--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:00:47 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/12res/xerD/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1304.25 -1310.04 2 -1304.26 -1309.51 -------------------------------------- TOTAL -1304.26 -1309.81 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.844430 0.088693 0.335826 1.460997 0.811372 1501.00 1501.00 1.000 r(A<->C){all} 0.129529 0.013670 0.000019 0.361616 0.094198 257.17 328.32 1.002 r(A<->G){all} 0.166072 0.020798 0.000098 0.452663 0.128246 239.12 263.82 1.000 r(A<->T){all} 0.164653 0.020544 0.000041 0.465120 0.125544 226.14 245.91 1.003 r(C<->G){all} 0.105245 0.013581 0.000063 0.359783 0.063281 216.36 229.27 1.000 r(C<->T){all} 0.269536 0.029189 0.000604 0.582305 0.243650 152.64 170.88 1.000 r(G<->T){all} 0.164964 0.021162 0.000233 0.453155 0.123880 186.13 221.67 1.000 pi(A){all} 0.164330 0.000151 0.141212 0.188894 0.164124 1190.63 1209.04 1.000 pi(C){all} 0.268535 0.000201 0.242438 0.296880 0.268244 1133.34 1262.93 1.000 pi(G){all} 0.344925 0.000251 0.317013 0.377899 0.344770 1127.30 1189.88 1.000 pi(T){all} 0.222210 0.000188 0.195029 0.249049 0.222264 1154.28 1236.99 1.000 alpha{1,2} 0.216967 0.077565 0.000418 0.690369 0.128165 1250.09 1287.23 1.000 alpha{3} 0.272986 0.085186 0.003073 0.790876 0.184897 1167.91 1212.56 1.000 pinvar{all} 0.993728 0.000018 0.985493 0.999392 0.994748 1501.00 1501.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1261.924124 Model 2: PositiveSelection -1261.917291 Model 0: one-ratio -1261.923923 Model 7: beta -1261.92399 Model 8: beta&w>1 -1261.923931 Model 0 vs 1 4.019999996671686E-4 Model 2 vs 1 0.013665999999830092 Model 8 vs 7 1.1799999992945231E-4
>C1 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C2 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C3 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C4 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C5 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C6 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHWFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=316 C1 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C2 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C3 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C4 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C5 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C6 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL ************************************************** C1 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C2 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C3 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C4 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C5 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C6 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHWFAVAEG ******************************************* ****** C1 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C2 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C3 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C4 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C5 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C6 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ************************************************** C1 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C2 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C3 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C4 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C5 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C6 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV ************************************************** C1 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C2 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C3 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C4 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C5 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C6 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE ************************************************** C1 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C2 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C3 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C4 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C5 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C6 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT ************************************************** C1 VQALREVWAGAHPRAK C2 VQALREVWAGAHPRAK C3 VQALREVWAGAHPRAK C4 VQALREVWAGAHPRAK C5 VQALREVWAGAHPRAK C6 VQALREVWAGAHPRAK **************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 316 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 316 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9480] Library Relaxation: Multi_proc [96] Relaxation Summary: [9480]--->[9480] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.511 Mb, Max= 30.881 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C2 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C3 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C4 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C5 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL C6 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL ************************************************** C1 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C2 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C3 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C4 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C5 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG C6 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHWFAVAEG ******************************************* ****** C1 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C2 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C3 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C4 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C5 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR C6 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ************************************************** C1 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C2 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C3 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C4 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C5 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV C6 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV ************************************************** C1 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C2 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C3 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C4 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C5 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE C6 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE ************************************************** C1 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C2 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C3 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C4 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C5 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT C6 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT ************************************************** C1 VQALREVWAGAHPRAK C2 VQALREVWAGAHPRAK C3 VQALREVWAGAHPRAK C4 VQALREVWAGAHPRAK C5 VQALREVWAGAHPRAK C6 VQALREVWAGAHPRAK **************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 99.68 C1 C6 99.68 TOP 5 0 99.68 C6 C1 99.68 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.68 C2 C6 99.68 TOP 5 1 99.68 C6 C2 99.68 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 99.68 C3 C6 99.68 TOP 5 2 99.68 C6 C3 99.68 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 99.68 C4 C6 99.68 TOP 5 3 99.68 C6 C4 99.68 BOT 4 5 99.68 C5 C6 99.68 TOP 5 4 99.68 C6 C5 99.68 AVG 0 C1 * 99.94 AVG 1 C2 * 99.94 AVG 2 C3 * 99.94 AVG 3 C4 * 99.94 AVG 4 C5 * 99.94 AVG 5 C6 * 99.68 TOT TOT * 99.89 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT C2 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT C3 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT C4 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT C5 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT C6 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT ************************************************** C1 GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG C2 GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG C3 GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG C4 GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG C5 GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG C6 GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ************************************************** C1 ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG C2 ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG C3 ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG C4 ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG C5 ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG C6 ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG ************************************************** C1 GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG C2 GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG C3 GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG C4 GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG C5 GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG C6 GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG ************************************************** C1 TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC C2 TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC C3 TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC C4 TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC C5 TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC C6 TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC ************************************************** C1 GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG C2 GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG C3 GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG C4 GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG C5 GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG C6 GAGCGTTGATCGCAGTGCGCGGTTTGCATTGGTTCGCTGTTGCCGAAGGG ***************************** ********** ********* C1 TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG C2 TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG C3 TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG C4 TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG C5 TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG C6 TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG ************************************************** C1 TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA C2 TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA C3 TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA C4 TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA C5 TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA C6 TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA ************************************************** C1 GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG C2 GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG C3 GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG C4 GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG C5 GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG C6 GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG ************************************************** C1 GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT C2 GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT C3 GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT C4 GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT C5 GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT C6 GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT ************************************************** C1 TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC C2 TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC C3 TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC C4 TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC C5 TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC C6 TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC ************************************************** C1 AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG C2 AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG C3 AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG C4 AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG C5 AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG C6 AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG ************************************************** C1 CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG C2 CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG C3 CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG C4 CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG C5 CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG C6 CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG ************************************************** C1 GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG C2 GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG C3 GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG C4 GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG C5 GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG C6 GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG ************************************************** C1 GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA C2 GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA C3 GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA C4 GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA C5 GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA C6 GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA ************************************************** C1 CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT C2 CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT C3 CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT C4 CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT C5 CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT C6 CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT ************************************************** C1 TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT C2 TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT C3 TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT C4 TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT C5 TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT C6 TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT ************************************************** C1 TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT C2 TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT C3 TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT C4 TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT C5 TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT C6 TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT ************************************************** C1 GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA C2 GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA C3 GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA C4 GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA C5 GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA C6 GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA ************************************************ >C1 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >C2 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >C3 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >C4 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >C5 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >C6 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATTGGTTCGCTGTTGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >C1 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C2 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C3 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C4 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C5 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >C6 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHWFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 948 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791540 Setting output file names to "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1886066586 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0852416505 Seed = 1412930023 Swapseed = 1579791540 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 5 unique site patterns Division 2 has 4 unique site patterns Division 3 has 5 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2128.475165 -- -24.965149 Chain 2 -- -2128.471942 -- -24.965149 Chain 3 -- -2128.472065 -- -24.965149 Chain 4 -- -2128.475165 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2128.475165 -- -24.965149 Chain 2 -- -2128.472066 -- -24.965149 Chain 3 -- -2128.475041 -- -24.965149 Chain 4 -- -2128.475165 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2128.475] (-2128.472) (-2128.472) (-2128.475) * [-2128.475] (-2128.472) (-2128.475) (-2128.475) 500 -- (-1331.110) (-1314.893) [-1307.806] (-1319.777) * (-1315.434) [-1310.589] (-1317.148) (-1335.493) -- 0:00:00 1000 -- (-1316.894) (-1307.466) (-1309.652) [-1304.236] * (-1307.896) (-1310.434) (-1306.669) [-1308.302] -- 0:00:00 1500 -- (-1309.527) (-1306.119) [-1310.312] (-1311.406) * (-1308.161) (-1303.587) [-1303.832] (-1303.766) -- 0:00:00 2000 -- [-1304.513] (-1311.114) (-1305.540) (-1305.535) * (-1314.435) (-1307.645) [-1303.700] (-1307.246) -- 0:00:00 2500 -- (-1320.599) (-1329.470) (-1317.013) [-1305.476] * (-1309.242) [-1310.817] (-1313.205) (-1319.663) -- 0:00:00 3000 -- (-1318.522) (-1308.999) [-1314.502] (-1303.581) * (-1306.401) (-1306.547) [-1310.325] (-1309.325) -- 0:00:00 3500 -- (-1304.730) [-1305.289] (-1308.224) (-1309.229) * (-1313.456) [-1308.795] (-1310.386) (-1305.127) -- 0:00:00 4000 -- [-1307.902] (-1316.248) (-1307.534) (-1309.622) * (-1310.241) [-1307.020] (-1306.842) (-1306.252) -- 0:00:00 4500 -- (-1305.684) (-1313.602) [-1307.587] (-1308.947) * (-1306.395) [-1308.367] (-1309.311) (-1310.086) -- 0:00:00 5000 -- (-1307.634) (-1304.947) (-1309.468) [-1313.766] * (-1306.857) (-1316.410) [-1310.138] (-1308.382) -- 0:00:00 Average standard deviation of split frequencies: 0.082309 5500 -- [-1308.260] (-1307.689) (-1308.200) (-1313.072) * (-1308.260) [-1315.363] (-1304.743) (-1302.604) -- 0:00:00 6000 -- (-1322.529) (-1309.934) [-1307.061] (-1307.646) * (-1310.001) [-1309.177] (-1304.934) (-1313.696) -- 0:00:00 6500 -- (-1307.394) (-1309.068) (-1311.671) [-1310.158] * (-1309.545) (-1316.069) (-1303.563) [-1306.564] -- 0:00:00 7000 -- (-1303.060) (-1310.377) (-1312.585) [-1310.236] * (-1305.993) [-1314.089] (-1306.669) (-1301.793) -- 0:00:00 7500 -- [-1308.468] (-1312.995) (-1309.681) (-1307.413) * [-1307.314] (-1306.745) (-1307.309) (-1309.150) -- 0:00:00 8000 -- (-1318.951) (-1313.842) (-1313.444) [-1303.345] * (-1304.777) (-1305.272) [-1311.193] (-1304.683) -- 0:00:00 8500 -- (-1310.716) [-1312.095] (-1305.923) (-1312.970) * (-1311.586) (-1308.564) (-1313.885) [-1303.930] -- 0:00:00 9000 -- (-1304.699) (-1314.138) [-1304.999] (-1333.843) * (-1311.720) (-1310.711) [-1304.341] (-1309.486) -- 0:00:00 9500 -- (-1305.864) (-1311.113) (-1315.654) [-1305.414] * (-1308.058) (-1313.304) [-1301.953] (-1314.265) -- 0:01:44 10000 -- (-1306.148) (-1307.072) [-1315.665] (-1310.773) * (-1311.193) (-1316.981) [-1302.125] (-1302.791) -- 0:01:39 Average standard deviation of split frequencies: 0.075761 10500 -- (-1304.696) (-1307.691) [-1307.935] (-1304.342) * (-1314.425) (-1315.010) [-1311.840] (-1306.607) -- 0:01:34 11000 -- (-1305.286) (-1304.653) [-1316.113] (-1305.559) * (-1310.941) (-1303.555) [-1304.355] (-1305.962) -- 0:01:29 11500 -- [-1304.697] (-1314.517) (-1320.264) (-1310.825) * (-1303.505) (-1310.585) [-1305.001] (-1316.221) -- 0:01:25 12000 -- (-1304.679) [-1311.363] (-1306.114) (-1310.100) * (-1308.532) (-1313.592) [-1306.420] (-1310.953) -- 0:01:22 12500 -- (-1311.476) [-1310.767] (-1304.927) (-1305.075) * (-1307.904) (-1317.414) (-1310.046) [-1300.803] -- 0:01:19 13000 -- (-1305.380) (-1312.099) (-1304.858) [-1305.551] * (-1310.030) (-1308.642) [-1302.739] (-1305.968) -- 0:01:15 13500 -- (-1309.101) [-1307.560] (-1307.126) (-1305.104) * (-1312.365) [-1303.205] (-1307.377) (-1309.490) -- 0:01:13 14000 -- (-1308.430) [-1305.460] (-1308.569) (-1310.016) * [-1306.785] (-1311.206) (-1302.035) (-1310.169) -- 0:01:10 14500 -- (-1302.664) (-1305.576) [-1305.088] (-1304.571) * [-1311.555] (-1310.876) (-1304.307) (-1302.511) -- 0:01:07 15000 -- (-1303.218) [-1307.085] (-1305.485) (-1305.513) * (-1302.776) (-1307.456) (-1311.841) [-1303.191] -- 0:01:05 Average standard deviation of split frequencies: 0.079550 15500 -- (-1308.120) (-1307.584) [-1305.149] (-1306.147) * (-1307.463) (-1311.205) (-1303.162) [-1305.217] -- 0:01:03 16000 -- (-1303.332) [-1311.508] (-1306.085) (-1308.402) * [-1305.925] (-1305.775) (-1309.453) (-1306.175) -- 0:01:01 16500 -- (-1303.940) (-1310.174) [-1303.915] (-1309.354) * (-1307.277) (-1305.826) [-1302.815] (-1306.422) -- 0:00:59 17000 -- [-1307.451] (-1305.782) (-1307.579) (-1311.449) * (-1308.447) (-1305.983) [-1308.448] (-1307.708) -- 0:00:57 17500 -- (-1311.098) (-1304.616) (-1303.774) [-1307.065] * (-1314.258) (-1309.455) [-1303.768] (-1304.410) -- 0:00:56 18000 -- (-1309.379) (-1312.977) [-1303.011] (-1306.403) * (-1311.769) (-1309.236) (-1307.632) [-1303.667] -- 0:00:54 18500 -- (-1309.745) (-1305.429) [-1304.345] (-1307.928) * (-1310.278) (-1307.240) (-1309.701) [-1306.393] -- 0:00:53 19000 -- [-1306.626] (-1306.902) (-1304.960) (-1310.996) * (-1303.364) (-1307.912) [-1308.005] (-1307.360) -- 0:00:51 19500 -- (-1305.624) (-1310.152) (-1305.685) [-1309.528] * (-1311.686) (-1310.150) [-1309.675] (-1308.602) -- 0:00:50 20000 -- (-1308.409) [-1308.825] (-1305.193) (-1304.441) * (-1308.288) (-1314.449) [-1311.633] (-1303.493) -- 0:00:49 Average standard deviation of split frequencies: 0.052748 20500 -- (-1306.300) [-1305.521] (-1303.391) (-1305.513) * (-1305.362) [-1313.354] (-1304.797) (-1305.624) -- 0:01:35 21000 -- (-1308.296) (-1310.569) (-1303.816) [-1304.773] * (-1318.004) (-1313.010) [-1301.589] (-1306.379) -- 0:01:33 21500 -- (-1308.743) [-1312.058] (-1307.768) (-1309.215) * (-1307.047) (-1307.464) [-1306.754] (-1302.889) -- 0:01:31 22000 -- (-1306.474) (-1306.233) (-1306.461) [-1307.646] * [-1308.203] (-1309.645) (-1314.675) (-1304.738) -- 0:01:28 22500 -- (-1309.777) [-1307.661] (-1304.535) (-1311.043) * (-1301.447) (-1303.034) (-1308.637) [-1305.219] -- 0:01:26 23000 -- (-1308.864) [-1301.750] (-1302.665) (-1304.907) * (-1310.864) [-1307.405] (-1305.064) (-1309.252) -- 0:01:24 23500 -- (-1309.757) [-1308.606] (-1302.866) (-1309.245) * (-1303.175) (-1305.877) (-1304.353) [-1303.907] -- 0:01:23 24000 -- (-1305.827) [-1304.840] (-1305.472) (-1311.352) * (-1307.954) (-1308.855) [-1304.103] (-1309.196) -- 0:01:21 24500 -- (-1305.727) (-1307.559) (-1308.604) [-1306.493] * (-1312.133) (-1311.421) [-1301.370] (-1308.089) -- 0:01:19 25000 -- (-1305.128) [-1307.704] (-1306.810) (-1309.908) * [-1299.659] (-1306.650) (-1314.253) (-1304.447) -- 0:01:18 Average standard deviation of split frequencies: 0.041033 25500 -- (-1305.373) [-1302.201] (-1309.072) (-1309.712) * (-1305.783) (-1307.562) (-1311.544) [-1303.361] -- 0:01:16 26000 -- (-1304.172) [-1303.191] (-1306.018) (-1306.253) * [-1305.624] (-1310.038) (-1307.929) (-1312.830) -- 0:01:14 26500 -- (-1305.311) [-1308.863] (-1313.622) (-1309.975) * [-1305.333] (-1307.750) (-1312.268) (-1311.453) -- 0:01:13 27000 -- (-1306.675) [-1305.996] (-1307.843) (-1306.912) * [-1307.769] (-1307.543) (-1301.890) (-1311.869) -- 0:01:12 27500 -- (-1306.750) [-1303.918] (-1312.135) (-1309.412) * (-1302.453) (-1315.256) [-1309.584] (-1303.662) -- 0:01:10 28000 -- (-1303.751) (-1307.837) [-1310.105] (-1311.131) * (-1301.543) (-1309.215) (-1305.141) [-1309.491] -- 0:01:09 28500 -- (-1308.529) (-1307.288) (-1312.739) [-1308.388] * (-1300.828) (-1311.156) (-1303.275) [-1303.809] -- 0:01:08 29000 -- (-1305.901) (-1308.659) (-1308.069) [-1308.811] * (-1302.560) (-1309.306) [-1304.921] (-1305.506) -- 0:01:06 29500 -- [-1304.824] (-1300.635) (-1306.995) (-1304.122) * [-1305.405] (-1313.541) (-1304.958) (-1312.208) -- 0:01:05 30000 -- (-1309.393) [-1301.299] (-1308.050) (-1307.851) * (-1304.290) (-1312.219) (-1305.159) [-1307.284] -- 0:01:04 Average standard deviation of split frequencies: 0.039643 30500 -- [-1304.337] (-1303.067) (-1310.497) (-1304.681) * (-1314.761) (-1308.698) (-1308.351) [-1303.547] -- 0:01:03 31000 -- (-1304.221) [-1303.040] (-1308.380) (-1306.665) * [-1306.036] (-1308.576) (-1302.603) (-1307.968) -- 0:01:33 31500 -- (-1304.120) (-1304.526) (-1308.399) [-1303.089] * [-1303.318] (-1307.045) (-1309.544) (-1309.369) -- 0:01:32 32000 -- (-1305.858) [-1304.976] (-1307.277) (-1308.261) * (-1308.438) (-1305.961) [-1306.354] (-1311.524) -- 0:01:30 32500 -- (-1304.506) [-1301.503] (-1304.837) (-1308.750) * (-1300.406) (-1307.112) (-1305.728) [-1302.115] -- 0:01:29 33000 -- (-1303.421) (-1309.050) (-1307.209) [-1307.837] * (-1312.548) (-1305.819) (-1308.848) [-1305.720] -- 0:01:27 33500 -- [-1302.267] (-1306.696) (-1304.936) (-1305.346) * [-1303.416] (-1307.081) (-1299.336) (-1312.211) -- 0:01:26 34000 -- (-1305.710) (-1307.501) [-1309.496] (-1308.092) * (-1305.649) (-1308.864) [-1314.790] (-1305.878) -- 0:01:25 34500 -- (-1305.827) (-1310.925) [-1308.138] (-1308.385) * (-1307.341) (-1307.246) [-1306.395] (-1308.214) -- 0:01:23 35000 -- (-1306.370) [-1302.598] (-1307.656) (-1309.138) * (-1302.233) (-1309.694) [-1306.700] (-1317.669) -- 0:01:22 Average standard deviation of split frequencies: 0.036527 35500 -- [-1302.346] (-1298.375) (-1305.681) (-1307.957) * [-1307.432] (-1307.478) (-1306.897) (-1303.921) -- 0:01:21 36000 -- [-1306.356] (-1304.657) (-1303.727) (-1308.537) * (-1312.797) (-1307.592) [-1305.367] (-1304.440) -- 0:01:20 36500 -- (-1304.636) (-1303.017) (-1302.729) [-1306.041] * [-1301.514] (-1308.875) (-1302.295) (-1310.592) -- 0:01:19 37000 -- (-1303.589) (-1310.871) (-1303.526) [-1303.951] * (-1306.499) (-1310.869) [-1302.539] (-1311.028) -- 0:01:18 37500 -- (-1305.444) [-1305.647] (-1303.879) (-1304.898) * (-1308.264) (-1305.835) [-1303.364] (-1302.179) -- 0:01:17 38000 -- (-1303.121) [-1299.402] (-1308.066) (-1305.106) * (-1306.279) (-1311.333) (-1304.911) [-1303.339] -- 0:01:15 38500 -- (-1305.613) [-1300.715] (-1305.905) (-1306.275) * (-1302.041) (-1307.991) [-1315.704] (-1303.937) -- 0:01:14 39000 -- (-1307.761) (-1309.077) [-1307.329] (-1304.077) * (-1313.046) (-1309.430) [-1309.104] (-1307.477) -- 0:01:13 39500 -- (-1305.096) [-1303.294] (-1307.150) (-1307.879) * (-1309.152) [-1306.220] (-1301.921) (-1305.678) -- 0:01:12 40000 -- (-1305.465) [-1301.753] (-1305.994) (-1308.941) * (-1308.107) (-1305.352) [-1309.284] (-1310.767) -- 0:01:12 Average standard deviation of split frequencies: 0.035458 40500 -- (-1304.764) [-1301.713] (-1304.742) (-1306.933) * [-1302.665] (-1306.166) (-1309.916) (-1304.633) -- 0:01:11 41000 -- (-1307.467) [-1305.374] (-1304.942) (-1307.434) * (-1311.034) [-1304.340] (-1314.825) (-1307.901) -- 0:01:10 41500 -- (-1307.077) (-1311.446) [-1307.435] (-1308.319) * [-1305.185] (-1312.507) (-1303.122) (-1309.210) -- 0:01:32 42000 -- (-1308.926) [-1306.266] (-1305.523) (-1304.775) * [-1306.719] (-1304.932) (-1309.040) (-1307.336) -- 0:01:31 42500 -- (-1307.231) [-1306.422] (-1304.763) (-1308.949) * [-1304.776] (-1308.092) (-1313.811) (-1308.013) -- 0:01:30 43000 -- (-1306.859) (-1307.281) (-1306.518) [-1306.320] * (-1304.115) (-1304.812) [-1312.413] (-1309.025) -- 0:01:29 43500 -- (-1306.902) [-1305.976] (-1308.053) (-1308.616) * [-1307.699] (-1304.886) (-1309.594) (-1305.360) -- 0:01:27 44000 -- (-1308.565) (-1307.891) (-1305.099) [-1305.891] * [-1309.735] (-1302.812) (-1310.466) (-1305.858) -- 0:01:26 44500 -- (-1309.171) [-1301.305] (-1304.082) (-1304.487) * [-1303.610] (-1303.532) (-1310.054) (-1309.088) -- 0:01:25 45000 -- (-1310.530) [-1302.834] (-1308.798) (-1306.230) * (-1309.038) [-1305.757] (-1307.169) (-1311.846) -- 0:01:24 Average standard deviation of split frequencies: 0.036893 45500 -- (-1310.620) [-1300.284] (-1306.410) (-1304.635) * (-1301.500) (-1307.059) [-1305.360] (-1308.850) -- 0:01:23 46000 -- (-1311.813) (-1303.922) [-1306.869] (-1308.954) * (-1307.569) (-1306.856) (-1310.179) [-1305.932] -- 0:01:22 46500 -- (-1306.585) [-1303.850] (-1305.004) (-1312.976) * [-1305.482] (-1310.992) (-1306.825) (-1305.918) -- 0:01:22 47000 -- (-1307.567) (-1310.060) [-1306.305] (-1306.393) * [-1302.465] (-1304.584) (-1304.191) (-1303.536) -- 0:01:21 47500 -- (-1306.025) [-1300.280] (-1312.672) (-1308.762) * (-1312.672) (-1305.666) (-1307.557) [-1305.100] -- 0:01:20 48000 -- (-1306.594) [-1301.193] (-1309.534) (-1309.100) * (-1305.647) (-1308.574) [-1310.467] (-1308.492) -- 0:01:19 48500 -- (-1306.469) [-1303.739] (-1304.542) (-1306.700) * [-1304.140] (-1303.787) (-1317.919) (-1310.885) -- 0:01:18 49000 -- (-1307.726) (-1307.021) (-1306.681) [-1308.794] * [-1301.644] (-1304.042) (-1310.106) (-1304.135) -- 0:01:17 49500 -- (-1310.858) (-1308.002) (-1308.201) [-1307.553] * (-1308.888) (-1306.842) [-1308.472] (-1304.888) -- 0:01:16 50000 -- (-1310.655) [-1306.006] (-1307.145) (-1307.143) * (-1313.456) (-1306.611) [-1311.479] (-1305.719) -- 0:01:16 Average standard deviation of split frequencies: 0.033788 50500 -- (-1309.258) [-1303.558] (-1309.847) (-1304.729) * (-1305.123) (-1306.911) [-1305.781] (-1311.565) -- 0:01:15 51000 -- (-1304.811) [-1304.815] (-1307.954) (-1305.058) * (-1304.533) [-1304.269] (-1307.825) (-1309.557) -- 0:01:14 51500 -- (-1304.858) (-1301.177) [-1306.884] (-1303.503) * [-1307.623] (-1305.563) (-1306.674) (-1306.218) -- 0:01:13 52000 -- (-1308.592) [-1303.901] (-1305.941) (-1307.731) * (-1308.090) (-1308.220) (-1305.770) [-1304.416] -- 0:01:12 52500 -- [-1306.450] (-1301.824) (-1309.184) (-1304.128) * (-1312.808) [-1306.214] (-1304.438) (-1307.672) -- 0:01:12 53000 -- (-1307.108) (-1305.415) [-1309.517] (-1303.127) * (-1309.134) [-1304.191] (-1307.886) (-1306.828) -- 0:01:29 53500 -- (-1308.457) [-1304.942] (-1304.747) (-1307.284) * (-1303.745) [-1304.165] (-1306.976) (-1303.656) -- 0:01:28 54000 -- (-1307.877) (-1303.240) [-1306.085] (-1308.197) * (-1307.645) [-1304.216] (-1302.592) (-1304.885) -- 0:01:27 54500 -- (-1309.494) (-1302.190) [-1302.495] (-1303.419) * (-1312.701) [-1303.860] (-1306.811) (-1310.563) -- 0:01:26 55000 -- (-1313.953) [-1303.690] (-1307.500) (-1304.884) * (-1311.818) (-1304.565) (-1304.645) [-1301.187] -- 0:01:25 Average standard deviation of split frequencies: 0.027912 55500 -- (-1310.217) (-1311.614) [-1308.284] (-1310.187) * [-1304.413] (-1306.639) (-1309.570) (-1305.947) -- 0:01:25 56000 -- [-1308.612] (-1309.324) (-1310.805) (-1303.690) * (-1313.041) [-1306.618] (-1310.349) (-1305.218) -- 0:01:24 56500 -- (-1310.249) [-1304.741] (-1307.292) (-1304.878) * [-1306.763] (-1305.004) (-1305.341) (-1305.271) -- 0:01:23 57000 -- (-1311.229) [-1307.133] (-1308.022) (-1305.484) * [-1305.212] (-1306.557) (-1305.754) (-1308.820) -- 0:01:22 57500 -- (-1314.492) [-1303.490] (-1306.939) (-1308.099) * [-1308.477] (-1304.740) (-1308.980) (-1306.429) -- 0:01:21 58000 -- (-1310.860) [-1301.554] (-1308.007) (-1305.828) * [-1304.273] (-1305.615) (-1304.016) (-1311.368) -- 0:01:21 58500 -- (-1309.574) (-1301.219) [-1304.471] (-1303.722) * (-1309.655) [-1309.139] (-1308.793) (-1307.246) -- 0:01:20 59000 -- (-1310.347) (-1308.496) (-1307.412) [-1305.040] * (-1310.492) (-1306.923) (-1306.890) [-1309.684] -- 0:01:19 59500 -- (-1306.278) [-1310.279] (-1304.439) (-1303.917) * [-1319.987] (-1306.119) (-1309.105) (-1311.651) -- 0:01:19 60000 -- (-1309.220) [-1304.713] (-1302.862) (-1303.869) * (-1303.560) [-1307.468] (-1305.327) (-1312.161) -- 0:01:18 Average standard deviation of split frequencies: 0.026765 60500 -- (-1307.906) (-1306.338) [-1305.263] (-1308.713) * (-1309.699) [-1307.529] (-1307.550) (-1307.533) -- 0:01:17 61000 -- (-1310.557) [-1307.694] (-1304.865) (-1305.345) * [-1303.802] (-1307.875) (-1310.548) (-1307.232) -- 0:01:16 61500 -- (-1310.666) (-1304.736) (-1306.183) [-1307.032] * (-1309.630) (-1306.727) (-1306.514) [-1307.825] -- 0:01:16 62000 -- (-1312.673) [-1304.860] (-1306.609) (-1305.028) * [-1303.202] (-1306.174) (-1305.532) (-1311.447) -- 0:01:15 62500 -- (-1311.951) (-1307.140) (-1306.201) [-1305.815] * [-1302.251] (-1303.921) (-1306.537) (-1305.469) -- 0:01:15 63000 -- (-1314.167) [-1301.877] (-1308.164) (-1305.200) * (-1303.710) [-1308.515] (-1307.169) (-1306.630) -- 0:01:14 63500 -- (-1309.438) (-1303.375) [-1309.502] (-1311.439) * (-1307.775) (-1310.341) (-1307.564) [-1308.104] -- 0:01:13 64000 -- (-1311.617) (-1305.101) [-1305.309] (-1305.859) * (-1307.562) (-1308.458) [-1304.115] (-1303.766) -- 0:01:13 64500 -- (-1310.637) (-1303.187) (-1304.827) [-1310.354] * [-1305.425] (-1304.673) (-1302.802) (-1307.187) -- 0:01:12 65000 -- (-1308.934) (-1303.565) (-1306.009) [-1302.397] * (-1306.536) (-1302.818) [-1304.853] (-1310.512) -- 0:01:26 Average standard deviation of split frequencies: 0.022499 65500 -- (-1308.352) (-1301.198) [-1303.117] (-1306.632) * (-1308.609) (-1304.375) [-1306.474] (-1306.500) -- 0:01:25 66000 -- (-1306.524) (-1308.433) [-1303.852] (-1305.547) * (-1318.078) (-1310.221) [-1306.200] (-1301.815) -- 0:01:24 66500 -- (-1310.905) (-1309.556) (-1305.682) [-1307.014] * [-1309.261] (-1304.397) (-1308.425) (-1303.085) -- 0:01:24 67000 -- (-1308.293) [-1303.975] (-1310.873) (-1306.825) * [-1305.243] (-1308.637) (-1305.858) (-1304.313) -- 0:01:23 67500 -- [-1305.259] (-1305.993) (-1306.750) (-1304.771) * (-1310.967) [-1305.688] (-1305.898) (-1303.476) -- 0:01:22 68000 -- (-1308.939) (-1310.836) (-1305.465) [-1306.310] * (-1316.918) [-1307.622] (-1307.336) (-1304.000) -- 0:01:22 68500 -- [-1307.740] (-1303.530) (-1307.098) (-1304.405) * (-1314.851) (-1307.460) (-1305.540) [-1303.602] -- 0:01:21 69000 -- (-1308.629) [-1308.240] (-1305.612) (-1308.435) * (-1311.659) (-1304.524) [-1303.473] (-1307.190) -- 0:01:20 69500 -- (-1312.214) (-1304.147) (-1310.334) [-1308.423] * (-1310.641) (-1303.383) [-1305.866] (-1302.615) -- 0:01:20 70000 -- (-1315.248) (-1303.832) (-1307.449) [-1304.766] * (-1307.073) (-1307.778) (-1307.585) [-1305.063] -- 0:01:19 Average standard deviation of split frequencies: 0.025506 70500 -- [-1309.032] (-1307.618) (-1305.845) (-1308.609) * (-1308.148) [-1307.138] (-1306.760) (-1303.602) -- 0:01:19 71000 -- (-1314.691) (-1307.028) [-1304.728] (-1307.626) * [-1306.784] (-1305.955) (-1308.923) (-1305.744) -- 0:01:18 71500 -- (-1305.914) [-1304.943] (-1305.799) (-1306.155) * [-1304.901] (-1303.938) (-1307.325) (-1307.016) -- 0:01:17 72000 -- (-1309.453) (-1309.153) (-1311.269) [-1306.172] * (-1307.426) (-1306.915) (-1306.409) [-1304.629] -- 0:01:17 72500 -- (-1307.733) (-1309.202) (-1309.648) [-1308.730] * (-1307.654) (-1306.888) (-1305.880) [-1303.844] -- 0:01:16 73000 -- [-1307.641] (-1304.850) (-1306.211) (-1306.409) * [-1306.706] (-1304.172) (-1304.914) (-1306.029) -- 0:01:16 73500 -- (-1310.265) (-1306.692) (-1308.085) [-1304.309] * (-1307.452) (-1307.320) [-1304.950] (-1306.626) -- 0:01:15 74000 -- (-1308.567) [-1300.722] (-1306.319) (-1307.759) * (-1308.545) [-1313.432] (-1307.708) (-1306.153) -- 0:01:15 74500 -- (-1307.701) [-1301.949] (-1314.857) (-1305.275) * (-1305.978) (-1307.231) (-1304.884) [-1304.805] -- 0:01:14 75000 -- (-1306.992) (-1305.052) [-1305.763] (-1304.474) * (-1307.157) [-1309.326] (-1304.844) (-1306.131) -- 0:01:14 Average standard deviation of split frequencies: 0.025464 75500 -- [-1307.040] (-1306.429) (-1307.087) (-1307.331) * (-1309.911) [-1304.312] (-1306.175) (-1302.514) -- 0:01:13 76000 -- (-1306.476) (-1305.166) [-1305.365] (-1309.198) * (-1306.221) (-1304.230) (-1307.056) [-1303.536] -- 0:01:12 76500 -- [-1308.340] (-1305.178) (-1308.029) (-1309.803) * (-1307.209) (-1306.354) [-1307.885] (-1304.567) -- 0:01:24 77000 -- (-1308.716) (-1305.964) (-1305.899) [-1305.706] * (-1306.185) [-1307.496] (-1307.108) (-1308.171) -- 0:01:23 77500 -- (-1303.613) [-1305.936] (-1306.565) (-1309.454) * (-1307.960) [-1304.986] (-1306.371) (-1309.832) -- 0:01:23 78000 -- (-1302.844) (-1311.219) (-1304.764) [-1309.625] * (-1302.944) [-1308.824] (-1305.336) (-1311.416) -- 0:01:22 78500 -- (-1304.154) (-1307.092) (-1305.298) [-1304.320] * (-1309.024) (-1306.057) [-1307.511] (-1306.445) -- 0:01:22 79000 -- (-1309.252) (-1310.922) [-1306.198] (-1307.128) * (-1309.970) (-1308.397) [-1308.395] (-1302.830) -- 0:01:21 79500 -- (-1304.244) [-1307.468] (-1302.716) (-1305.090) * (-1307.056) (-1305.516) [-1305.774] (-1307.765) -- 0:01:21 80000 -- [-1307.205] (-1310.915) (-1305.683) (-1311.689) * (-1309.767) (-1311.111) (-1303.825) [-1303.298] -- 0:01:20 Average standard deviation of split frequencies: 0.024063 80500 -- (-1305.134) [-1305.117] (-1302.882) (-1307.337) * (-1306.339) (-1304.659) (-1309.453) [-1303.761] -- 0:01:19 81000 -- (-1305.858) [-1310.639] (-1307.930) (-1308.614) * (-1306.979) (-1305.980) (-1307.128) [-1307.873] -- 0:01:19 81500 -- (-1308.524) [-1303.922] (-1306.215) (-1303.988) * (-1309.310) (-1307.469) (-1307.289) [-1304.593] -- 0:01:18 82000 -- [-1309.215] (-1308.368) (-1306.321) (-1306.236) * (-1308.872) (-1306.304) [-1310.178] (-1307.371) -- 0:01:18 82500 -- [-1314.340] (-1306.117) (-1305.383) (-1311.992) * (-1305.353) [-1307.906] (-1303.378) (-1305.556) -- 0:01:17 83000 -- (-1315.308) (-1304.389) (-1306.876) [-1305.301] * (-1308.032) [-1304.205] (-1305.820) (-1306.472) -- 0:01:17 83500 -- (-1314.672) (-1305.882) [-1303.607] (-1306.541) * (-1312.498) (-1306.399) (-1308.748) [-1307.724] -- 0:01:16 84000 -- (-1309.022) [-1307.500] (-1310.342) (-1308.674) * [-1303.960] (-1307.713) (-1307.584) (-1307.402) -- 0:01:16 84500 -- (-1305.864) [-1308.389] (-1310.639) (-1304.995) * [-1313.095] (-1305.515) (-1306.578) (-1312.510) -- 0:01:15 85000 -- [-1307.281] (-1303.948) (-1308.733) (-1308.948) * (-1312.603) (-1302.798) [-1305.481] (-1302.026) -- 0:01:15 Average standard deviation of split frequencies: 0.022200 85500 -- (-1305.684) [-1304.289] (-1309.109) (-1309.719) * (-1308.525) [-1306.172] (-1306.366) (-1302.422) -- 0:01:14 86000 -- [-1307.039] (-1304.346) (-1304.136) (-1308.765) * (-1307.561) [-1304.869] (-1307.226) (-1304.149) -- 0:01:14 86500 -- (-1304.459) [-1305.448] (-1305.962) (-1306.760) * (-1311.396) (-1308.629) (-1303.454) [-1303.591] -- 0:01:13 87000 -- (-1306.833) (-1302.825) [-1307.253] (-1307.764) * (-1308.308) [-1305.418] (-1307.855) (-1308.715) -- 0:01:13 87500 -- (-1303.898) (-1305.216) (-1306.150) [-1308.382] * [-1307.258] (-1307.425) (-1313.517) (-1307.973) -- 0:01:13 88000 -- (-1305.525) [-1303.768] (-1305.743) (-1307.909) * [-1308.081] (-1308.205) (-1311.925) (-1307.467) -- 0:01:12 88500 -- [-1307.758] (-1310.241) (-1307.281) (-1310.929) * (-1309.598) [-1308.516] (-1303.830) (-1307.014) -- 0:01:22 89000 -- (-1303.521) [-1303.004] (-1305.078) (-1310.242) * (-1309.415) (-1307.782) [-1304.727] (-1309.663) -- 0:01:21 89500 -- (-1304.496) (-1306.221) [-1307.097] (-1309.714) * (-1310.623) (-1303.873) (-1309.246) [-1305.850] -- 0:01:21 90000 -- [-1307.643] (-1304.930) (-1306.195) (-1309.636) * (-1311.344) [-1306.462] (-1304.431) (-1303.449) -- 0:01:20 Average standard deviation of split frequencies: 0.026776 90500 -- (-1307.861) (-1306.591) (-1305.492) [-1308.291] * (-1317.603) (-1304.097) (-1310.270) [-1303.119] -- 0:01:20 91000 -- (-1305.608) [-1305.962] (-1305.302) (-1307.087) * (-1305.102) [-1301.995] (-1311.118) (-1304.590) -- 0:01:19 91500 -- [-1305.602] (-1304.224) (-1302.948) (-1313.649) * (-1305.973) (-1306.415) (-1304.785) [-1307.301] -- 0:01:19 92000 -- (-1303.585) [-1306.130] (-1308.429) (-1310.818) * (-1304.764) (-1305.579) (-1304.660) [-1306.677] -- 0:01:18 92500 -- [-1308.817] (-1307.931) (-1306.447) (-1311.931) * (-1305.343) (-1304.967) [-1308.023] (-1301.915) -- 0:01:18 93000 -- (-1303.815) (-1304.023) [-1303.837] (-1315.175) * (-1304.004) [-1304.166] (-1303.375) (-1306.172) -- 0:01:18 93500 -- (-1305.087) [-1307.950] (-1307.778) (-1310.555) * (-1306.132) [-1305.340] (-1304.460) (-1310.168) -- 0:01:17 94000 -- (-1311.682) [-1305.318] (-1307.586) (-1311.333) * (-1310.452) (-1303.833) [-1310.083] (-1308.550) -- 0:01:17 94500 -- (-1306.708) [-1306.258] (-1309.660) (-1311.369) * (-1305.477) (-1306.397) [-1305.602] (-1307.290) -- 0:01:16 95000 -- (-1303.507) [-1306.773] (-1309.172) (-1311.637) * [-1311.448] (-1304.257) (-1307.090) (-1305.560) -- 0:01:16 Average standard deviation of split frequencies: 0.026517 95500 -- [-1304.820] (-1306.535) (-1306.568) (-1304.569) * (-1305.977) [-1309.525] (-1304.966) (-1305.783) -- 0:01:15 96000 -- (-1305.167) (-1309.048) [-1302.928] (-1304.814) * (-1310.807) [-1305.080] (-1305.147) (-1306.897) -- 0:01:15 96500 -- [-1308.093] (-1307.409) (-1303.051) (-1306.805) * (-1307.125) [-1305.735] (-1304.228) (-1310.224) -- 0:01:14 97000 -- (-1307.376) (-1309.604) [-1305.897] (-1310.846) * [-1307.184] (-1307.183) (-1303.072) (-1304.961) -- 0:01:14 