242.025) [-1242.325] (-1242.963) (-1241.974) -- 0:00:09 847500 -- (-1243.507) [-1242.050] (-1243.191) (-1242.191) * (-1242.555) [-1242.066] (-1242.869) (-1242.721) -- 0:00:09 848000 -- (-1240.744) [-1241.215] (-1241.523) (-1241.130) * [-1244.824] (-1243.847) (-1241.837) (-1240.857) -- 0:00:09 848500 -- (-1243.513) (-1242.691) (-1241.976) [-1242.246] * [-1242.528] (-1245.204) (-1244.069) (-1241.900) -- 0:00:09 849000 -- (-1244.037) (-1241.174) [-1245.598] (-1245.684) * [-1241.157] (-1244.288) (-1243.966) (-1242.366) -- 0:00:09 849500 -- (-1240.502) (-1242.911) [-1243.123] (-1245.457) * (-1245.747) (-1246.220) [-1241.545] (-1241.801) -- 0:00:09 850000 -- (-1241.692) [-1242.853] (-1242.324) (-1242.006) * [-1243.149] (-1245.973) (-1244.297) (-1242.961) -- 0:00:09 Average standard deviation of split frequencies: 0.008001 850500 -- [-1243.761] (-1246.289) (-1241.694) (-1242.293) * [-1241.442] (-1244.473) (-1242.369) (-1243.262) -- 0:00:09 851000 -- (-1243.148) [-1246.829] (-1244.075) (-1241.888) * (-1241.626) [-1244.833] (-1243.266) (-1243.643) -- 0:00:09 851500 -- (-1241.909) (-1242.513) (-1242.308) [-1242.709] * (-1240.843) [-1243.621] (-1242.185) (-1244.891) -- 0:00:09 852000 -- (-1242.119) (-1245.980) (-1243.719) [-1240.756] * (-1240.673) (-1242.557) [-1241.775] (-1242.321) -- 0:00:09 852500 -- (-1243.130) [-1243.104] (-1243.740) (-1241.220) * (-1241.495) (-1244.964) (-1250.673) [-1244.312] -- 0:00:09 853000 -- (-1241.851) [-1241.182] (-1242.458) (-1243.377) * (-1243.285) (-1244.360) [-1242.022] (-1248.689) -- 0:00:09 853500 -- (-1241.601) (-1241.670) [-1240.986] (-1241.709) * (-1242.951) (-1243.894) [-1242.079] (-1245.192) -- 0:00:09 854000 -- [-1243.099] (-1241.467) (-1244.897) (-1241.733) * [-1241.393] (-1241.414) (-1245.967) (-1241.391) -- 0:00:09 854500 -- (-1245.809) (-1244.091) (-1249.232) [-1241.207] * [-1242.278] (-1242.919) (-1243.190) (-1242.413) -- 0:00:09 855000 -- [-1242.966] (-1242.762) (-1243.493) (-1243.376) * (-1242.148) [-1242.592] (-1246.195) (-1242.925) -- 0:00:09 Average standard deviation of split frequencies: 0.008261 855500 -- (-1243.696) (-1240.723) (-1244.309) [-1244.121] * (-1244.540) (-1247.861) (-1243.396) [-1243.909] -- 0:00:09 856000 -- (-1242.083) (-1243.806) [-1242.224] (-1241.581) * [-1243.605] (-1242.997) (-1244.524) (-1241.383) -- 0:00:09 856500 -- (-1244.326) [-1242.114] (-1241.104) (-1240.931) * (-1245.330) (-1246.413) (-1241.939) [-1241.845] -- 0:00:09 857000 -- (-1244.194) (-1241.898) [-1242.234] (-1241.849) * (-1246.437) (-1243.575) [-1243.448] (-1245.652) -- 0:00:09 857500 -- (-1242.568) (-1241.198) (-1242.116) [-1241.478] * (-1241.056) [-1241.935] (-1247.119) (-1241.706) -- 0:00:08 858000 -- (-1242.409) (-1246.100) (-1241.360) [-1241.779] * (-1242.989) (-1248.537) [-1241.640] (-1240.996) -- 0:00:08 858500 -- (-1242.843) (-1242.746) [-1242.337] (-1242.886) * (-1242.676) (-1241.377) (-1243.369) [-1243.225] -- 0:00:09 859000 -- [-1242.423] (-1241.933) (-1241.007) (-1242.011) * (-1241.872) (-1242.107) [-1243.047] (-1243.979) -- 0:00:09 859500 -- [-1245.236] (-1246.452) (-1242.524) (-1244.211) * (-1242.583) (-1241.244) (-1244.100) [-1241.925] -- 0:00:08 860000 -- (-1241.986) (-1243.094) [-1241.577] (-1242.284) * [-1240.857] (-1243.439) (-1245.084) (-1241.660) -- 0:00:08 Average standard deviation of split frequencies: 0.008421 860500 -- (-1244.183) (-1244.588) (-1243.491) [-1241.836] * (-1240.652) (-1241.106) [-1245.174] (-1246.570) -- 0:00:08 861000 -- (-1244.216) (-1241.226) [-1243.360] (-1241.217) * (-1242.775) (-1246.475) [-1243.159] (-1246.153) -- 0:00:08 861500 -- (-1247.302) [-1242.483] (-1244.131) (-1244.235) * [-1243.132] (-1242.181) (-1242.158) (-1243.580) -- 0:00:08 862000 -- [-1242.411] (-1241.699) (-1242.979) (-1244.369) * (-1242.734) (-1242.247) [-1243.678] (-1240.552) -- 0:00:08 862500 -- [-1241.886] (-1242.646) (-1243.129) (-1244.615) * (-1245.897) (-1241.434) [-1243.562] (-1240.706) -- 0:00:08 863000 -- [-1241.720] (-1242.950) (-1246.235) (-1241.164) * (-1247.833) (-1241.799) [-1241.209] (-1241.674) -- 0:00:08 863500 -- (-1240.814) (-1246.411) (-1246.335) [-1244.158] * [-1245.094] (-1244.489) (-1249.121) (-1243.670) -- 0:00:08 864000 -- [-1240.982] (-1253.348) (-1244.067) (-1244.187) * [-1243.418] (-1243.109) (-1243.544) (-1241.879) -- 0:00:08 864500 -- (-1240.887) (-1247.716) (-1242.208) [-1242.298] * [-1243.234] (-1240.606) (-1245.585) (-1241.419) -- 0:00:08 865000 -- (-1243.209) (-1244.220) (-1242.943) [-1240.965] * (-1241.480) [-1243.442] (-1242.690) (-1246.745) -- 0:00:08 Average standard deviation of split frequencies: 0.008505 865500 -- (-1244.632) (-1241.588) (-1246.656) [-1240.902] * (-1241.286) (-1242.348) [-1241.829] (-1242.224) -- 0:00:08 866000 -- [-1243.981] (-1241.219) (-1241.681) (-1244.222) * [-1241.390] (-1242.489) (-1242.061) (-1244.717) -- 0:00:08 866500 -- [-1240.751] (-1242.162) (-1241.692) (-1242.591) * (-1242.942) [-1241.288] (-1241.360) (-1245.267) -- 0:00:08 867000 -- (-1242.338) (-1242.224) (-1242.056) [-1240.753] * (-1241.076) (-1240.928) (-1241.167) [-1242.466] -- 0:00:08 867500 -- (-1242.996) (-1242.307) (-1243.017) [-1240.718] * [-1240.677] (-1241.494) (-1241.155) (-1240.654) -- 0:00:08 868000 -- (-1242.404) [-1241.817] (-1245.166) (-1247.747) * (-1244.990) (-1243.299) [-1241.597] (-1241.030) -- 0:00:08 868500 -- (-1241.289) [-1243.171] (-1243.391) (-1247.273) * (-1249.259) (-1245.475) [-1243.627] (-1241.930) -- 0:00:08 869000 -- (-1240.356) [-1241.760] (-1244.385) (-1246.260) * (-1248.139) [-1241.841] (-1243.405) (-1241.441) -- 0:00:08 869500 -- [-1241.383] (-1242.121) (-1241.056) (-1247.551) * [-1243.877] (-1241.871) (-1251.730) (-1241.881) -- 0:00:08 870000 -- (-1242.148) (-1242.517) [-1241.781] (-1245.393) * [-1242.042] (-1242.429) (-1252.588) (-1241.915) -- 0:00:08 Average standard deviation of split frequencies: 0.008257 870500 -- [-1242.414] (-1241.883) (-1242.639) (-1243.226) * [-1242.669] (-1244.048) (-1242.664) (-1242.324) -- 0:00:08 871000 -- [-1242.675] (-1242.369) (-1243.198) (-1242.714) * (-1240.317) (-1247.328) [-1242.398] (-1241.999) -- 0:00:08 871500 -- (-1242.031) (-1242.132) (-1243.013) [-1240.944] * (-1240.318) (-1243.590) (-1246.157) [-1242.200] -- 0:00:08 872000 -- (-1243.748) (-1244.004) [-1242.245] (-1241.232) * [-1241.049] (-1248.414) (-1247.629) (-1242.775) -- 0:00:08 872500 -- (-1241.514) (-1242.755) (-1244.684) [-1242.153] * (-1243.884) (-1242.036) (-1241.232) [-1241.629] -- 0:00:08 873000 -- [-1240.511] (-1242.829) (-1248.142) (-1245.826) * (-1244.936) (-1242.965) [-1241.633] (-1241.747) -- 0:00:08 873500 -- (-1240.342) (-1243.393) (-1246.290) [-1243.132] * (-1247.590) (-1240.818) (-1243.024) [-1241.045] -- 0:00:07 874000 -- (-1241.289) (-1243.093) (-1246.783) [-1241.275] * [-1245.704] (-1241.514) (-1242.749) (-1241.160) -- 0:00:07 874500 -- (-1242.519) [-1241.124] (-1246.354) (-1241.002) * (-1242.264) (-1241.170) (-1244.137) [-1241.872] -- 0:00:08 875000 -- (-1240.734) (-1241.594) [-1241.345] (-1244.068) * [-1242.700] (-1243.749) (-1241.765) (-1243.629) -- 0:00:08 Average standard deviation of split frequencies: 0.008341 875500 -- (-1242.310) (-1243.932) [-1243.170] (-1241.579) * (-1244.651) (-1242.866) (-1244.299) [-1243.764] -- 0:00:07 876000 -- (-1241.751) (-1243.130) (-1247.275) [-1242.016] * [-1243.433] (-1241.521) (-1243.952) (-1241.668) -- 0:00:07 876500 -- [-1241.378] (-1242.859) (-1244.077) (-1241.506) * (-1242.122) [-1244.794] (-1241.356) (-1243.212) -- 0:00:07 877000 -- (-1240.925) (-1243.394) [-1241.466] (-1244.579) * (-1240.851) (-1245.863) [-1246.008] (-1244.131) -- 0:00:07 877500 -- (-1242.006) (-1241.707) (-1242.181) [-1244.015] * (-1241.513) (-1243.551) [-1245.050] (-1242.007) -- 0:00:07 878000 -- (-1244.842) [-1244.248] (-1242.284) (-1242.816) * (-1240.921) [-1242.740] (-1243.248) (-1244.559) -- 0:00:07 878500 -- (-1241.801) (-1240.955) (-1241.813) [-1241.036] * (-1243.791) (-1241.752) [-1242.591] (-1243.443) -- 0:00:07 879000 -- [-1243.644] (-1240.352) (-1244.224) (-1244.013) * (-1242.237) (-1243.863) (-1243.918) [-1241.976] -- 0:00:07 879500 -- (-1241.168) (-1243.228) (-1242.457) [-1241.206] * (-1242.287) (-1244.432) [-1243.504] (-1241.663) -- 0:00:07 880000 -- (-1242.995) (-1243.393) [-1242.910] (-1243.428) * (-1246.692) (-1241.049) (-1247.116) [-1243.387] -- 0:00:07 Average standard deviation of split frequencies: 0.007996 880500 -- [-1242.460] (-1240.883) (-1244.653) (-1242.341) * (-1247.150) [-1240.864] (-1242.818) (-1243.833) -- 0:00:07 881000 -- (-1242.566) [-1241.321] (-1241.402) (-1243.148) * (-1242.965) (-1241.519) [-1243.217] (-1241.490) -- 0:00:07 881500 -- (-1242.641) (-1243.475) [-1244.654] (-1242.026) * (-1242.734) (-1243.132) [-1241.245] (-1241.743) -- 0:00:07 882000 -- (-1244.980) (-1245.131) [-1245.397] (-1241.549) * (-1243.675) [-1242.877] (-1242.493) (-1241.362) -- 0:00:07 882500 -- (-1243.684) (-1243.756) (-1242.738) [-1247.765] * (-1244.634) (-1243.002) [-1242.478] (-1242.349) -- 0:00:07 883000 -- (-1240.674) (-1242.822) [-1242.630] (-1244.313) * (-1241.363) [-1241.292] (-1244.087) (-1242.350) -- 0:00:07 883500 -- [-1242.999] (-1243.159) (-1243.175) (-1242.146) * (-1241.453) (-1242.675) (-1245.907) [-1241.451] -- 0:00:07 884000 -- (-1241.454) (-1245.158) (-1243.212) [-1241.725] * (-1244.156) [-1241.720] (-1244.026) (-1242.725) -- 0:00:07 884500 -- (-1241.485) (-1241.598) (-1242.665) [-1241.687] * (-1241.071) [-1243.690] (-1242.680) (-1243.082) -- 0:00:07 885000 -- [-1242.008] (-1244.891) (-1243.227) (-1244.068) * (-1243.010) [-1244.018] (-1242.457) (-1241.807) -- 