97500 -- (-1306.296) (-1307.062) [-1305.046] (-1305.478) * (-1305.937) (-1305.776) (-1305.708) [-1307.789] -- 0:01:14 98000 -- (-1307.632) (-1307.006) [-1304.874] (-1304.801) * (-1304.222) (-1307.816) (-1306.265) [-1302.373] -- 0:01:13 98500 -- (-1308.131) [-1306.640] (-1302.597) (-1306.793) * (-1307.471) (-1311.773) (-1305.285) [-1305.332] -- 0:01:13 99000 -- (-1308.447) (-1307.071) (-1305.722) [-1306.896] * [-1304.898] (-1310.253) (-1311.915) (-1308.531) -- 0:01:12 99500 -- (-1311.709) (-1303.747) (-1307.027) [-1305.060] * (-1305.961) [-1303.297] (-1308.146) (-1306.785) -- 0:01:12 100000 -- (-1305.923) [-1301.827] (-1304.415) (-1306.109) * (-1308.027) (-1303.617) (-1303.776) [-1306.024] -- 0:01:12 Average standard deviation of split frequencies: 0.029822 100500 -- (-1306.069) (-1304.508) (-1303.336) [-1308.254] * (-1304.783) (-1306.597) [-1304.104] (-1305.899) -- 0:01:11 101000 -- (-1305.968) (-1304.529) (-1309.971) [-1311.324] * (-1308.082) (-1307.282) (-1303.033) [-1308.430] -- 0:01:11 101500 -- (-1302.814) (-1307.738) (-1305.282) [-1311.614] * (-1311.467) [-1311.580] (-1310.101) (-1307.860) -- 0:01:10 102000 -- (-1304.649) (-1304.819) [-1306.478] (-1312.261) * (-1305.996) [-1311.795] (-1307.870) (-1311.464) -- 0:01:10 102500 -- (-1303.410) (-1304.649) [-1306.660] (-1308.108) * (-1315.261) (-1310.302) [-1306.583] (-1311.642) -- 0:01:10 103000 -- (-1305.779) (-1306.372) (-1305.998) [-1310.223] * [-1309.231] (-1305.538) (-1306.102) (-1308.077) -- 0:01:18 103500 -- [-1306.620] (-1303.644) (-1305.284) (-1313.338) * [-1308.026] (-1307.300) (-1315.450) (-1312.499) -- 0:01:17 104000 -- (-1303.466) (-1308.889) [-1307.188] (-1303.050) * (-1305.780) (-1305.030) [-1308.348] (-1310.372) -- 0:01:17 104500 -- (-1303.511) (-1302.569) (-1305.628) [-1305.789] * (-1308.056) [-1304.021] (-1307.856) (-1307.163) -- 0:01:17 105000 -- [-1305.335] (-1305.053) (-1304.228) (-1310.313) * (-1305.031) [-1304.038] (-1309.689) (-1305.095) -- 0:01:16 Average standard deviation of split frequencies: 0.031130 105500 -- (-1306.911) (-1304.174) [-1304.236] (-1306.393) * (-1306.165) (-1305.895) [-1306.005] (-1310.626) -- 0:01:16 106000 -- (-1312.508) [-1307.040] (-1302.358) (-1311.093) * [-1306.108] (-1305.329) (-1308.133) (-1309.966) -- 0:01:15 106500 -- (-1307.991) (-1306.914) (-1306.169) [-1310.162] * (-1306.923) (-1303.943) [-1305.351] (-1310.550) -- 0:01:15 107000 -- (-1307.936) (-1305.633) [-1309.686] (-1309.550) * (-1306.864) (-1304.440) (-1301.605) [-1309.023] -- 0:01:15 107500 -- (-1311.637) [-1303.067] (-1307.999) (-1310.294) * (-1308.145) (-1305.422) [-1304.561] (-1309.547) -- 0:01:14 108000 -- (-1308.182) [-1300.495] (-1309.119) (-1310.662) * (-1309.082) [-1306.125] (-1302.308) (-1308.344) -- 0:01:14 108500 -- [-1304.234] (-1306.949) (-1308.100) (-1306.283) * (-1307.854) (-1305.536) (-1302.515) [-1310.828] -- 0:01:13 109000 -- (-1305.818) (-1308.842) (-1307.861) [-1303.326] * (-1302.913) (-1308.302) (-1302.712) [-1310.760] -- 0:01:13 109500 -- [-1304.045] (-1308.304) (-1307.469) (-1305.329) * (-1308.526) (-1309.194) [-1303.346] (-1310.112) -- 0:01:13 110000 -- (-1306.993) (-1305.758) (-1309.421) [-1306.398] * (-1308.672) (-1312.372) [-1307.147] (-1309.652) -- 0:01:12 Average standard deviation of split frequencies: 0.032161 110500 -- (-1307.491) [-1304.157] (-1310.181) (-1306.294) * (-1307.679) [-1312.073] (-1308.565) (-1308.185) -- 0:01:12 111000 -- (-1310.343) [-1304.861] (-1312.255) (-1306.403) * [-1307.959] (-1309.822) (-1303.889) (-1311.428) -- 0:01:12 111500 -- (-1303.446) (-1305.095) [-1309.112] (-1308.421) * [-1304.923] (-1311.218) (-1305.955) (-1309.714) -- 0:01:11 112000 -- (-1304.365) (-1304.812) (-1306.936) [-1305.970] * (-1304.185) (-1311.090) [-1302.836] (-1307.078) -- 0:01:11 112500 -- (-1307.143) (-1305.219) (-1304.655) [-1306.905] * [-1309.890] (-1306.938) (-1307.363) (-1308.717) -- 0:01:11 113000 -- (-1306.524) [-1304.142] (-1304.911) (-1305.152) * (-1303.773) (-1304.667) [-1305.518] (-1307.147) -- 0:01:10 113500 -- (-1308.431) [-1303.442] (-1303.368) (-1306.710) * (-1309.789) (-1305.161) (-1305.837) [-1308.849] -- 0:01:10 114000 -- (-1307.978) (-1307.038) (-1304.643) [-1306.749] * (-1307.110) [-1305.843] (-1304.158) (-1308.737) -- 0:01:09 114500 -- [-1304.813] (-1309.643) (-1305.795) (-1306.079) * (-1306.720) (-1308.684) (-1301.559) [-1307.974] -- 0:01:09 115000 -- (-1306.084) [-1304.057] (-1306.553) (-1309.016) * (-1305.212) (-1309.756) [-1305.798] (-1307.837) -- 0:01:09 Average standard deviation of split frequencies: 0.032714 115500 -- (-1307.315) (-1312.150) (-1306.712) [-1307.763] * (-1309.357) (-1307.594) [-1304.422] (-1312.637) -- 0:01:08 116000 -- (-1307.654) (-1306.488) (-1302.224) [-1305.697] * (-1305.961) [-1306.744] (-1304.346) (-1306.865) -- 0:01:08 116500 -- (-1307.029) (-1311.187) [-1305.887] (-1305.272) * (-1304.421) (-1303.856) (-1307.731) [-1306.986] -- 0:01:08 117000 -- (-1307.977) [-1308.243] (-1302.772) (-1305.184) * (-1304.932) [-1304.604] (-1307.370) (-1306.101) -- 0:01:15 117500 -- (-1311.359) [-1307.487] (-1307.585) (-1307.581) * [-1305.843] (-1304.945) (-1304.637) (-1307.453) -- 0:01:15 118000 -- (-1307.440) [-1307.816] (-1306.597) (-1306.834) * (-1305.686) (-1306.207) (-1308.450) [-1305.826] -- 0:01:14 118500 -- (-1310.153) [-1305.253] (-1303.975) (-1306.578) * [-1305.841] (-1305.373) (-1307.389) (-1303.789) -- 0:01:14 119000 -- (-1309.517) [-1308.050] (-1306.292) (-1305.656) * (-1306.817) (-1305.661) [-1307.385] (-1302.520) -- 0:01:14 119500 -- [-1307.610] (-1307.620) (-1304.916) (-1304.655) * (-1304.823) [-1304.178] (-1306.540) (-1303.561) -- 0:01:13 120000 -- (-1312.391) (-1308.474) (-1305.382) [-1304.317] * [-1307.113] (-1306.169) (-1307.804) (-1309.187) -- 0:01:13 Average standard deviation of split frequencies: 0.034943 120500 -- (-1311.088) (-1304.595) [-1305.619] (-1301.754) * (-1308.823) (-1308.434) [-1301.456] (-1304.787) -- 0:01:12 121000 -- (-1313.395) (-1305.757) [-1303.199] (-1310.066) * (-1309.180) [-1303.631] (-1304.493) (-1311.364) -- 0:01:12 121500 -- (-1306.502) (-1303.648) (-1302.837) [-1307.272] * (-1306.785) (-1310.457) [-1304.598] (-1309.360) -- 0:01:12 122000 -- (-1305.282) [-1305.359] (-1302.205) (-1307.975) * (-1306.411) (-1307.936) [-1304.605] (-1306.830) -- 0:01:11 122500 -- (-1308.179) (-1305.470) [-1302.984] (-1307.784) * (-1305.689) (-1307.400) [-1305.156] (-1306.704) -- 0:01:11 123000 -- (-1310.249) (-1306.770) [-1309.104] (-1309.144) * (-1306.099) [-1309.628] (-1307.847) (-1305.911) -- 0:01:11 123500 -- (-1306.000) [-1304.783] (-1308.489) (-1303.467) * [-1302.640] (-1308.875) (-1308.762) (-1306.219) -- 0:01:10 124000 -- [-1306.744] (-1304.977) (-1311.727) (-1305.170) * [-1306.323] (-1307.636) (-1305.838) (-1303.963) -- 0:01:10 124500 -- [-1306.110] (-1304.747) (-1304.415) (-1308.581) * (-1303.953) (-1314.844) (-1306.052) [-1305.566] -- 0:01:10 125000 -- (-1308.414) (-1306.008) (-1304.766) [-1305.235] * (-1302.077) (-1304.160) (-1303.270) [-1309.877] -- 0:01:10 Average standard deviation of split frequencies: 0.034711 125500 -- (-1307.567) (-1307.349) (-1303.614) [-1307.766] * [-1305.264] (-1304.377) (-1304.663) (-1304.573) -- 0:01:09 126000 -- (-1304.124) [-1305.123] (-1310.515) (-1307.587) * [-1305.148] (-1306.504) (-1304.005) (-1311.964) -- 0:01:09 126500 -- (-1306.417) (-1310.942) (-1306.295) [-1307.232] * [-1307.900] (-1303.097) (-1306.258) (-1309.197) -- 0:01:09 127000 -- (-1310.484) (-1307.735) (-1307.986) [-1306.776] * (-1313.864) (-1303.060) (-1305.866) [-1307.335] -- 0:01:08 127500 -- [-1307.388] (-1305.525) (-1310.951) (-1309.990) * (-1302.024) (-1303.515) [-1305.018] (-1311.735) -- 0:01:08 128000 -- (-1309.539) (-1310.369) [-1303.265] (-1303.958) * [-1304.177] (-1306.132) (-1304.447) (-1309.053) -- 0:01:08 128500 -- (-1307.580) (-1306.913) [-1302.277] (-1303.964) * (-1303.304) [-1303.597] (-1302.999) (-1308.257) -- 0:01:07 129000 -- (-1309.235) (-1305.558) (-1306.620) [-1304.207] * (-1308.266) (-1302.700) (-1304.330) [-1309.059] -- 0:01:07 129500 -- (-1309.171) (-1305.064) (-1309.334) [-1306.665] * [-1309.817] (-1305.314) (-1306.830) (-1308.996) -- 0:01:07 130000 -- (-1310.175) (-1307.217) [-1304.707] (-1310.502) * (-1307.101) [-1301.639] (-1307.252) (-1310.993) -- 0:01:06 Average standard deviation of split frequencies: 0.031868 