0:00:07 Average standard deviation of split frequencies: 0.008114 885500 -- (-1241.675) [-1245.203] (-1243.410) (-1242.686) * (-1242.935) [-1242.229] (-1243.780) (-1246.173) -- 0:00:07 886000 -- (-1245.785) (-1242.808) (-1242.704) [-1243.676] * [-1244.307] (-1241.553) (-1247.523) (-1245.638) -- 0:00:07 886500 -- (-1243.110) (-1241.512) [-1241.972] (-1241.495) * (-1243.108) [-1241.582] (-1242.747) (-1241.509) -- 0:00:07 887000 -- (-1243.734) (-1242.471) (-1242.452) [-1241.007] * [-1243.990] (-1245.212) (-1244.874) (-1242.537) -- 0:00:07 887500 -- [-1242.295] (-1242.253) (-1244.026) (-1243.434) * (-1242.195) [-1242.037] (-1243.060) (-1241.190) -- 0:00:07 888000 -- [-1242.206] (-1242.027) (-1243.384) (-1245.321) * (-1242.224) [-1242.419] (-1241.941) (-1243.074) -- 0:00:07 888500 -- (-1244.696) (-1241.243) [-1241.586] (-1244.864) * [-1241.407] (-1240.921) (-1242.169) (-1241.293) -- 0:00:07 889000 -- (-1242.355) [-1240.637] (-1243.264) (-1242.209) * (-1241.848) (-1241.595) (-1241.158) [-1240.642] -- 0:00:06 889500 -- (-1241.841) (-1240.439) [-1244.431] (-1245.448) * (-1247.053) (-1241.637) (-1240.686) [-1243.823] -- 0:00:06 890000 -- (-1241.808) (-1240.994) (-1241.795) [-1244.194] * (-1244.888) (-1245.987) [-1241.254] (-1242.287) -- 0:00:06 Average standard deviation of split frequencies: 0.007972 890500 -- (-1243.999) (-1241.545) [-1242.730] (-1242.678) * (-1245.135) [-1244.178] (-1243.496) (-1242.999) -- 0:00:06 891000 -- (-1242.681) (-1243.473) (-1247.904) [-1241.964] * (-1240.565) (-1244.812) [-1243.445] (-1242.072) -- 0:00:06 891500 -- (-1244.063) (-1241.929) [-1240.512] (-1243.720) * (-1241.662) (-1242.245) (-1248.042) [-1243.471] -- 0:00:06 892000 -- [-1243.677] (-1243.264) (-1245.446) (-1244.718) * (-1245.366) [-1242.554] (-1247.221) (-1241.116) -- 0:00:06 892500 -- (-1242.941) [-1240.964] (-1245.621) (-1242.085) * (-1242.948) [-1242.633] (-1244.165) (-1242.280) -- 0:00:06 893000 -- [-1243.268] (-1242.999) (-1246.102) (-1242.245) * (-1244.074) (-1244.345) (-1244.361) [-1241.593] -- 0:00:06 893500 -- [-1246.209] (-1242.474) (-1243.885) (-1241.983) * [-1241.870] (-1241.838) (-1242.770) (-1245.983) -- 0:00:06 894000 -- (-1243.906) (-1240.771) [-1243.260] (-1241.018) * [-1242.315] (-1243.156) (-1242.521) (-1242.462) -- 0:00:06 894500 -- (-1243.625) (-1242.224) [-1243.081] (-1243.218) * [-1243.898] (-1242.223) (-1241.933) (-1242.098) -- 0:00:06 895000 -- (-1244.900) (-1244.521) [-1242.339] (-1243.258) * (-1242.953) (-1245.555) (-1241.997) [-1242.204] -- 0:00:06 Average standard deviation of split frequencies: 0.007629 895500 -- [-1240.860] (-1243.662) (-1248.348) (-1245.018) * (-1243.268) (-1243.144) [-1241.040] (-1244.519) -- 0:00:06 896000 -- (-1242.519) (-1244.923) [-1242.982] (-1244.703) * (-1242.523) (-1242.909) (-1240.462) [-1241.456] -- 0:00:06 896500 -- (-1241.384) (-1245.187) (-1244.814) [-1242.374] * (-1243.237) (-1241.041) [-1243.296] (-1245.133) -- 0:00:06 897000 -- (-1246.412) (-1245.740) [-1242.154] (-1242.029) * [-1241.740] (-1245.444) (-1242.306) (-1243.136) -- 0:00:06 897500 -- (-1243.057) (-1241.500) (-1241.456) [-1243.014] * (-1243.431) [-1241.480] (-1249.570) (-1242.419) -- 0:00:06 898000 -- (-1248.024) (-1241.334) [-1241.937] (-1246.590) * (-1240.913) [-1245.351] (-1242.687) (-1245.581) -- 0:00:06 898500 -- [-1244.107] (-1240.583) (-1243.134) (-1243.645) * (-1244.918) (-1245.015) (-1245.042) [-1241.415] -- 0:00:06 899000 -- (-1241.240) (-1242.535) (-1248.006) [-1245.095] * (-1243.047) (-1243.854) (-1246.524) [-1241.638] -- 0:00:06 899500 -- [-1243.749] (-1242.294) (-1242.217) (-1240.621) * [-1244.110] (-1242.970) (-1244.706) (-1246.697) -- 0:00:06 900000 -- (-1244.091) [-1244.055] (-1242.498) (-1244.293) * (-1242.045) [-1241.884] (-1245.204) (-1246.376) -- 0:00:06 Average standard deviation of split frequencies: 0.007000 900500 -- (-1243.010) [-1244.353] (-1242.216) (-1247.081) * (-1241.844) [-1246.080] (-1243.528) (-1242.233) -- 0:00:06 901000 -- (-1241.635) (-1242.464) [-1241.514] (-1241.856) * [-1243.443] (-1243.428) (-1245.683) (-1241.758) -- 0:00:06 901500 -- [-1243.296] (-1242.824) (-1240.857) (-1241.997) * (-1243.097) [-1241.898] (-1242.165) (-1242.568) -- 0:00:06 902000 -- (-1241.765) (-1245.091) [-1242.229] (-1242.527) * [-1241.661] (-1246.583) (-1242.195) (-1243.160) -- 0:00:06 902500 -- [-1241.431] (-1242.532) (-1246.870) (-1241.685) * (-1241.899) (-1241.238) [-1241.078] (-1243.858) -- 0:00:06 903000 -- (-1242.433) [-1243.747] (-1245.869) (-1245.024) * (-1240.867) [-1241.246] (-1245.706) (-1244.877) -- 0:00:06 903500 -- (-1245.498) [-1241.848] (-1243.840) (-1242.224) * (-1242.846) (-1241.293) (-1245.825) [-1241.521] -- 0:00:06 904000 -- (-1243.006) (-1243.836) [-1245.010] (-1244.222) * [-1244.743] (-1241.276) (-1244.210) (-1243.758) -- 0:00:06 904500 -- (-1245.074) (-1243.446) [-1242.947] (-1249.790) * (-1241.428) (-1243.731) (-1246.120) [-1241.037] -- 0:00:06 905000 -- (-1243.391) (-1244.767) (-1240.378) [-1241.739] * (-1241.126) (-1244.056) [-1243.476] (-1241.035) -- 0:00:05 Average standard deviation of split frequencies: 0.007122 905500 -- (-1242.051) (-1244.621) [-1241.866] (-1242.037) * (-1242.212) (-1243.583) [-1242.742] (-1241.282) -- 0:00:05 906000 -- [-1245.335] (-1243.567) (-1241.545) (-1245.779) * [-1242.537] (-1241.448) (-1242.080) (-1241.968) -- 0:00:05 906500 -- (-1240.749) (-1242.075) [-1244.291] (-1241.094) * [-1242.482] (-1242.772) (-1242.739) (-1242.610) -- 0:00:05 907000 -- [-1241.675] (-1240.820) (-1245.583) (-1242.599) * (-1247.384) [-1244.087] (-1241.377) (-1250.473) -- 0:00:05 907500 -- (-1242.670) [-1243.673] (-1242.972) (-1244.587) * [-1242.280] (-1242.346) (-1243.573) (-1243.736) -- 0:00:05 908000 -- (-1242.164) [-1241.948] (-1242.197) (-1243.416) * (-1241.567) (-1241.413) (-1245.000) [-1241.749] -- 0:00:05 908500 -- (-1243.702) (-1241.170) (-1244.086) [-1241.505] * (-1242.392) (-1241.599) [-1243.192] (-1247.059) -- 0:00:05 909000 -- (-1243.542) (-1241.330) [-1243.009] (-1244.363) * [-1244.503] (-1240.761) (-1242.619) (-1245.537) -- 0:00:05 909500 -- (-1244.151) (-1241.570) (-1243.081) [-1242.998] * (-1247.043) [-1242.990] (-1242.504) (-1242.777) -- 0:00:05 910000 -- (-1241.086) (-1241.956) [-1242.009] (-1241.732) * (-1245.338) (-1242.047) [-1240.917] (-1242.639) -- 0:00:05 Average standard deviation of split frequencies: 0.006729 910500 -- [-1242.858] (-1243.009) (-1242.345) (-1241.423) * (-1245.357) (-1241.689) [-1242.353] (-1242.278) -- 0:00:05 911000 -- (-1241.696) (-1244.736) [-1245.447] (-1242.278) * (-1243.534) (-1241.531) [-1243.519] (-1242.578) -- 0:00:05 911500 -- (-1245.250) [-1242.289] (-1240.426) (-1240.739) * (-1242.726) (-1243.601) (-1243.395) [-1242.401] -- 0:00:05 912000 -- (-1243.047) (-1242.817) [-1243.035] (-1242.864) * [-1240.782] (-1244.393) (-1242.531) (-1242.307) -- 0:00:05 912500 -- (-1241.986) [-1241.923] (-1241.354) (-1243.290) * (-1242.820) [-1241.880] (-1242.351) (-1243.936) -- 0:00:05 913000 -- (-1241.315) (-1240.928) (-1242.607) [-1243.314] * [-1250.665] (-1241.743) (-1240.860) (-1246.857) -- 0:00:05 913500 -- [-1241.476] (-1241.825) (-1243.584) (-1243.749) * (-1244.831) [-1242.958] (-1244.083) (-1244.048) -- 0:00:05 914000 -- (-1241.910) [-1241.761] (-1245.614) (-1245.981) * (-1242.824) (-1241.817) (-1241.489) [-1242.801] -- 0:00:05 914500 -- (-1241.677) (-1241.085) [-1240.928] (-1243.704) * [-1241.776] (-1242.275) (-1246.459) (-1241.760) -- 0:00:05 915000 -- [-1241.850] (-1242.944) (-1241.809) (-1243.534) * (-1244.055) (-1244.145) (-1243.045) [-1241.535] -- 0:00:05 Average standard deviation of split frequencies: 0.006759 915500 -- (-1242.382) [-1242.233] (-1241.807) (-1243.674) * (-1243.140) [-1243.254] (-1243.516) (-1244.313) -- 0:00:05 916000 -- [-1244.332] (-1244.255) (-1241.587) (-1241.971) * [-1243.644] (-1244.502) (-1241.968) (-1244.944) -- 0:00:05 916500 -- (-1243.858) [-1243.169] (-1245.066) (-1241.457) * [-1241.487] (-1242.258) (-1242.791) (-1253.026) -- 0:00:05 917000 -- [-1242.339] (-1243.176) (-1243.548) (-1244.380) * [-1242.447] (-1243.163) (-1245.204) (-1248.142) -- 0:00:05 917500 -- (-1242.322) (-1242.911) (-1244.089) [-1244.931] * (-1244.765) [-1242.017] (-1241.859) (-1242.624) -- 0:00:05 918000 -- [-1242.881] (-1241.388) (-1244.454) (-1241.627) * [-1242.108] (-1241.574) (-1245.987) (-1241.966) -- 0:00:05 918500 -- (-1243.989) (-1241.665) (-1242.202) [-1242.423] * (-1241.892) (-1242.340) (-1245.236) [-1245.008] -- 0:00:05 919000 -- (-1241.046) (-1251.520) [-1242.291] (-1243.259) * (-1242.168) (-1242.713) (-1241.139) [-1242.176] -- 0:00:05 919500 -- (-1243.475) (-1249.868) [-1244.313] (-1243.139) * (-1243.334) (-1243.951) [-1242.388] (-1242.233) -- 0:00:05 920000 -- (-1242.859) [-1241.938] (-1243.758) (-1243.652) * (-1241.843) (-1242.103) [-1243.396] (-1240.681) -- 0:00:05 Average standard deviation of split frequencies: 0.006912 920500 -- (-1243.248) [-1242.122] (-1241.589) (-1244.100) * (-1244.762) (-1241.767) (-1242.253) [-1240.319] -- 0:00:05 921000 -- [-1240.936] (-1244.385) (-1245.294) (-1242.829) * (-1244.116) [-1241.102] (-1241.499) (-1240.870) -- 0:00:04 921500 -- [-1241.122] (-1242.464) (-1244.098) (-1244.902) * [-1242.407] (-1242.402) (-1241.513) (-1245.738) -- 0:00:04 922000 -- [-1242.531] (-1243.278) (-1242.982) (-1243.401) * (-1241.558) (-1242.348) (-1244.468) [-1242.025] -- 0:00:04 922500 -- (-1244.719) [-1241.217] (-1240.909) (-1242.746) * [-1245.021] (-1241.267) (-1241.617) (-1243.074) -- 0:00:04 923000 -- (-1244.602) (-1242.759) [-1241.233] (-1243.337) * (-1243.915) [-1243.092] (-1242.130) (-1245.541) -- 0:00:04 923500 -- (-1243.117) (-1242.232) [-1241.561] (-1241.742) * (-1243.789) (-1243.873) [-1241.660] (-1243.330) -- 0:00:04 924000 -- [-1243.007] (-1241.869) (-1242.983) (-1242.461) * (-1241.956) (-1241.840) (-1242.704) [-1243.634] -- 0:00:04 924500 -- (-1243.332) (-1243.240) (-1246.382) [-1240.928] * (-1242.928) (-1246.226) [-1242.630] (-1242.728) -- 0:00:04 925000 -- (-1242.910) [-1242.109] (-1243.468) (-1240.735) * [-1244.926] (-1242.460) (-1242.028) (-1243.795) -- 0:00:04 Average standard deviation of split frequencies: 0.006777 925500 -- (-1241.002) (-1242.761) (-1243.298) [-1244.000] * (-1247.935) (-1244.061) [-1241.326] (-1241.450) -- 0:00:04 926000 -- (-1244.124) (-1243.600) [-1243.861] (-1242.963) * (-1243.545) (-1241.813) (-1241.807) [-1242.414] -- 0:00:04 926500 -- (-1240.862) (-1242.923) (-1243.515) [-1243.116] * (-1242.781) [-1243.729] (-1243.222) (-1244.111) -- 0:00:04 927000 -- (-1241.018) (-1240.566) [-1241.631] (-1241.538) * [-1241.383] (-1243.625) (-1241.627) (-1246.033) -- 0:00:04 927500 -- (-1240.876) [-1241.845] (-1242.004) (-1245.212) * (-1246.773) (-1243.038) (-1244.639) [-1241.976] -- 0:00:04 928000 -- [-1245.502] (-1241.647) (-1241.394) (-1243.897) * (-1241.936) (-1250.684) (-1242.739) [-1241.735] -- 0:00:04 928500 -- [-1242.186] (-1244.378) (-1242.631) (-1243.458) * [-1243.615] (-1243.916) (-1242.589) (-1241.718) -- 0:00:04 929000 -- (-1243.162) (-1242.966) (-1241.827) [-1242.231] * (-1241.877) (-1246.990) (-1241.827) [-1241.838] -- 0:00:04 929500 -- (-1242.778) (-1245.395) (-1244.985) [-1242.293] * (-1242.358) (-1246.536) (-1241.976) [-1242.388] -- 0:00:04 930000 -- (-1242.238) [-1241.997] (-1246.076) (-1242.377) * (-1245.899) (-1243.663) [-1241.270] (-1241.816) -- 0:00:04 Average standard deviation of split frequencies: 0.006521 930500 -- [-1240.974] (-1242.526) (-1245.582) (-1241.081) * (-1245.062) [-1243.941] (-1244.352) (-1242.278) -- 0:00:04 931000 -- (-1240.972) (-1243.393) (-1244.498) [-1244.235] * (-1249.563) (-1241.216) (-1241.684) [-1242.178] -- 0:00:04 931500 -- (-1241.403) [-1244.357] (-1243.531) (-1245.950) * (-1243.784) (-1246.615) (-1241.356) [-1242.415] -- 0:00:04 932000 -- (-1244.035) [-1246.118] (-1247.366) (-1250.077) * (-1242.429) [-1244.379] (-1242.297) (-1242.709) -- 0:00:04 932500 -- (-1242.633) (-1244.859) (-1245.656) [-1247.727] * [-1244.388] (-1244.547) (-1243.358) (-1241.145) -- 0:00:04 933000 -- (-1244.676) [-1243.894] (-1244.721) (-1244.105) * (-1245.976) (-1245.710) (-1242.332) [-1242.570] -- 0:00:04 933500 -- (-1242.308) (-1245.155) (-1243.061) [-1242.462] * [-1245.510] (-1247.923) (-1246.146) (-1242.313) -- 0:00:04 934000 -- [-1243.687] (-1242.944) (-1240.960) (-1241.702) * (-1241.224) [-1249.292] (-1246.621) (-1250.641) -- 0:00:04 934500 -- (-1243.300) [-1241.353] (-1241.354) (-1246.765) * [-1242.584] (-1243.291) (-1244.767) (-1241.412) -- 0:00:04 935000 -- [-1242.018] (-1244.554) (-1241.637) (-1242.836) * (-1242.372) (-1241.772) (-1243.865) [-1242.507] -- 0:00:04 Average standard deviation of split frequencies: 0.006279 935500 -- (-1244.478) (-1245.431) [-1241.023] (-1242.818) * (-1241.632) (-1242.312) [-1244.445] (-1246.906) -- 0:00:04 936000 -- (-1243.456) [-1243.215] (-1241.778) (-1243.669) * [-1242.815] (-1242.860) (-1245.621) (-1244.524) -- 0:00:04 936500 -- (-1243.346) (-1240.625) [-1242.825] (-1243.822) * [-1244.325] (-1244.481) (-1242.766) (-1242.989) -- 0:00:04 937000 -- (-1244.878) (-1241.468) (-1243.293) [-1244.712] * (-1244.652) [-1242.101] (-1244.360) (-1241.896) -- 0:00:03 937500 -- (-1241.635) (-1243.401) [-1244.709] (-1242.308) * (-1244.299) (-1243.739) [-1243.747] (-1243.211) -- 0:00:03 938000 -- (-1242.287) (-1242.954) (-1241.483) [-1242.442] * (-1242.828) (-1244.901) (-1243.926) [-1243.113] -- 0:00:03 938500 -- (-1242.652) (-1242.327) (-1245.858) [-1245.191] * (-1241.261) (-1242.309) [-1243.064] (-1243.372) -- 0:00:03 939000 -- (-1243.708) [-1241.849] (-1242.358) (-1243.599) * (-1242.869) [-1241.400] (-1245.714) (-1242.071) -- 0:00:03 939500 -- (-1242.203) [-1243.646] (-1243.109) (-1242.400) * (-1242.736) [-1240.594] (-1243.341) (-1245.172) -- 0:00:03 940000 -- (-1241.845) [-1242.574] (-1244.426) (-1243.398) * (-1243.100) (-1246.247) [-1241.481] (-1243.836) -- 0:00:03 Average standard deviation of split frequencies: 0.006448 940500 -- [-1245.753] (-1242.845) (-1243.548) (-1242.516) * (-1243.317) [-1245.025] (-1241.712) (-1242.491) -- 0:00:03 941000 -- (-1243.171) [-1242.482] (-1241.761) (-1242.368) * (-1242.990) [-1245.184] (-1242.703) (-1241.566) -- 0:00:03 941500 -- (-1246.275) (-1244.517) (-1242.395) [-1243.097] * (-1243.431) (-1242.135) (-1243.558) [-1244.747] -- 0:00:03 942000 -- (-1245.701) [-1242.127] (-1241.967) (-1242.848) * [-1241.608] (-1248.845) (-1243.721) (-1241.754) -- 0:00:03 942500 -- (-1246.873) [-1242.076] (-1243.216) (-1242.588) * (-1241.600) [-1246.168] (-1244.476) (-1243.582) -- 0:00:03 943000 -- (-1242.978) (-1242.571) [-1245.418] (-1241.543) * (-1241.850) (-1242.872) [-1244.860] (-1246.268) -- 0:00:03 943500 -- (-1242.644) (-1243.085) [-1241.829] (-1241.803) * (-1240.886) [-1245.275] (-1243.700) (-1242.239) -- 0:00:03 944000 -- (-1245.921) (-1242.531) (-1242.615) [-1243.685] * [-1240.845] (-1240.700) (-1241.006) (-1243.643) -- 0:00:03 944500 -- (-1244.985) [-1244.216] (-1241.210) (-1240.778) * (-1241.507) (-1243.862) [-1241.976] (-1244.654) -- 0:00:03 945000 -- (-1243.079) (-1242.791) [-1241.829] (-1243.246) * (-1241.327) (-1244.768) (-1244.911) [-1244.831] -- 0:00:03 Average standard deviation of split frequencies: 0.006378 945500 -- (-1243.880) (-1242.955) (-1242.601) [-1241.920] * (-1244.589) (-1246.737) (-1242.259) [-1242.595] -- 0:00:03 946000 -- (-1241.631) [-1242.168] (-1241.697) (-1242.018) * [-1242.859] (-1243.122) (-1240.977) (-1242.860) -- 0:00:03 946500 -- (-1242.856) (-1243.326) [-1243.726] (-1242.045) * (-1245.004) (-1241.310) [-1243.933] (-1244.492) -- 0:00:03 947000 -- [-1241.855] (-1241.691) (-1241.720) (-1244.893) * [-1240.639] (-1242.081) (-1241.764) (-1243.439) -- 0:00:03 947500 -- (-1241.472) (-1241.668) [-1245.118] (-1241.583) * (-1242.549) (-1244.431) (-1241.491) [-1240.924] -- 0:00:03 948000 -- (-1243.290) (-1242.548) [-1249.225] (-1241.172) * [-1240.540] (-1248.593) (-1244.170) (-1241.789) -- 0:00:03 948500 -- (-1240.541) (-1243.693) (-1243.256) [-1240.652] * (-1244.134) (-1245.718) (-1244.466) [-1241.159] -- 0:00:03 949000 -- (-1246.527) [-1241.056] (-1243.719) (-1240.821) * [-1244.774] (-1242.095) (-1246.401) (-1241.572) -- 0:00:03 949500 -- [-1241.658] (-1241.350) (-1244.830) (-1241.453) * (-1242.205) [-1242.541] (-1243.698) (-1242.537) -- 0:00:03 950000 -- (-1241.849) [-1242.334] (-1248.426) (-1247.552) * (-1241.307) (-1242.831) (-1242.137) [-1242.423] -- 0:00:03 Average standard deviation of split frequencies: 0.006281 950500 -- (-1243.660) (-1241.927) [-1241.956] (-1245.691) * (-1241.399) (-1246.381) (-1243.012) [-1241.566] -- 0:00:03 951000 -- (-1240.921) (-1244.102) [-1242.154] (-1241.092) * [-1241.575] (-1242.549) (-1242.306) (-1242.729) -- 0:00:03 951500 -- [-1240.734] (-1241.178) (-1241.703) (-1241.636) * [-1244.271] (-1242.200) (-1242.343) (-1243.100) -- 0:00:03 952000 -- (-1242.216) [-1240.787] (-1242.409) (-1240.698) * (-1243.963) (-1244.859) [-1242.662] (-1241.690) -- 0:00:03 952500 -- (-1241.408) [-1241.573] (-1251.632) (-1243.097) * [-1241.158] (-1242.531) (-1242.425) (-1248.282) -- 0:00:02 953000 -- [-1241.340] (-1242.555) (-1244.285) (-1242.640) * (-1244.846) (-1241.945) [-1244.877] (-1243.977) -- 0:00:02 953500 -- [-1241.445] (-1242.978) (-1245.005) (-1243.589) * (-1244.050) (-1240.813) [-1246.683] (-1241.833) -- 0:00:02 954000 -- (-1248.487) [-1241.760] (-1243.519) (-1243.750) * (-1241.567) (-1241.763) (-1240.996) [-1242.084] -- 0:00:02 954500 -- (-1246.046) [-1242.108] (-1241.312) (-1242.084) * [-1241.241] (-1243.502) (-1241.807) (-1243.255) -- 0:00:02 955000 -- (-1242.342) [-1243.342] (-1240.719) (-1241.630) * (-1241.861) [-1240.814] (-1245.708) (-1243.526) -- 0:00:02 Average standard deviation of split frequencies: 0.006410 955500 -- (-1241.362) (-1241.662) [-1241.071] (-1241.221) * (-1242.378) (-1240.731) [-1241.503] (-1243.223) -- 0:00:02 956000 -- (-1240.865) [-1241.805] (-1243.251) (-1240.639) * (-1240.398) [-1240.655] (-1242.036) (-1242.448) -- 0:00:02 956500 -- (-1241.753) (-1241.032) [-1244.219] (-1241.462) * (-1248.111) (-1241.476) (-1242.486) [-1242.429] -- 0:00:02 957000 -- (-1241.982) [-1242.841] (-1242.891) (-1245.978) * (-1247.875) (-1243.561) [-1241.621] (-1241.156) -- 0:00:02 957500 -- (-1241.057) (-1244.528) (-1243.543) [-1244.547] * (-1243.467) (-1243.722) (-1242.907) [-1241.356] -- 0:00:02 958000 -- (-1241.190) [-1241.748] (-1242.032) (-1241.088) * (-1243.328) (-1243.234) [-1241.803] (-1242.129) -- 0:00:02 958500 -- (-1244.077) (-1240.741) (-1241.329) [-1241.833] * [-1243.990] (-1243.009) (-1241.811) (-1241.034) -- 0:00:02 959000 -- (-1243.085) [-1241.420] (-1242.511) (-1243.985) * (-1243.642) (-1241.250) [-1240.613] (-1241.228) -- 0:00:02 959500 -- (-1244.762) [-1241.228] (-1242.021) (-1244.925) * [-1244.150] (-1244.797) (-1241.277) (-1244.184) -- 0:00:02 960000 -- (-1241.532) [-1243.970] (-1245.086) (-1247.180) * (-1242.164) (-1242.634) [-1242.131] (-1241.371) -- 0:00:02 Average standard deviation of split frequencies: 0.006085 960500 -- [-1241.241] (-1242.106) (-1242.018) (-1242.806) * (-1241.938) (-1242.795) (-1242.650) [-1241.616] -- 0:00:02 961000 -- (-1244.170) (-1244.419) [-1241.482] (-1244.652) * (-1242.549) (-1243.071) (-1248.239) [-1242.436] -- 0:00:02 961500 -- (-1247.879) (-1243.096) [-1240.896] (-1243.938) * [-1242.505] (-1246.157) (-1242.542) (-1245.944) -- 0:00:02 962000 -- [-1245.611] (-1241.374) (-1241.565) (-1240.888) * (-1242.910) (-1243.224) [-1241.659] (-1242.683) -- 0:00:02 962500 -- [-1241.997] (-1242.866) (-1242.967) (-1241.783) * (-1244.096) (-1243.927) (-1245.105) [-1241.166] -- 0:00:02 963000 -- (-1250.827) [-1243.656] (-1244.426) (-1244.716) * (-1243.143) (-1247.308) [-1241.098] (-1242.835) -- 0:00:02 963500 -- [-1244.604] (-1241.086) (-1242.470) (-1241.774) * (-1243.638) [-1245.561] (-1242.711) (-1242.393) -- 0:00:02 964000 -- (-1245.936) (-1242.468) [-1241.198] (-1242.442) * (-1243.703) (-1244.137) (-1241.590) [-1244.873] -- 0:00:02 964500 -- (-1242.227) [-1242.017] (-1241.712) (-1241.562) * (-1241.168) [-1242.949] (-1241.363) (-1242.348) -- 0:00:02 965000 -- (-1242.167) (-1241.668) (-1241.599) [-1242.772] * [-1242.676] (-1244.406) (-1244.206) (-1243.103) -- 0:00:02 Average standard deviation of split frequencies: 0.006409 965500 -- (-1241.076) (-1241.237) (-1241.568) [-1240.791] * (-1242.150) (-1241.692) [-1243.032] (-1244.840) -- 0:00:02 966000 -- (-1247.500) [-1242.310] (-1241.121) (-1240.351) * [-1241.864] (-1241.879) (-1242.737) (-1242.582) -- 0:00:02 966500 -- (-1241.840) (-1245.981) (-1242.897) [-1242.939] * (-1243.802) [-1241.891] (-1240.915) (-1244.526) -- 0:00:02 967000 -- [-1241.783] (-1242.007) (-1240.840) (-1242.468) * [-1246.224] (-1242.284) (-1243.113) (-1246.135) -- 0:00:02 967500 -- (-1244.917) (-1243.171) (-1240.967) [-1245.483] * (-1241.724) [-1242.859] (-1243.218) (-1247.537) -- 0:00:02 968000 -- (-1245.473) (-1241.546) (-1241.925) [-1243.568] * (-1242.687) (-1245.497) [-1245.307] (-1244.713) -- 0:00:02 968500 -- (-1246.491) [-1241.028] (-1241.022) (-1241.224) * (-1241.096) (-1241.781) (-1246.891) [-1243.626] -- 0:00:01 969000 -- (-1241.533) (-1248.668) [-1240.835] (-1242.758) * [-1243.467] (-1241.142) (-1241.448) (-1244.698) -- 0:00:01 969500 -- (-1244.100) (-1243.463) (-1242.843) [-1243.074] * (-1241.997) [-1241.940] (-1241.555) (-1244.577) -- 0:00:01 970000 -- (-1242.568) (-1245.178) (-1243.153) [-1242.973] * (-1241.792) [-1243.276] (-1243.542) (-1245.073) -- 0:00:01 Average standard deviation of split frequencies: 0.006346 970500 -- (-1243.911) [-1240.829] (-1246.537) (-1243.403) * (-1243.497) [-1242.969] (-1242.509) (-1241.389) -- 0:00:01 971000 -- (-1244.854) (-1242.543) (-1244.596) [-1242.686] * (-1240.500) [-1241.127] (-1241.187) (-1241.048) -- 0:00:01 971500 -- (-1243.157) (-1241.758) (-1246.517) [-1241.119] * (-1242.256) (-1241.742) [-1242.463] (-1241.636) -- 0:00:01 972000 -- (-1243.247) (-1241.337) [-1241.189] (-1241.260) * (-1245.300) (-1244.125) (-1240.765) [-1245.074] -- 0:00:01 972500 -- [-1247.375] (-1242.287) (-1244.660) (-1243.881) * (-1244.826) (-1241.644) (-1241.180) [-1242.690] -- 0:00:01 973000 -- (-1245.806) [-1242.779] (-1246.207) (-1249.141) * [-1241.239] (-1242.301) (-1240.779) (-1243.468) -- 0:00:01 973500 -- [-1241.807] (-1244.880) (-1242.416) (-1243.403) * [-1241.328] (-1242.004) (-1240.862) (-1242.672) -- 0:00:01 974000 -- (-1241.811) [-1241.851] (-1240.980) (-1242.259) * [-1243.059] (-1242.586) (-1242.295) (-1246.486) -- 0:00:01 974500 -- (-1241.486) [-1243.805] (-1242.512) (-1242.894) * (-1243.190) (-1240.843) (-1243.649) [-1241.830] -- 0:00:01 975000 -- (-1242.187) (-1241.692) (-1243.795) [-1243.526] * [-1241.345] (-1241.204) (-1243.428) (-1244.261) -- 0:00:01 Average standard deviation of split frequencies: 0.006279 975500 -- (-1241.326) [-1240.361] (-1244.133) (-1241.844) * (-1247.780) (-1243.099) (-1246.508) [-1242.539] -- 0:00:01 976000 -- (-1243.691) [-1240.432] (-1245.919) (-1245.928) * (-1242.928) [-1244.929] (-1242.246) (-1242.656) -- 0:00:01 976500 -- (-1247.874) [-1241.697] (-1241.064) (-1241.848) * (-1242.599) (-1240.692) [-1244.268] (-1243.332) -- 0:00:01 977000 -- (-1243.923) [-1242.436] (-1241.256) (-1241.770) * (-1243.102) (-1240.836) [-1244.108] (-1242.279) -- 0:00:01 977500 -- (-1244.424) (-1245.478) [-1241.920] (-1241.632) * (-1241.171) (-1246.648) (-1242.246) [-1242.520] -- 0:00:01 978000 -- (-1243.982) (-1248.912) (-1243.921) [-1243.657] * [-1242.091] (-1241.405) (-1241.605) (-1242.699) -- 0:00:01 978500 -- [-1245.607] (-1248.988) (-1243.689) (-1245.636) * (-1241.679) [-1242.106] (-1244.705) (-1246.330) -- 0:00:01 979000 -- (-1241.992) (-1247.083) [-1241.013] (-1242.275) * (-1241.995) (-1242.824) (-1241.716) [-1245.289] -- 0:00:01 979500 -- (-1245.001) (-1240.666) [-1241.549] (-1241.688) * [-1240.643] (-1241.181) (-1242.101) (-1242.432) -- 0:00:01 980000 -- (-1247.479) [-1242.761] (-1240.964) (-1241.697) * [-1240.525] (-1240.373) (-1241.795) (-1243.351) -- 0:00:01 Average standard deviation of split frequencies: 0.006153 980500 -- (-1247.599) (-1240.978) (-1245.272) [-1244.991] * (-1240.792) (-1244.179) (-1243.116) [-1242.286] -- 0:00:01 981000 -- (-1249.480) (-1244.862) [-1247.158] (-1242.200) * (-1241.750) (-1243.382) [-1240.890] (-1242.979) -- 0:00:01 981500 -- (-1242.487) (-1242.105) (-1245.158) [-1241.795] * (-1241.047) [-1241.204] (-1241.671) (-1243.082) -- 0:00:01 982000 -- (-1246.939) (-1243.693) [-1243.310] (-1243.232) * (-1240.550) (-1241.320) [-1240.971] (-1242.227) -- 0:00:01 982500 -- (-1242.163) (-1242.994) [-1242.278] (-1242.673) * (-1241.204) (-1243.550) (-1242.285) [-1244.692] -- 0:00:01 983000 -- (-1242.728) [-1243.188] (-1247.484) (-1245.224) * (-1241.176) [-1241.709] (-1242.277) (-1248.246) -- 0:00:01 983500 -- (-1242.646) (-1241.480) (-1244.009) [-1243.670] * (-1241.754) [-1242.621] (-1242.693) (-1243.941) -- 0:00:01 984000 -- (-1241.676) (-1241.438) [-1240.531] (-1241.201) * [-1241.241] (-1245.035) (-1242.475) (-1241.363) -- 0:00:01 984500 -- (-1242.181) (-1245.443) [-1242.042] (-1241.329) * (-1240.925) (-1247.149) [-1243.853] (-1241.372) -- 0:00:00 985000 -- [-1242.197] (-1242.447) (-1243.390) (-1241.205) * (-1241.245) (-1241.197) [-1243.536] (-1242.168) -- 0:00:00 Average standard deviation of split frequencies: 0.005865 985500 -- (-1241.761) (-1241.719) [-1243.393] (-1244.250) * (-1242.761) [-1242.150] (-1242.826) (-1241.285) -- 0:00:00 986000 -- [-1242.442] (-1243.192) (-1241.016) (-1243.957) * (-1246.482) (-1243.264) (-1243.437) [-1244.111] -- 0:00:00 986500 -- [-1246.542] (-1242.012) (-1241.081) (-1243.662) * (-1241.137) (-1242.448) (-1243.652) [-1242.258] -- 0:00:00 987000 -- (-1243.362) (-1241.266) [-1241.238] (-1245.351) * (-1241.798) [-1241.983] (-1245.847) (-1242.469) -- 0:00:00 987500 -- (-1242.585) (-1244.208) (-1242.112) [-1241.759] * (-1241.198) (-1241.616) (-1243.065) [-1242.207] -- 0:00:00 988000 -- (-1241.696) (-1244.174) [-1242.827] (-1241.584) * (-1241.593) [-1241.621] (-1246.944) (-1242.102) -- 0:00:00 988500 -- [-1240.863] (-1243.140) (-1245.451) (-1242.621) * (-1242.091) (-1240.489) [-1242.770] (-1241.724) -- 0:00:00 989000 -- (-1243.808) (-1242.168) [-1240.474] (-1243.421) * (-1242.596) (-1240.898) [-1242.917] (-1241.675) -- 0:00:00 989500 -- (-1243.432) (-1241.789) (-1242.688) [-1242.235] * (-1243.423) [-1241.103] (-1242.884) (-1241.312) -- 0:00:00 990000 -- [-1240.793] (-1242.028) (-1241.586) (-1243.538) * (-1244.223) [-1241.838] (-1243.689) (-1246.089) -- 0:00:00 Average standard deviation of split frequencies: 0.005837 990500 -- (-1240.806) [-1244.638] (-1245.561) (-1246.922) * (-1241.851) [-1241.402] (-1246.776) (-1245.978) -- 0:00:00 991000 -- (-1241.475) (-1243.677) (-1243.423) [-1241.555] * [-1241.891] (-1241.994) (-1241.524) (-1241.577) -- 0:00:00 991500 -- [-1241.717] (-1241.629) (-1243.626) (-1243.582) * (-1242.325) [-1241.122] (-1241.562) (-1241.661) -- 0:00:00 992000 -- (-1241.874) (-1241.799) [-1245.294] (-1245.055) * (-1241.923) (-1241.564) [-1241.638] (-1246.017) -- 0:00:00 992500 -- (-1243.285) [-1241.669] (-1241.187) (-1244.064) * [-1243.720] (-1245.399) (-1246.407) (-1242.654) -- 0:00:00 993000 -- (-1244.528) [-1241.811] (-1240.501) (-1243.978) * [-1243.230] (-1241.660) (-1242.158) (-1243.783) -- 0:00:00 993500 -- (-1243.860) (-1242.310) (-1240.501) [-1243.767] * (-1242.659) (-1245.381) (-1243.986) [-1244.481] -- 0:00:00 994000 -- (-1242.655) (-1246.060) (-1242.086) [-1251.292] * (-1243.667) [-1245.213] (-1244.025) (-1243.079) -- 0:00:00 994500 -- [-1241.251] (-1245.093) (-1242.515) (-1242.769) * [-1242.695] (-1243.579) (-1242.490) (-1241.776) -- 0:00:00 995000 -- [-1241.387] (-1246.494) (-1242.779) (-1243.509) * (-1244.815) (-1242.979) (-1242.427) [-1243.770] -- 0:00:00 Average standard deviation of split frequencies: 0.005995 995500 -- (-1241.306) (-1246.477) [-1243.071] (-1241.426) * (-1244.783) (-1241.614) (-1242.533) [-1243.628] -- 0:00:00 996000 -- (-1240.958) (-1248.046) [-1241.597] (-1243.700) * (-1242.180) (-1241.760) [-1243.106] (-1241.707) -- 0:00:00 996500 -- [-1240.942] (-1243.950) (-1241.376) (-1242.316) * (-1244.044) [-1242.132] (-1245.675) (-1241.859) -- 0:00:00 997000 -- (-1240.874) (-1241.119) (-1241.549) [-1242.700] * (-1243.982) (-1243.432) [-1242.938] (-1241.413) -- 0:00:00 997500 -- (-1241.011) (-1243.502) (-1241.090) [-1241.891] * (-1242.081) (-1243.642) [-1243.226] (-1241.002) -- 0:00:00 998000 -- [-1241.717] (-1250.977) (-1243.298) (-1241.286) * (-1243.592) (-1242.455) (-1242.126) [-1244.327] -- 0:00:00 998500 -- (-1241.802) (-1244.604) (-1243.477) [-1241.787] * (-1242.897) (-1244.198) (-1240.917) [-1241.215] -- 0:00:00 999000 -- (-1241.837) (-1245.674) (-1241.610) [-1241.623] * (-1243.938) (-1244.447) (-1242.879) [-1243.800] -- 0:00:00 999500 -- (-1240.922) (-1242.089) (-1242.918) [-1243.029] * (-1242.139) (-1241.795) (-1243.215) [-1242.297] -- 0:00:00 1000000 -- (-1241.615) [-1243.997] (-1244.366) (-1245.557) * (-1241.672) (-1241.155) (-1244.689) [-1241.795] -- 0:00:00 Average standard deviation of split frequencies: 0.005873 Analysis completed in 1 mins 4 seconds Analysis used 62.42 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1240.21 Likelihood of best state for "cold" chain of run 2 was -1240.21 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 76.3 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.4 % ( 28 %) Dirichlet(Pi{all}) 27.8 % ( 25 %) Slider(Pi{all}) 78.8 % ( 54 %) Multiplier(Alpha{1,2}) 77.9 % ( 48 %) Multiplier(Alpha{3}) 18.5 % ( 30 %) Slider(Pinvar{all}) 98.7 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 70 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 27 %) Multiplier(V{all}) 97.4 % ( 96 %) Nodeslider(V{all}) 30.9 % ( 25 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.2 % ( 58 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.1 % ( 29 %) Dirichlet(Pi{all}) 27.8 % ( 22 %) Slider(Pi{all}) 78.8 % ( 50 %) Multiplier(Alpha{1,2}) 77.9 % ( 60 %) Multiplier(Alpha{3}) 18.3 % ( 32 %) Slider(Pinvar{all}) 98.7 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 77 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 95 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 29 %) Multiplier(V{all}) 97.5 % ( 99 %) Nodeslider(V{all}) 30.5 % ( 27 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166858 0.82 0.67 3 | 166121 166876 0.84 4 | 167153 166222 166770 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.80 0.64 0.50 2 | 166307 0.82 0.66 3 | 167209 166771 0.83 4 | 166829 165981 166903 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1241.82 | 1 1 | | | | 1* 2 2 1 | | 2 2 * 1 2 1 1 2 1 2 | |11 2 112 1 1 1 2 2 2 2 2 | | 1 12 1 2 22 1 1 2 2 121| | 2 1 2 2 1 1 * 1 1 1 2| | 2 1 121 * 122 11 2 2 2 12 11 2 1 | | 1 2 1 111 1 1 * 1 1 22 2 1 2 2 | |2 2 2 2 1 2 2 1 1 2 | | 2 2 *1 | | 2 2 1 | | 2 2 | | 2 | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1243.77 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1241.92 -1245.23 2 -1241.97 -1245.85 -------------------------------------- TOTAL -1241.94 -1245.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890519 0.089031 0.332162 1.452637 0.859783 1391.94 1446.47 1.000 r(A<->C){all} 0.171190 0.019528 0.000107 0.451733 0.137919 94.35 205.14 1.002 r(A<->G){all} 0.169459 0.021934 0.000191 0.466578 0.128385 110.30 228.37 1.001 r(A<->T){all} 0.173563 0.021561 0.000047 0.469307 0.134254 146.68 173.33 1.001 r(C<->G){all} 0.160869 0.019865 0.000098 0.435774 0.120458 215.63 238.94 1.001 r(C<->T){all} 0.163870 0.018430 0.000046 0.428004 0.131090 191.37 251.23 1.000 r(G<->T){all} 0.161049 0.020339 0.000021 0.453306 0.117954 113.63 171.57 1.000 pi(A){all} 0.153014 0.000140 0.130570 0.175537 0.152780 1108.90 1259.47 1.000 pi(C){all} 0.285780 0.000220 0.257869 0.315427 0.285614 1103.71 1183.80 1.001 pi(G){all} 0.347100 0.000250 0.316094 0.378444 0.347319 1148.34 1213.79 1.000 pi(T){all} 0.214106 0.000172 0.188413 0.239409 0.213745 1038.56 1202.25 1.000 alpha{1,2} 0.424906 0.236395 0.000452 1.369378 0.258066 1294.21 1381.97 1.000 alpha{3} 0.458009 0.227401 0.000170 1.401651 0.305596 1320.31 1322.25 1.000 pinvar{all} 0.998389 0.000004 0.994851 0.999999 0.998976 1054.65 1150.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ..*..* 8 -- .*...* 9 -- .*..*. 10 -- ...*.* 11 -- .***.* 12 -- ...**. 13 -- ..**** 14 -- .****. 15 -- ..**.. 16 -- .**.** 17 -- ..*.*. 18 -- .**... 19 -- .*.*.. 20 -- .*.*** 21 -- ....** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 455 0.151566 0.008951 0.145237 0.157895 2 8 448 0.149234 0.011306 0.141239 0.157229 2 9 446 0.148568 0.011306 0.140573 0.156562 2 10 446 0.148568 0.000942 0.147901 0.149234 2 11 443 0.147568 0.001413 0.146569 0.148568 2 12 440 0.146569 0.005653 0.142572 0.150566 2 13 436 0.145237 0.003769 0.142572 0.147901 2 14 427 0.142239 0.000471 0.141905 0.142572 2 15 424 0.141239 0.001884 0.139907 0.142572 2 16 421 0.140240 0.002355 0.138574 0.141905 2 17 421 0.140240 0.020257 0.125916 0.154564 2 18 408 0.135909 0.008480 0.129913 0.141905 2 19 407 0.135576 0.002355 0.133911 0.137242 2 20 402 0.133911 0.005653 0.129913 0.137908 2 21 389 0.129580 0.003298 0.127249 0.131912 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097503 0.009656 0.000097 0.298493 0.064845 1.000 2 length{all}[2] 0.099341 0.010013 0.000064 0.295841 0.070119 1.000 2 length{all}[3] 0.097732 0.009597 0.000039 0.294908 0.065372 1.000 2 length{all}[4] 0.097559 0.009764 0.000051 0.303216 0.066496 1.000 2 length{all}[5] 0.098587 0.009988 0.000001 0.295229 0.067496 1.000 2 length{all}[6] 0.098457 0.009529 0.000015 0.295910 0.068968 1.001 2 length{all}[7] 0.102238 0.010431 0.000388 0.303991 0.071164 1.000 2 length{all}[8] 0.097790 0.009072 0.000390 0.282858 0.072017 0.998 2 length{all}[9] 0.094146 0.007896 0.000088 0.264614 0.063538 0.998 2 length{all}[10] 0.097101 0.009389 0.000011 0.283133 0.071247 0.998 2 length{all}[11] 0.101288 0.010408 0.000014 0.282558 0.072407 0.998 2 length{all}[12] 0.105401 0.010090 0.000037 0.304766 0.079401 0.998 2 length{all}[13] 0.100853 0.011273 0.000199 0.300771 0.066932 1.002 2 length{all}[14] 0.099491 0.009571 0.000039 0.322576 0.064154 0.998 2 length{all}[15] 0.091821 0.008945 0.000262 0.269705 0.059317 0.998 2 length{all}[16] 0.098963 0.010721 0.000100 0.301266 0.070679 0.999 2 length{all}[17] 0.096120 0.008002 0.000145 0.258279 0.070510 1.002 2 length{all}[18] 0.107156 0.011282 0.000187 0.334049 0.074762 0.998 2 length{all}[19] 0.104955 0.011274 0.000047 0.313509 0.071477 0.999 2 length{all}[20] 0.104176 0.010090 0.001218 0.301314 0.069111 0.998 2 length{all}[21] 0.099896 0.011800 0.000271 0.332461 0.063833 1.009 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005873 Maximum standard deviation of split frequencies = 0.020257 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.009 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------- C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------- C3 (3) + |-------------------------------------------------------------------- C4 (4) | |--------------------------------------------------------------------- C5 (5) | \----------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 924 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 55 patterns at 308 / 308 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 55 patterns at 308 / 308 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 53680 bytes for conP 4840 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.085067 0.043387 0.084752 0.078612 0.101747 0.067598 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1356.158669 Iterating by ming2 Initial: fx= 1356.158669 x= 0.08507 0.04339 0.08475 0.07861 0.10175 0.06760 0.30000 1.30000 1 h-m-p 0.0000 0.0001 738.3369 ++ 1277.868719 m 0.0001 13 | 1/8 2 h-m-p 0.0019 0.0120 51.4341 ------------.. | 1/8 3 h-m-p 0.0000 0.0001 678.4791 ++ 1240.873812 m 0.0001 45 | 2/8 4 h-m-p 0.0012 0.0329 40.4141 -----------.. | 2/8 5 h-m-p 0.0000 0.0000 609.0704 ++ 1227.300218 m 0.0000 76 | 3/8 6 h-m-p 0.0006 0.0397 34.8196 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 528.2370 ++ 1221.604799 m 0.0000 107 | 4/8 8 h-m-p 0.0003 0.0522 27.4517 ----------.. | 4/8 9 h-m-p 0.0000 0.0000 431.5574 ++ 1221.409790 m 0.0000 137 | 5/8 10 h-m-p 0.0002 0.0786 18.3924 ----------.. | 5/8 11 h-m-p 0.0000 0.0001 304.7128 ++ 1216.240445 m 0.0001 167 | 6/8 12 h-m-p 0.5870 8.0000 0.0000 ++ 1216.240445 m 8.0000 178 | 6/8 13 h-m-p 0.5123 8.0000 0.0000 ----C 1216.240445 0 0.0005 195 | 6/8 14 h-m-p 0.0160 8.0000 0.0000 ---C 1216.240445 0 0.0001 211 Out.. lnL = -1216.240445 212 lfun, 212 eigenQcodon, 1272 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.061024 0.018791 0.012333 0.020026 0.090870 0.101079 0.300003 0.713524 0.425533 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 10.731211 np = 9 lnL0 = -1306.690143 Iterating by ming2 Initial: fx= 1306.690143 x= 0.06102 0.01879 0.01233 0.02003 0.09087 0.10108 0.30000 0.71352 0.42553 1 h-m-p 0.0000 0.0000 717.5126 ++ 1285.099891 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0001 388.4212 ++ 1275.391892 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 360.0136 ++ 1274.223991 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0002 809.2115 +++ 1239.579728 m 0.0002 51 | 4/9 5 h-m-p 0.0000 0.0000 5663.1411 ++ 1219.996716 m 0.0000 63 | 5/9 6 h-m-p 0.0000 0.0000 1583.9052 ++ 1216.240362 m 0.0000 75 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 1216.240361 m 8.0000 87 | 6/9 8 h-m-p 0.0018 0.9035 1.1112 ---------Y 1216.240361 0 0.0000 111 | 6/9 9 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240360 m 8.0000 126 | 6/9 10 h-m-p 0.0192 3.5218 0.2844 ----------Y 1216.240360 0 0.0000 151 | 6/9 11 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240360 m 8.0000 169 | 6/9 12 h-m-p 0.0012 0.5816 1.4526 -----------.. | 6/9 13 h-m-p 0.0160 8.0000 0.0003 +++++ 1216.240360 m 8.0000 208 | 6/9 14 h-m-p 0.0025 1.2291 0.8624 ---------C 1216.240360 0 0.0000 232 | 6/9 15 h-m-p 0.0160 8.0000 0.0024 +++++ 1216.240355 m 8.0000 250 | 6/9 16 h-m-p 0.0806 4.0848 0.2429 -------------C 1216.240355 0 0.0000 278 | 6/9 17 h-m-p 0.0160 8.0000 0.0015 +++++ 1216.240351 m 8.0000 296 | 6/9 18 h-m-p 0.0471 3.2084 0.2596 ----------C 1216.240351 0 0.0000 321 | 6/9 19 h-m-p 0.0160 8.0000 0.0004 +++++ 1216.240351 m 8.0000 339 | 6/9 20 h-m-p 0.0110 2.9501 0.2751 -------------.. | 6/9 21 h-m-p 0.0160 8.0000 0.0003 +++++ 1216.240350 m 8.0000 383 | 6/9 22 h-m-p 0.0112 5.1373 0.2154 ------------Y 1216.240350 0 0.0000 410 | 6/9 23 h-m-p 0.0160 8.0000 0.0021 +++++ 1216.240345 m 8.0000 428 | 6/9 24 h-m-p 0.0731 4.1148 0.2324 ------------C 1216.240345 0 0.0000 455 | 6/9 25 h-m-p 0.0160 8.0000 0.0001 -----N 1216.240345 0 0.0000 475 | 6/9 26 h-m-p 0.0160 8.0000 0.0000 +++++ 1216.240345 m 8.0000 493 | 6/9 27 h-m-p 0.0083 4.1577 0.2221 ------------C 1216.240345 0 0.0000 520 | 6/9 28 h-m-p 0.0160 8.0000 0.0000 ------C 1216.240345 0 0.0000 541 | 6/9 29 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9 30 h-m-p 0.0160 8.0000 0.0003 +++++ 1216.240344 m 8.0000 585 | 6/9 31 h-m-p 0.0127 5.4634 0.2074 ---------Y 1216.240344 0 0.0000 609 | 6/9 32 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240343 m 8.0000 627 | 6/9 33 h-m-p 0.0185 2.7481 0.2993 ----------Y 1216.240343 0 0.0000 652 | 6/9 34 h-m-p 0.0160 8.0000 0.0165 +++++ 1216.240298 m 8.0000 670 | 6/9 35 h-m-p 0.3820 2.7944 0.3462 ------------C 1216.240298 0 0.0000 697 | 6/9 36 h-m-p 0.0160 8.0000 0.0003 ------C 1216.240298 0 0.0000 718 | 6/9 37 h-m-p 0.0160 8.0000 0.0015 --------Y 1216.240298 0 0.0000 741 | 6/9 38 h-m-p 0.0160 8.0000 0.0011 +++++ 1216.240295 m 8.0000 759 | 6/9 39 h-m-p 0.0365 4.1943 0.2314 -----------C 1216.240295 0 0.0000 785 | 6/9 40 h-m-p 0.0160 8.0000 0.0002 -------------.. | 6/9 41 h-m-p 0.0160 8.0000 0.0006 +++++ 1216.240292 m 8.0000 829 | 6/9 42 h-m-p 0.0305 7.9557 0.1594 -----------C 1216.240292 0 0.0000 855 | 6/9 43 h-m-p 0.0160 8.0000 0.0009 +++++ 1216.240288 m 8.0000 873 | 6/9 44 h-m-p 0.0362 3.1363 0.2082 ------------C 1216.240288 0 0.0000 900 | 6/9 45 h-m-p 0.0160 8.0000 0.0006 +++++ 1216.240287 m 8.0000 918 | 6/9 46 h-m-p 0.0082 0.5521 0.5937 ---------Y 1216.240287 0 0.0000 942 | 6/9 47 h-m-p 0.0160 8.0000 0.0008 -------------.. | 6/9 48 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240283 m 8.0000 986 | 6/9 49 h-m-p 0.0344 8.0000 0.1534 --------------.. | 6/9 50 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240279 m 8.0000 1031 | 6/9 51 h-m-p 0.0362 8.0000 0.1511 -----------Y 1216.240279 0 0.0000 1057 | 6/9 52 h-m-p 0.0020 0.9864 0.0355 +++++ 1216.240251 m 0.9864 1075 | 7/9 53 h-m-p 0.2218 7.9923 0.1178 ---------------.. | 7/9 54 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240248 m 8.0000 1120 | 7/9 55 h-m-p 0.0275 4.9632 0.1969 --------------.. | 7/9 56 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240244 m 8.0000 1163 | 7/9 57 h-m-p 0.0287 5.0583 0.1942 -------------Y 1216.240244 0 0.0000 1190 | 7/9 58 h-m-p 0.0109 5.4575 0.0097 +++++ 1216.240201 m 5.4575 1207 | 8/9 59 h-m-p 0.2057 8.0000 0.0000 -----------C 1216.240201 0 0.0000 1232 Out.. lnL = -1216.240201 1233 lfun, 3699 eigenQcodon, 14796 P(t) Time used: 0:05 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.058388 0.030577 0.109255 0.066319 0.017984 0.073143 0.244393 1.148108 0.349544 0.310198 1.387560 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.011142 np = 11 lnL0 = -1319.558014 Iterating by ming2 Initial: fx= 1319.558014 x= 0.05839 0.03058 0.10926 0.06632 0.01798 0.07314 0.24439 1.14811 0.34954 0.31020 1.38756 1 h-m-p 0.0000 0.0001 682.6612 ++ 1289.387273 m 0.0001 16 | 1/11 2 h-m-p 0.0000 0.0002 323.8674 ++ 1270.608905 m 0.0002 30 | 2/11 3 h-m-p 0.0000 0.0001 759.0371 ++ 1239.747538 m 0.0001 44 | 3/11 4 h-m-p 0.0000 0.0002 268.6243 ++ 1231.943350 m 0.0002 58 | 4/11 5 h-m-p 0.0000 0.0000 116750.0498 ++ 1227.458151 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0000 8999.2040 ++ 1222.507889 m 0.0000 86 | 6/11 7 h-m-p 0.0030 0.0407 8.2134 ------------.. | 6/11 8 h-m-p 0.0000 0.0001 297.2259 ++ 1216.240385 m 0.0001 124 | 7/11 9 h-m-p 0.2502 8.0000 0.0000 +++ 1216.240385 m 8.0000 139 | 7/11 10 h-m-p 0.0160 8.0000 0.0141 --------C 1216.240385 0 0.0000 165 | 7/11 11 h-m-p 0.0160 8.0000 0.0002 +++++ 1216.240385 m 8.0000 186 | 7/11 12 h-m-p 0.0160 8.0000 1.1449 -------------.. | 7/11 13 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240385 m 8.0000 232 | 7/11 14 h-m-p 0.0160 8.0000 0.0712 -------------.. | 7/11 15 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240385 m 8.0000 282 | 7/11 16 h-m-p 0.0160 8.0000 0.7078 ------------Y 1216.240385 0 0.0000 312 | 7/11 17 h-m-p 0.0160 8.0000 0.0002 +++++ 1216.240385 m 8.0000 333 | 7/11 18 h-m-p 0.0160 8.0000 1.2638 ----------Y 1216.240385 0 0.0000 361 | 7/11 19 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240385 m 8.0000 378 | 7/11 20 h-m-p 0.0001 0.0585 16.4025 ---------Y 1216.240385 0 0.0000 405 | 7/11 21 h-m-p 0.0160 8.0000 0.0773 +++++ 1216.240358 m 8.0000 422 | 7/11 22 h-m-p 0.0001 0.0005 1555.2761 ++ 1216.240328 m 0.0005 440 | 8/11 23 h-m-p 1.0737 8.0000 0.7510 C 1216.240323 0 1.0737 454 | 8/11 24 h-m-p 1.6000 8.0000 0.1598 Y 1216.240322 0 1.0853 471 | 8/11 25 h-m-p 1.6000 8.0000 0.0060 Y 1216.240322 0 0.9619 488 | 8/11 26 h-m-p 1.6000 8.0000 0.0000 ++ 1216.240322 m 8.0000 505 | 8/11 27 h-m-p 0.0160 8.0000 0.0167 +++Y 1216.240322 0 2.2497 525 | 8/11 28 h-m-p 1.6000 8.0000 0.0005 ++ 1216.240322 m 8.0000 542 | 8/11 29 h-m-p 0.0160 8.0000 4.7671 ------------Y 1216.240322 0 0.0000 571 | 8/11 30 h-m-p 0.0011 0.5536 12.4128 +++++ 1216.240138 m 0.5536 588 | 9/11 31 h-m-p 1.6000 8.0000 0.4736 ++ 1216.240135 m 8.0000 602 | 9/11 32 h-m-p 1.6000 8.0000 0.9558 ++ 1216.240134 m 8.0000 618 | 9/11 33 h-m-p 1.6000 8.0000 0.3167 ++ 1216.240134 m 8.0000 634 | 9/11 34 h-m-p 1.6000 8.0000 1.3156 ++ 1216.240134 m 8.0000 650 | 9/11 35 h-m-p 1.3141 8.0000 8.0089 ------Y 1216.240134 0 0.0001 670 | 9/11 36 h-m-p 1.6000 8.0000 0.0000 Y 1216.240134 0 1.6000 684 | 9/11 37 h-m-p 0.0160 8.0000 0.0000 Y 1216.240134 0 0.0160 700 Out.. lnL = -1216.240134 701 lfun, 2804 eigenQcodon, 12618 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1216.297778 S = -1216.241303 -0.021853 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:08 did 20 / 55 patterns 0:08 did 30 / 55 patterns 0:08 did 40 / 55 patterns 0:08 did 50 / 55 patterns 0:08 did 55 / 55 patterns 0:08 Time used: 0:08 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.053997 0.066795 0.094281 0.010197 0.016566 0.041101 0.000100 0.378255 1.886951 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 23.072522 np = 9 lnL0 = -1297.142152 Iterating by ming2 Initial: fx= 1297.142152 x= 0.05400 0.06680 0.09428 0.01020 0.01657 0.04110 0.00011 0.37825 1.88695 1 h-m-p 0.0000 0.0000 678.0542 ++ 1296.535178 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0067 45.3024 +++++ 1290.386253 m 0.0067 29 | 2/9 3 h-m-p 0.0000 0.0001 213.1635 ++ 1283.204876 m 0.0001 41 | 3/9 4 h-m-p 0.0000 0.0004 661.1686 ++ 1244.805834 m 0.0004 53 | 4/9 5 h-m-p 0.0001 0.0006 559.1602 ++ 1228.002449 m 0.0006 65 | 5/9 6 h-m-p 0.0001 0.0003 289.0848 ++ 1226.420797 m 0.0003 77 | 6/9 7 h-m-p 0.0051 0.0336 16.9136 ------------.. | 6/9 8 h-m-p 0.0000 0.0001 293.0658 ++ 1216.240295 m 0.0001 111 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 ++ 1216.240295 m 8.0000 123 | 7/9 10 h-m-p 0.0655 8.0000 0.0011 ++++ 1216.240295 m 8.0000 139 | 7/9 11 h-m-p 0.0160 8.0000 1.0449 +++++ 1216.240281 m 8.0000 156 | 7/9 12 h-m-p 1.6000 8.0000 0.1702 ++ 1216.240281 m 8.0000 168 | 7/9 13 h-m-p 0.2885 2.4776 4.7190 ----------Y 1216.240281 0 0.0000 192 | 7/9 14 h-m-p 1.3041 8.0000 0.0000 ++ 1216.240281 m 8.0000 204 | 7/9 15 h-m-p 0.6879 8.0000 0.0000 -----Y 1216.240281 0 0.0002 223 Out.. lnL = -1216.240281 224 lfun, 2464 eigenQcodon, 13440 P(t) Time used: 0:12 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.090072 0.088740 0.030434 0.061319 0.059352 0.084502 0.000100 0.900000 0.888157 1.321984 1.299887 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 13.733261 np = 11 lnL0 = -1334.395630 Iterating by ming2 Initial: fx= 1334.395630 x= 0.09007 0.08874 0.03043 0.06132 0.05935 0.08450 0.00011 0.90000 0.88816 1.32198 1.29989 1 h-m-p 0.0000 0.0000 660.1233 ++ 1333.697269 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0011 228.7247 ++++ 1281.970435 m 0.0011 32 | 2/11 3 h-m-p 0.0000 0.0001 1171.0585 ++ 1240.908583 m 0.0001 46 | 3/11 4 h-m-p 0.0001 0.0004 84.3589 ++ 1239.084380 m 0.0004 60 | 4/11 5 h-m-p 0.0000 0.0000 19747.9539 ++ 1220.077765 m 0.0000 74 | 5/11 6 h-m-p 0.0000 0.0000 6310.2993 ++ 1216.780486 m 0.0000 88 | 6/11 7 h-m-p 0.0000 0.0000 6961.7120 ++ 1216.240399 m 0.0000 102 | 7/11 8 h-m-p 1.6000 8.0000 0.0019 ++ 1216.240398 m 8.0000 116 | 7/11 9 h-m-p 0.0009 0.0100 16.6943 ++ 1216.240391 m 0.0100 134 | 7/11 10 h-m-p 0.0000 0.0000 0.0221 h-m-p: 2.22017455e-16 1.11008727e-15 2.20925637e-02 1216.240391 .. | 8/11 11 h-m-p 0.0160 8.0000 0.0003 +++++ 1216.240390 m 8.0000 166 | 8/11 12 h-m-p 0.0104 3.0315 0.2351 -----------Y 1216.240390 0 0.0000 194 | 8/11 13 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240390 m 8.0000 214 | 8/11 14 h-m-p 0.0017 0.8625 2.3064 ------------.. | 8/11 15 h-m-p 0.0160 8.0000 0.0003 +++++ 1216.240390 m 8.0000 258 | 8/11 16 h-m-p 0.0121 3.4979 0.2044 ----------Y 1216.240390 0 0.0000 285 | 8/11 17 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240389 m 8.0000 305 | 8/11 18 h-m-p 0.0117 2.9611 0.3483 -----------Y 1216.240389 0 0.0000 333 | 8/11 19 h-m-p 0.0160 8.0000 0.0008 +++++ 1216.240387 m 8.0000 353 | 8/11 20 h-m-p 0.0193 3.0486 0.3162 ----------Y 1216.240387 0 0.0000 380 | 8/11 21 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240386 m 8.0000 400 | 8/11 22 h-m-p 0.0120 3.1137 0.4614 -------------.. | 8/11 23 h-m-p 0.0160 8.0000 0.0003 +++++ 1216.240385 m 8.0000 448 | 8/11 24 h-m-p 0.0115 3.2030 0.2271 ------------Y 1216.240385 0 0.0000 477 | 8/11 25 h-m-p 0.0160 8.0000 0.0009 +++++ 1216.240383 m 8.0000 497 | 8/11 26 h-m-p 0.0299 3.4217 0.2361 -------------Y 1216.240383 0 0.0000 527 | 8/11 27 h-m-p 0.0160 8.0000 0.0018 +++++ 1216.240379 m 8.0000 547 | 8/11 28 h-m-p 0.0571 3.5068 0.2538 --------------.. | 8/11 29 h-m-p 0.0160 8.0000 0.0004 +++++ 1216.240378 m 8.0000 596 | 8/11 30 h-m-p 0.0133 3.4668 0.2157 -----------Y 1216.240378 0 0.0000 624 | 8/11 31 h-m-p 0.0160 8.0000 0.0002 +++++ 1216.240378 m 8.0000 644 | 8/11 32 h-m-p 0.0069 3.4436 0.9535 ----------C 1216.240378 0 0.0000 671 | 8/11 33 h-m-p 0.0160 8.0000 0.0063 +++++ 1216.240372 m 8.0000 691 | 8/11 34 h-m-p 0.0512 3.4179 0.9784 ------------Y 1216.240372 0 0.0000 720 | 8/11 35 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/11 36 h-m-p 0.0160 8.0000 0.0004 +++++ 1216.240370 m 8.0000 768 | 8/11 37 h-m-p 0.0147 3.6225 0.2104 -----------C 1216.240370 0 0.0000 796 | 8/11 38 h-m-p 0.0160 8.0000 0.0029 +++++ 1216.240362 m 8.0000 816 | 8/11 39 h-m-p 0.0953 3.5885 0.2424 -------------N 1216.240362 0 0.0000 846 | 8/11 40 h-m-p 0.0160 8.0000 0.0012 +++++ 1216.240358 m 8.0000 866 | 8/11 41 h-m-p 0.0313 3.7376 0.2965 -----------C 1216.240358 0 0.0000 894 | 8/11 42 h-m-p 0.0160 8.0000 0.0002 +++++ 1216.240358 m 8.0000 914 | 8/11 43 h-m-p 0.0077 3.8382 0.2823 -----------Y 1216.240358 0 0.0000 942 | 8/11 44 h-m-p 0.0160 8.0000 0.0000 -----N 1216.240358 0 0.0000 964 | 8/11 45 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240357 m 8.0000 984 | 8/11 46 h-m-p 0.0078 3.9124 0.2448 -----------N 1216.240357 0 0.0000 1012 | 8/11 47 h-m-p 0.0160 8.0000 0.0001 ------Y 1216.240357 0 0.0000 1035 | 8/11 48 h-m-p 0.0160 8.0000 0.0000 +++++ 1216.240357 m 8.0000 1055 | 8/11 49 h-m-p 0.0077 3.8705 0.2682 -------------.. | 8/11 50 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240356 m 8.0000 1103 | 8/11 51 h-m-p 0.0187 4.0787 0.1946 ----------C 1216.240356 0 0.0000 1130 | 8/11 52 h-m-p 0.0160 8.0000 0.0004 +++++ 1216.240354 m 8.0000 1150 | 8/11 53 h-m-p 0.0124 3.9323 0.2893 -----------Y 1216.240354 0 0.0000 1178 | 8/11 54 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240353 m 8.0000 1198 | 8/11 55 h-m-p 0.0149 3.9815 0.2600 -----------Y 1216.240353 0 0.0000 1226 | 8/11 56 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240353 m 8.0000 1246 | 8/11 57 h-m-p 0.0094 4.7248 0.2709 -----------N 1216.240353 0 0.0000 1274 | 8/11 58 h-m-p 0.0160 8.0000 0.0000 +++++ 1216.240353 m 8.0000 1294 | 8/11 59 h-m-p 0.0086 4.2828 0.1912 -----------N 1216.240353 0 0.0000 1322 | 8/11 60 h-m-p 0.0160 8.0000 0.0000 +++++ 1216.240352 m 8.0000 1342 | 8/11 61 h-m-p 0.0089 4.4536 0.1943 ----------Y 1216.240352 0 0.0000 1369 | 8/11 62 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240352 m 8.0000 1389 | 8/11 63 h-m-p 0.0088 4.3926 0.1894 -------------.. | 8/11 64 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240350 m 8.0000 1437 | 8/11 65 h-m-p 0.0204 4.2589 0.1889 -------------.. | 8/11 66 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240348 m 8.0000 1485 | 8/11 67 h-m-p 0.0211 4.3201 0.1871 -------------.. | 8/11 68 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240346 m 8.0000 1533 | 8/11 69 h-m-p 0.0218 4.3887 0.1850 -----------C 1216.240346 0 0.0000 1561 | 8/11 70 h-m-p 0.0160 8.0000 0.0002 +++++ 1216.240346 m 8.0000 1581 | 8/11 71 h-m-p 0.0086 4.3176 0.3724 ----------Y 1216.240346 0 0.0000 1608 | 8/11 72 h-m-p 0.0160 8.0000 0.0025 +++++ 1216.240340 m 8.0000 1628 | 8/11 73 h-m-p 0.0457 4.1306 0.4427 ------------Y 1216.240340 0 0.0000 1657 | 8/11 74 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240340 m 8.0000 1677 | 8/11 75 h-m-p 0.0089 4.4309 0.3661 ----------C 1216.240340 0 0.0000 1704 | 8/11 76 h-m-p 0.0160 8.0000 0.0001 +++++ 1216.240340 m 8.0000 1724 | 8/11 77 h-m-p 0.0091 4.5509 0.3698 -----------Y 1216.240340 0 0.0000 1752 | 8/11 78 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11 79 h-m-p 0.0160 8.0000 0.0005 +++++ 1216.240337 m 8.0000 1800 | 8/11 80 h-m-p 0.0246 4.6431 0.1780 ----------Y 1216.240337 0 0.0000 1827 | 8/11 81 h-m-p 0.0160 8.0000 0.0008 +++++ 1216.240335 m 8.0000 1847 | 8/11 82 h-m-p 0.0316 4.9513 0.2084 -----------N 1216.240335 0 0.0000 1875 | 8/11 83 h-m-p 0.0160 8.0000 0.0007 +++++ 1216.240333 m 8.0000 1895 | 8/11 84 h-m-p 0.0186 4.7005 0.3046 -------------.. | 8/11 85 h-m-p 0.0160 8.0000 0.0006 +++++ 1216.240330 m 8.0000 1943 | 8/11 86 h-m-p 0.0275 4.9010 0.1713 -----------N 1216.240330 0 0.0000 1971 | 8/11 87 h-m-p 0.0008 0.3864 0.4254 +++++ 1216.240134 m 0.3864 1991 | 9/11 88 h-m-p 1.6000 8.0000 0.0000 Y 1216.240134 0 1.6000 2008 | 9/11 89 h-m-p 0.2414 8.0000 0.0000 -Y 1216.240134 0 0.0151 2025 | 9/11 90 h-m-p 0.0741 8.0000 0.0000 Y 1216.240134 0 0.0185 2041 | 9/11 91 h-m-p 0.0015 0.7688 5.0487 ----------N 1216.240134 0 0.0000 2067 | 9/11 92 h-m-p 0.9757 8.0000 0.0000 Y 1216.240134 0 0.9757 2081 | 9/11 93 h-m-p 1.6000 8.0000 0.0000 C 1216.240134 0 1.6000 2097 Out.. lnL = -1216.240134 2098 lfun, 25176 eigenQcodon, 138468 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1216.314671 S = -1216.241302 -0.032719 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:45 did 20 / 55 patterns 0:45 did 30 / 55 patterns 0:45 did 40 / 55 patterns 0:45 did 50 / 55 patterns 0:46 did 55 / 55 patterns 0:46 Time used: 0:46 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=308 NC_011896_1_WP_010907906_1_787_MLBR_RS03710 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA NC_002677_1_NP_301582_1_454_wbbL VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA ************************************************** NC_011896_1_WP_010907906_1_787_MLBR_RS03710 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP NC_002677_1_NP_301582_1_454_wbbL VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP ************************************************** NC_011896_1_WP_010907906_1_787_MLBR_RS03710 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG NC_002677_1_NP_301582_1_454_wbbL DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG ************************************************** NC_011896_1_WP_010907906_1_787_MLBR_RS03710 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG NC_002677_1_NP_301582_1_454_wbbL MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG ************************************************** NC_011896_1_WP_010907906_1_787_MLBR_RS03710 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA NC_002677_1_NP_301582_1_454_wbbL FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA ************************************************** NC_011896_1_WP_010907906_1_787_MLBR_RS03710 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA NC_002677_1_NP_301582_1_454_wbbL AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA ************************************************** NC_011896_1_WP_010907906_1_787_MLBR_RS03710 RQLAEGRR NC_002677_1_NP_301582_1_454_wbbL RQLAEGRR NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 RQLAEGRR NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 RQLAEGRR NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 RQLAEGRR NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 RQLAEGRR ********
>NC_011896_1_WP_010907906_1_787_MLBR_RS03710 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >NC_002677_1_NP_301582_1_454_wbbL GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT >NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 GTGACTGACGTGCTGCCCGTCGTCGCGGTGACTTACTCGCCGGGACCGCA CTTGGAGCGTTTTCTGGCTTCGTTAGCATTGGCCACTGACCGCCCGGTGA GCGTGGTGTTGGCCGACAACGGGTCCACTGACGGGACACCGCAGGTGGCG GTCGAACGTTACGTCAATGTTCGGTTGTTTGAGACCGGGGCCAACCTCGG GTACGGAACCGCTGCGAATCTCGCTATCGCACAGTTTTTTGAGGAGGGCG GGGCAACCGGCCAACCTTGGGTCGATGATTGGGTGATTGTGGCCAACCCT GACGTGCAATGGGGTCCGGGCAGTATCGACGCTCTGCTGGACGCCGCCGC CCGATGGCCCCGCGCGGGGGCCCTGGGCCCGCTGATTCGTGATCCCGACG GGTCGGTGTATCCGTCCGCGCGTCATTTACCAAGCTTGGTTCGCGGTGGC ATGCACGCAGTGTTGGGGCCGGTTTGGCCACGCAATCCGTGGACAGCTGC CTACCGCCAGGAACGGCTCGAGCTCACCGAACGGCCGGTGGGCTGGCTGT CGGGTTCGTGTCTGCTAGTGCGGCGTTCGGCTTTCCGTGAGGTCGGTGGC TTCGACGAGCGCTACTTCATGTACATGGAGGACGTCGACTTGGGGGACCG GCTCGGCAAAGCTGGTTGGCTAAGCGTCTATGTGCCGTCGGCCGAAGTGC TGCATCACAAGGGCCACTCCACCGGACGTGACCCGGTAAGCCATTTGGCG GCCCACCACAAAAGCACCTATATCTTCTTGGCTGATCGACATTCTGGTTG GTGGCGAGCCCCGCTGCGCTGGATGCTGCGTGGCTCGTTGGTGGTGCGTT CTCGCCTGATGGTGCGTAGTTCGCGTCGTAAACAGGCTGCGAAGCAGGCC AGGCAACTGGCAGAAGGGCGACGT
>NC_011896_1_WP_010907906_1_787_MLBR_RS03710 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >NC_002677_1_NP_301582_1_454_wbbL VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR >NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 VTDVLPVVAVTYSPGPHLERFLASLALATDRPVSVVLADNGSTDGTPQVA VERYVNVRLFETGANLGYGTAANLAIAQFFEEGGATGQPWVDDWVIVANP DVQWGPGSIDALLDAAARWPRAGALGPLIRDPDGSVYPSARHLPSLVRGG MHAVLGPVWPRNPWTAAYRQERLELTERPVGWLSGSCLLVRRSAFREVGG FDERYFMYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKGHSTGRDPVSHLA AHHKSTYIFLADRHSGWWRAPLRWMLRGSLVVRSRLMVRSSRRKQAAKQA RQLAEGRR
#NEXUS [ID: 0570605940] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907906_1_787_MLBR_RS03710 NC_002677_1_NP_301582_1_454_wbbL NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 ; end; begin trees; translate 1 NC_011896_1_WP_010907906_1_787_MLBR_RS03710, 2 NC_002677_1_NP_301582_1_454_wbbL, 3 NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860, 4 NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805, 5 NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110, 6 NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06484451,2:0.07011895,3:0.06537194,4:0.06649567,5:0.06749615,6:0.0689678); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06484451,2:0.07011895,3:0.06537194,4:0.06649567,5:0.06749615,6:0.0689678); end;
Estimated marginal likelihoods for runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1241.92 -1245.23 2 -1241.97 -1245.85 -------------------------------------- TOTAL -1241.94 -1245.59 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/wbbL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890519 0.089031 0.332162 1.452637 0.859783 1391.94 1446.47 1.000 r(A<->C){all} 0.171190 0.019528 0.000107 0.451733 0.137919 94.35 205.14 1.002 r(A<->G){all} 0.169459 0.021934 0.000191 0.466578 0.128385 110.30 228.37 1.001 r(A<->T){all} 0.173563 0.021561 0.000047 0.469307 0.134254 146.68 173.33 1.001 r(C<->G){all} 0.160869 0.019865 0.000098 0.435774 0.120458 215.63 238.94 1.001 r(C<->T){all} 0.163870 0.018430 0.000046 0.428004 0.131090 191.37 251.23 1.000 r(G<->T){all} 0.161049 0.020339 0.000021 0.453306 0.117954 113.63 171.57 1.000 pi(A){all} 0.153014 0.000140 0.130570 0.175537 0.152780 1108.90 1259.47 1.000 pi(C){all} 0.285780 0.000220 0.257869 0.315427 0.285614 1103.71 1183.80 1.001 pi(G){all} 0.347100 0.000250 0.316094 0.378444 0.347319 1148.34 1213.79 1.000 pi(T){all} 0.214106 0.000172 0.188413 0.239409 0.213745 1038.56 1202.25 1.000 alpha{1,2} 0.424906 0.236395 0.000452 1.369378 0.258066 1294.21 1381.97 1.000 alpha{3} 0.458009 0.227401 0.000170 1.401651 0.305596 1320.31 1322.25 1.000 pinvar{all} 0.998389 0.000004 0.994851 0.999999 0.998976 1054.65 1150.90 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/wbbL/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 308 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 4 4 4 4 4 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1 TTC 4 4 4 4 4 4 | TCC 3 3 3 3 3 3 | TAC 6 6 6 6 6 6 | TGC 0 0 0 0 0 0 Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 10 10 10 10 10 10 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 11 11 11 11 11 11 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 4 4 4 4 4 4 | Arg CGT 13 13 13 13 13 13 CTC 5 5 5 5 5 5 | CCC 3 3 3 3 3 3 | CAC 6 6 6 6 6 6 | CGC 8 8 8 8 8 8 CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 4 4 4 4 4 4 CTG 13 13 13 13 13 13 | CCG 13 13 13 13 13 13 | CAG 5 5 5 5 5 5 | CGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 4 4 4 4 4 4 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2 ATC 3 3 3 3 3 3 | ACC 6 6 6 6 6 6 | AAC 3 3 3 3 3 3 | AGC 5 5 5 5 5 5 ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 5 5 5 5 5 5 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 9 9 9 9 9 9 | Asp GAT 4 4 4 4 4 4 | Gly GGT 6 6 6 6 6 6 GTC 8 8 8 8 8 8 | GCC 13 13 13 13 13 13 | GAC 13 13 13 13 13 13 | GGC 10 10 10 10 10 10 GTA 1 1 1 1 1 1 | GCA 5 5 5 5 5 5 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3 GTG 19 19 19 19 19 19 | GCG 7 7 7 7 7 7 | GAG 8 8 8 8 8 8 | GGG 10 10 10 10 10 10 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907906_1_787_MLBR_RS03710 position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 #2: NC_002677_1_NP_301582_1_454_wbbL position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 #3: NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860 position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 #4: NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805 position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 #5: NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110 position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 #6: NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165 position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 24 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 6 TTC 24 | TCC 18 | TAC 36 | TGC 0 Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 60 | TCG 54 | TAG 0 | Trp W TGG 66 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 12 | His H CAT 24 | Arg R CGT 78 CTC 30 | CCC 18 | CAC 36 | CGC 48 CTA 12 | CCA 12 | Gln Q CAA 18 | CGA 24 CTG 78 | CCG 78 | CAG 30 | CGG 30 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 24 | Asn N AAT 18 | Ser S AGT 12 ATC 18 | ACC 36 | AAC 18 | AGC 30 ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 30 | ACG 0 | AAG 12 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 54 | Asp D GAT 24 | Gly G GGT 36 GTC 48 | GCC 78 | GAC 78 | GGC 60 GTA 6 | GCA 30 | Glu E GAA 30 | GGA 18 GTG 114 | GCG 42 | GAG 48 | GGG 60 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.17857 C:0.28571 A:0.13312 G:0.40260 position 2: T:0.26299 C:0.25974 A:0.22078 G:0.25649 position 3: T:0.20130 C:0.31169 A:0.10390 G:0.38312 Average T:0.21429 C:0.28571 A:0.15260 G:0.34740 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1216.240445 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300003 1.299887 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907906_1_787_MLBR_RS03710: 0.000004, NC_002677_1_NP_301582_1_454_wbbL: 0.000004, NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860: 0.000004, NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805: 0.000004, NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110: 0.000004, NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.30000 omega (dN/dS) = 1.29989 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 693.5 230.5 1.2999 0.0000 0.0000 0.0 0.0 7..2 0.000 693.5 230.5 1.2999 0.0000 0.0000 0.0 0.0 7..3 0.000 693.5 230.5 1.2999 0.0000 0.0000 0.0 0.0 7..4 0.000 693.5 230.5 1.2999 0.0000 0.0000 0.0 0.0 7..5 0.000 693.5 230.5 1.2999 0.0000 0.0000 0.0 0.0 7..6 0.000 693.5 230.5 1.2999 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1216.240201 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.244393 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907906_1_787_MLBR_RS03710: 0.000004, NC_002677_1_NP_301582_1_454_wbbL: 0.000004, NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860: 0.000004, NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805: 0.000004, NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110: 0.000004, NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.24439 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 694.8 229.2 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 694.8 229.2 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 694.8 229.2 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 694.8 229.2 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 694.8 229.2 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 694.8 229.2 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1216.240134 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907906_1_787_MLBR_RS03710: 0.000004, NC_002677_1_NP_301582_1_454_wbbL: 0.000004, NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860: 0.000004, NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805: 0.000004, NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110: 0.000004, NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907906_1_787_MLBR_RS03710) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:08 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1216.240281 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 2.640402 11.421280 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907906_1_787_MLBR_RS03710: 0.000004, NC_002677_1_NP_301582_1_454_wbbL: 0.000004, NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860: 0.000004, NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805: 0.000004, NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110: 0.000004, NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 2.64040 q = 11.42128 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.05096 0.08528 0.11163 0.13594 0.16022 0.18584 0.21437 0.24842 0.29399 0.37616 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 701.4 222.6 0.1863 0.0000 0.0000 0.0 0.0 7..2 0.000 701.4 222.6 0.1863 0.0000 0.0000 0.0 0.0 7..3 0.000 701.4 222.6 0.1863 0.0000 0.0000 0.0 0.0 7..4 0.000 701.4 222.6 0.1863 0.0000 0.0000 0.0 0.0 7..5 0.000 701.4 222.6 0.1863 0.0000 0.0000 0.0 0.0 7..6 0.000 701.4 222.6 0.1863 0.0000 0.0000 0.0 0.0 Time used: 0:12 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1216.240134 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.670910 1.883917 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907906_1_787_MLBR_RS03710: 0.000004, NC_002677_1_NP_301582_1_454_wbbL: 0.000004, NZ_LVXE01000001_1_WP_010907906_1_172_A3216_RS00860: 0.000004, NZ_LYPH01000001_1_WP_010907906_1_161_A8144_RS00805: 0.000004, NZ_CP029543_1_WP_010907906_1_808_DIJ64_RS04110: 0.000004, NZ_AP014567_1_WP_010907906_1_819_JK2ML_RS04165: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.67091 (p1 = 0.00001) w = 1.88392 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.88392 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 701.4 222.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907906_1_787_MLBR_RS03710) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.094 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.106 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.105 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095 Time used: 0:46
Model 1: NearlyNeutral -1216.240201 Model 2: PositiveSelection -1216.240134 Model 0: one-ratio -1216.240445 Model 7: beta -1216.240281 Model 8: beta&w>1 -1216.240134 Model 0 vs 1 4.8799999967741314E-4 Model 2 vs 1 1.3400000034380355E-4 Model 8 vs 7 2.9400000039458973E-4