130500 -- [-1303.696] (-1310.389) (-1305.959) (-1306.310) * (-1311.682) [-1302.292] (-1306.031) (-1308.404) -- 0:01:06 131000 -- (-1304.809) (-1308.401) [-1304.765] (-1310.566) * (-1306.569) [-1304.467] (-1305.240) (-1308.464) -- 0:01:12 131500 -- (-1307.142) (-1306.592) (-1311.219) [-1307.706] * (-1303.590) (-1304.715) [-1301.846] (-1311.841) -- 0:01:12 132000 -- [-1309.652] (-1305.531) (-1309.864) (-1308.527) * (-1310.426) [-1307.550] (-1305.422) (-1306.950) -- 0:01:12 132500 -- (-1310.698) (-1306.253) [-1306.994] (-1310.612) * (-1302.728) [-1304.398] (-1303.881) (-1306.859) -- 0:01:12 133000 -- (-1313.053) (-1306.633) [-1305.953] (-1311.056) * (-1305.871) (-1307.708) (-1302.510) [-1307.808] -- 0:01:11 133500 -- (-1310.139) [-1304.737] (-1308.834) (-1308.577) * [-1303.111] (-1304.427) (-1304.385) (-1304.858) -- 0:01:11 134000 -- [-1310.987] (-1305.243) (-1306.646) (-1310.759) * (-1303.611) (-1302.175) [-1303.760] (-1309.496) -- 0:01:11 134500 -- [-1306.626] (-1309.114) (-1307.568) (-1313.459) * (-1307.363) (-1303.313) [-1304.674] (-1303.524) -- 0:01:10 135000 -- (-1304.563) (-1305.467) [-1307.343] (-1311.246) * (-1305.702) [-1301.404] (-1306.860) (-1305.245) -- 0:01:10 Average standard deviation of split frequencies: 0.031774 135500 -- (-1304.981) (-1307.911) [-1306.455] (-1308.640) * (-1308.395) (-1308.507) (-1308.623) [-1304.652] -- 0:01:10 136000 -- (-1303.558) (-1303.199) (-1305.352) [-1307.182] * (-1307.124) [-1304.478] (-1303.523) (-1306.188) -- 0:01:09 136500 -- (-1305.884) (-1302.595) [-1306.820] (-1307.386) * (-1308.548) [-1305.270] (-1305.339) (-1310.366) -- 0:01:09 137000 -- (-1303.098) [-1305.873] (-1307.260) (-1307.021) * (-1311.811) [-1308.189] (-1305.237) (-1306.525) -- 0:01:09 137500 -- [-1302.807] (-1304.933) (-1308.352) (-1307.850) * (-1307.370) (-1311.167) [-1304.196] (-1307.948) -- 0:01:09 138000 -- [-1307.660] (-1305.035) (-1309.531) (-1306.297) * (-1307.150) (-1309.271) (-1308.841) [-1304.854] -- 0:01:08 138500 -- (-1307.710) [-1305.254] (-1306.276) (-1304.542) * (-1305.721) (-1308.933) (-1309.367) [-1306.355] -- 0:01:08 139000 -- [-1309.033] (-1304.909) (-1306.665) (-1307.957) * [-1306.317] (-1308.516) (-1308.926) (-1309.568) -- 0:01:08 139500 -- (-1312.337) (-1303.558) [-1304.708] (-1306.569) * (-1309.430) (-1310.692) [-1307.285] (-1307.677) -- 0:01:07 140000 -- (-1306.474) (-1304.522) [-1305.553] (-1307.907) * (-1308.423) (-1309.650) (-1310.473) [-1306.611] -- 0:01:07 Average standard deviation of split frequencies: 0.032023 140500 -- (-1304.162) (-1307.405) [-1308.518] (-1306.981) * [-1307.059] (-1309.540) (-1309.923) (-1304.710) -- 0:01:07 141000 -- (-1307.030) [-1307.595] (-1305.615) (-1304.892) * [-1303.734] (-1310.510) (-1305.697) (-1309.216) -- 0:01:07 141500 -- (-1310.470) (-1305.335) (-1307.392) [-1311.424] * (-1306.916) [-1306.764] (-1307.556) (-1307.162) -- 0:01:06 142000 -- [-1312.916] (-1305.010) (-1303.545) (-1308.825) * [-1306.849] (-1305.820) (-1304.167) (-1307.850) -- 0:01:06 142500 -- (-1306.803) (-1302.630) [-1302.366] (-1308.017) * (-1305.400) (-1308.072) [-1305.380] (-1306.049) -- 0:01:06 143000 -- (-1306.497) (-1305.041) (-1305.772) [-1307.465] * (-1302.121) (-1308.057) (-1306.699) [-1308.609] -- 0:01:05 143500 -- (-1307.530) (-1306.600) (-1305.368) [-1304.755] * [-1306.402] (-1306.232) (-1304.137) (-1307.297) -- 0:01:05 144000 -- [-1308.364] (-1302.926) (-1310.692) (-1304.168) * (-1302.184) (-1307.174) (-1305.594) [-1309.081] -- 0:01:05 144500 -- (-1308.992) (-1305.572) (-1305.955) [-1304.994] * [-1303.878] (-1308.545) (-1303.785) (-1308.063) -- 0:01:05 145000 -- (-1307.628) [-1306.571] (-1304.419) (-1307.935) * [-1303.809] (-1308.656) (-1303.936) (-1306.504) -- 0:01:04 Average standard deviation of split frequencies: 0.031212 145500 -- (-1307.238) (-1303.137) (-1305.856) [-1305.049] * (-1305.124) (-1312.323) [-1310.441] (-1309.539) -- 0:01:10 146000 -- (-1308.438) (-1307.659) (-1307.063) [-1306.015] * [-1303.671] (-1305.931) (-1303.387) (-1310.130) -- 0:01:10 146500 -- (-1311.811) (-1306.248) (-1308.705) [-1304.551] * (-1307.576) [-1305.639] (-1305.457) (-1309.054) -- 0:01:09 147000 -- (-1312.540) (-1315.317) (-1307.402) [-1306.570] * (-1307.142) (-1306.560) [-1307.433] (-1309.310) -- 0:01:09 147500 -- (-1312.256) [-1307.544] (-1307.181) (-1310.978) * (-1307.807) (-1309.428) [-1306.218] (-1306.364) -- 0:01:09 148000 -- (-1311.045) [-1304.500] (-1306.490) (-1306.811) * [-1306.562] (-1308.110) (-1304.461) (-1302.658) -- 0:01:09 148500 -- (-1311.102) (-1307.844) [-1305.752] (-1304.459) * (-1308.618) [-1305.484] (-1307.348) (-1305.263) -- 0:01:08 149000 -- (-1308.464) (-1307.164) (-1306.211) [-1303.453] * (-1310.629) (-1305.207) (-1308.655) [-1305.432] -- 0:01:08 149500 -- (-1309.716) (-1307.410) [-1305.665] (-1306.523) * (-1310.453) (-1304.559) (-1308.866) [-1302.250] -- 0:01:08 150000 -- (-1314.569) (-1307.380) (-1304.736) [-1307.126] * (-1306.008) (-1308.700) (-1309.302) [-1304.250] -- 0:01:08 Average standard deviation of split frequencies: 0.030000 150500 -- (-1308.850) [-1306.157] (-1303.994) (-1308.467) * (-1309.294) [-1305.117] (-1307.883) (-1304.931) -- 0:01:07 151000 -- (-1304.443) (-1306.942) (-1304.983) [-1307.156] * [-1307.467] (-1305.539) (-1307.205) (-1306.537) -- 0:01:07 151500 -- (-1306.435) [-1306.304] (-1308.065) (-1305.217) * (-1308.922) [-1304.235] (-1308.163) (-1304.079) -- 0:01:07 152000 -- [-1306.061] (-1308.551) (-1306.007) (-1312.062) * (-1308.609) (-1303.440) [-1303.683] (-1305.979) -- 0:01:06 152500 -- [-1303.820] (-1303.857) (-1306.626) (-1306.567) * (-1305.081) [-1307.861] (-1302.992) (-1309.072) -- 0:01:06 153000 -- [-1301.883] (-1305.036) (-1308.893) (-1308.439) * [-1306.273] (-1308.332) (-1311.262) (-1306.745) -- 0:01:06 153500 -- (-1303.833) (-1308.573) [-1307.077] (-1307.502) * (-1308.915) [-1310.912] (-1304.343) (-1305.188) -- 0:01:06 154000 -- [-1305.725] (-1308.703) (-1305.497) (-1309.386) * (-1312.025) [-1306.173] (-1304.109) (-1308.184) -- 0:01:05 154500 -- [-1304.439] (-1311.549) (-1310.327) (-1307.203) * (-1310.982) (-1305.487) (-1307.673) [-1306.317] -- 0:01:05 155000 -- [-1306.749] (-1311.254) (-1304.822) (-1306.413) * (-1310.102) (-1305.590) [-1303.533] (-1301.777) -- 0:01:05 Average standard deviation of split frequencies: 0.030218 155500 -- (-1307.729) (-1305.835) (-1307.235) [-1308.872] * (-1309.147) (-1305.498) [-1307.004] (-1305.514) -- 0:01:05 156000 -- [-1306.846] (-1304.809) (-1307.551) (-1308.228) * (-1311.062) (-1305.378) (-1308.102) [-1307.372] -- 0:01:04 156500 -- (-1305.324) (-1306.115) [-1304.877] (-1309.876) * (-1311.721) (-1307.813) [-1308.523] (-1307.856) -- 0:01:04 157000 -- (-1306.215) (-1309.128) (-1308.527) [-1310.794] * (-1303.616) [-1303.319] (-1305.083) (-1307.279) -- 0:01:04 157500 -- [-1309.623] (-1308.586) (-1308.114) (-1310.875) * (-1304.443) (-1310.675) (-1303.723) [-1307.514] -- 0:01:04 158000 -- (-1309.904) (-1306.164) [-1309.725] (-1306.867) * (-1303.338) (-1306.992) (-1307.770) [-1304.936] -- 0:01:03 158500 -- (-1306.503) (-1306.853) [-1308.861] (-1307.706) * (-1306.885) (-1304.366) (-1308.227) [-1306.202] -- 0:01:03 159000 -- [-1307.308] (-1303.002) (-1306.344) (-1309.024) * (-1314.861) (-1306.672) (-1309.924) [-1303.747] -- 0:01:03 159500 -- (-1307.582) (-1303.940) [-1305.656] (-1311.904) * (-1309.044) [-1306.842] (-1309.210) (-1307.529) -- 0:01:08 160000 -- (-1306.760) [-1306.372] (-1305.797) (-1309.094) * (-1308.765) [-1311.013] (-1311.284) (-1306.277) -- 0:01:08 Average standard deviation of split frequencies: 0.030203 160500 -- [-1304.151] (-1305.466) (-1306.043) (-1313.978) * (-1309.513) (-1308.161) (-1310.346) [-1305.832] -- 0:01:07 161000 -- (-1305.073) (-1305.354) (-1308.233) [-1309.322] * (-1304.397) [-1305.885] (-1310.453) (-1306.994) -- 0:01:07 161500 -- (-1305.136) (-1304.344) [-1305.029] (-1311.774) * (-1311.181) (-1305.987) (-1310.031) [-1304.710] -- 0:01:07 162000 -- (-1303.809) [-1305.367] (-1309.401) (-1312.920) * [-1303.250] (-1307.440) (-1312.047) (-1308.231) -- 0:01:07 162500 -- [-1306.082] (-1305.354) (-1309.174) (-1309.682) * [-1309.096] (-1305.496) (-1306.607) (-1305.867) -- 0:01:07 163000 -- (-1301.903) (-1306.592) (-1310.255) [-1308.850] * (-1311.065) (-1307.219) [-1306.552] (-1308.503) -- 0:01:06 163500 -- [-1302.873] (-1303.370) (-1312.013) (-1311.673) * (-1308.745) [-1308.429] (-1306.975) (-1304.458) -- 0:01:06 164000 -- (-1308.280) (-1302.897) (-1311.249) [-1307.416] * (-1306.230) (-1306.618) [-1310.360] (-1304.349) -- 0:01:06 164500 -- (-1307.084) (-1309.137) (-1309.847) [-1311.398] * (-1304.212) (-1310.804) (-1305.354) [-1305.838] -- 0:01:06 165000 -- (-1309.770) (-1311.335) (-1309.317) [-1309.254] * (-1306.223) [-1309.148] (-1307.411) (-1310.719) -- 0:01:05 Average standard deviation of split frequencies: 0.031071 165500 -- (-1307.401) (-1303.034) (-1308.435) [-1305.895] * (-1303.290) [-1311.673] (-1311.089) (-1303.883) -- 0:01:05 166000 -- [-1306.180] (-1306.446) (-1307.879) (-1304.601) * (-1306.624) (-1309.379) (-1308.434) [-1306.328] -- 0:01:05 166500 -- (-1303.782) (-1303.894) (-1307.038) [-1307.653] * (-1306.123) [-1310.206] (-1309.288) (-1307.677) -- 0:01:05 167000 -- [-1307.238] (-1307.069) (-1306.864) (-1310.138) * [-1303.869] (-1306.859) (-1310.882) (-1305.687) -- 0:01:04 167500 -- (-1309.002) (-1302.560) [-1308.089] (-1306.687) * (-1304.594) [-1306.588] (-1309.750) (-1308.488) -- 0:01:04 168000 -- [-1307.094] (-1303.797) (-1304.344) (-1308.031) * (-1308.406) (-1306.038) (-1311.542) [-1309.505] -- 0:01:04 168500 -- [-1307.048] (-1303.398) (-1304.315) (-1307.909) * (-1302.849) [-1308.685] (-1308.785) (-1306.771) -- 0:01:04 169000 -- (-1304.003) (-1303.912) [-1305.158] (-1307.290) * (-1304.066) [-1305.023] (-1307.716) (-1307.940) -- 0:01:03 169500 -- (-1308.183) (-1304.658) (-1306.647) [-1306.241] * [-1305.683] (-1304.618) (-1306.703) (-1310.656) -- 0:01:03 170000 -- [-1303.980] (-1305.327) (-1310.693) (-1306.494) * (-1306.484) [-1306.763] (-1306.977) (-1306.490) -- 0:01:03 Average standard deviation of split frequencies: 0.027784 170500 -- (-1307.707) (-1307.537) [-1306.425] (-1308.395) * (-1306.312) (-1311.818) (-1307.691) [-1307.242] -- 0:01:03 171000 -- (-1305.953) (-1308.013) [-1304.930] (-1306.221) * (-1304.663) (-1311.122) (-1306.725) [-1305.929] -- 0:01:03 171500 -- [-1306.805] (-1305.692) (-1310.958) (-1304.275) * (-1310.420) [-1308.782] (-1307.383) (-1310.260) -- 0:01:02 172000 -- [-1306.188] (-1303.174) (-1304.326) (-1309.843) * [-1308.011] (-1306.306) (-1309.042) (-1306.565) -- 0:01:02 172500 -- [-1305.316] (-1304.386) (-1303.372) (-1307.016) * [-1305.187] (-1312.205) (-1311.749) (-1303.189) -- 0:01:02 173000 -- (-1308.439) (-1304.823) [-1304.407] (-1308.001) * [-1305.593] (-1308.511) (-1305.026) (-1307.054) -- 0:01:02 173500 -- (-1302.440) (-1303.585) [-1303.167] (-1307.133) * (-1301.943) (-1309.606) (-1303.282) [-1308.850] -- 0:01:06 174000 -- (-1304.133) (-1303.986) [-1304.931] (-1306.616) * (-1305.940) [-1306.975] (-1304.587) (-1312.644) -- 0:01:06 174500 -- [-1306.276] (-1304.195) (-1303.046) (-1311.123) * [-1306.139] (-1310.675) (-1306.970) (-1311.089) -- 0:01:06 175000 -- (-1305.687) (-1304.490) [-1305.059] (-1310.850) * [-1304.656] (-1309.112) (-1304.732) (-1307.040) -- 0:01:06 Average standard deviation of split frequencies: 0.026784 175500 -- (-1306.676) (-1305.337) [-1306.044] (-1310.530) * [-1307.560] (-1302.528) (-1305.468) (-1306.991) -- 0:01:05 176000 -- [-1304.152] (-1306.657) (-1306.099) (-1310.146) * [-1306.112] (-1308.064) (-1306.918) (-1307.704) -- 0:01:05 176500 -- (-1302.574) [-1306.582] (-1304.479) (-1306.035) * (-1306.439) [-1306.348] (-1309.639) (-1308.158) -- 0:01:05 177000 -- (-1306.988) (-1303.799) (-1306.934) [-1313.434] * (-1309.540) (-1305.778) (-1310.247) [-1310.648] -- 0:01:05 177500 -- (-1304.909) (-1305.346) (-1304.850) [-1305.684] * (-1307.372) [-1306.686] (-1306.750) (-1309.419) -- 0:01:04 178000 -- (-1308.108) (-1305.219) (-1303.958) [-1308.313] * (-1306.138) [-1308.344] (-1307.134) (-1306.488) -- 0:01:04 178500 -- (-1307.831) (-1306.667) [-1304.584] (-1306.362) * (-1305.537) [-1307.960] (-1307.338) (-1308.792) -- 0:01:04 179000 -- [-1302.969] (-1308.218) (-1307.283) (-1309.385) * [-1306.753] (-1308.300) (-1305.555) (-1308.446) -- 0:01:04 179500 -- [-1303.507] (-1308.637) (-1309.520) (-1306.810) * (-1304.502) (-1306.124) (-1308.393) [-1307.088] -- 0:01:03 180000 -- (-1309.410) (-1307.904) (-1305.563) [-1305.055] * (-1310.340) (-1304.324) [-1308.396] (-1309.735) -- 0:01:03 Average standard deviation of split frequencies: 0.025368 180500 -- (-1304.813) [-1305.042] (-1309.195) (-1306.922) * (-1312.862) (-1305.974) [-1308.250] (-1308.934) -- 0:01:03 181000 -- [-1303.138] (-1306.049) (-1308.412) (-1309.048) * (-1309.624) (-1314.662) [-1309.227] (-1309.640) -- 0:01:03 181500 -- [-1304.713] (-1305.387) (-1305.075) (-1311.785) * (-1308.756) (-1303.119) (-1309.623) [-1310.820] -- 0:01:03 182000 -- (-1305.118) (-1304.739) (-1306.726) [-1305.889] * (-1308.420) (-1303.745) [-1308.181] (-1309.970) -- 0:01:02 182500 -- [-1307.221] (-1304.409) (-1304.214) (-1303.251) * (-1310.447) [-1305.440] (-1308.951) (-1308.384) -- 0:01:02 183000 -- [-1302.021] (-1305.670) (-1304.592) (-1302.579) * (-1309.722) [-1305.494] (-1310.102) (-1307.730) -- 0:01:02 183500 -- [-1306.528] (-1308.275) (-1307.130) (-1308.080) * (-1312.786) [-1305.622] (-1310.090) (-1307.964) -- 0:01:02 184000 -- [-1306.061] (-1306.797) (-1312.182) (-1305.276) * [-1310.542] (-1308.158) (-1316.215) (-1309.429) -- 0:01:02 184500 -- (-1306.707) [-1309.098] (-1308.842) (-1308.014) * (-1314.309) (-1307.840) [-1312.219] (-1308.214) -- 0:01:01 185000 -- [-1310.555] (-1307.554) (-1314.468) (-1303.700) * (-1307.237) (-1308.567) (-1309.428) [-1306.702] -- 0:01:01 Average standard deviation of split frequencies: 0.022669 185500 -- (-1307.759) (-1306.681) (-1308.959) [-1310.168] * (-1308.113) (-1308.936) [-1305.995] (-1309.328) -- 0:01:01 186000 -- (-1305.855) [-1306.529] (-1306.730) (-1307.533) * (-1306.183) [-1307.356] (-1306.437) (-1309.314) -- 0:01:01 186500 -- (-1304.704) [-1308.382] (-1306.607) (-1305.138) * (-1307.931) (-1307.488) (-1305.709) [-1308.374] -- 0:01:01 187000 -- (-1306.606) [-1306.715] (-1306.523) (-1308.593) * (-1307.662) (-1305.678) [-1306.106] (-1311.609) -- 0:01:00 187500 -- [-1308.795] (-1306.911) (-1306.197) (-1306.238) * (-1309.984) [-1308.705] (-1306.422) (-1308.150) -- 0:01:00 188000 -- (-1305.833) [-1306.650] (-1309.559) (-1309.811) * (-1309.326) (-1309.757) (-1310.653) [-1306.299] -- 0:01:04 188500 -- (-1305.097) [-1304.335] (-1307.370) (-1309.050) * (-1308.015) [-1307.307] (-1315.681) (-1307.052) -- 0:01:04 189000 -- (-1307.140) (-1306.996) [-1306.620] (-1308.699) * (-1309.480) [-1309.334] (-1315.125) (-1306.570) -- 0:01:04 189500 -- (-1302.844) (-1307.556) (-1305.353) [-1305.626] * (-1305.651) (-1307.769) [-1307.549] (-1308.570) -- 0:01:04 190000 -- (-1306.620) [-1306.264] (-1308.412) (-1309.439) * (-1306.321) [-1309.394] (-1312.050) (-1310.293) -- 0:01:03 Average standard deviation of split frequencies: 0.021702 190500 -- (-1308.904) (-1305.557) (-1305.680) [-1306.405] * (-1311.610) (-1307.042) (-1306.891) [-1309.310] -- 0:01:03 191000 -- [-1309.543] (-1304.518) (-1307.434) (-1313.479) * [-1304.716] (-1308.370) (-1306.343) (-1308.310) -- 0:01:03 191500 -- [-1304.418] (-1307.028) (-1304.973) (-1310.940) * (-1307.233) (-1308.232) [-1306.598] (-1312.160) -- 0:01:03 192000 -- (-1310.052) (-1307.362) [-1307.389] (-1308.574) * (-1304.409) (-1307.850) (-1307.337) [-1307.068] -- 0:01:03 192500 -- (-1304.956) (-1309.069) [-1306.332] (-1307.114) * (-1308.604) (-1307.227) [-1310.165] (-1308.776) -- 0:01:02 193000 -- (-1303.208) (-1310.155) (-1309.125) [-1307.172] * [-1307.068] (-1306.878) (-1308.128) (-1307.015) -- 0:01:02 193500 -- (-1302.935) [-1308.080] (-1308.330) (-1309.726) * (-1304.513) (-1308.146) [-1308.992] (-1309.581) -- 0:01:02 194000 -- [-1305.101] (-1308.607) (-1306.917) (-1310.380) * (-1307.468) (-1306.762) [-1309.471] (-1316.842) -- 0:01:02 194500 -- (-1309.831) (-1309.248) [-1305.586] (-1309.056) * [-1304.402] (-1309.600) (-1307.205) (-1309.158) -- 0:01:02 195000 -- [-1304.564] (-1312.424) (-1305.063) (-1307.853) * [-1304.311] (-1307.269) (-1308.737) (-1307.587) -- 0:01:01 Average standard deviation of split frequencies: 0.019508 195500 -- [-1302.680] (-1309.215) (-1307.551) (-1305.659) * [-1307.810] (-1307.452) (-1311.948) (-1309.251) -- 0:01:01 196000 -- (-1303.879) (-1306.283) [-1307.232] (-1307.172) * (-1303.512) (-1309.517) [-1307.712] (-1310.060) -- 0:01:01 196500 -- [-1303.101] (-1307.297) (-1312.102) (-1306.266) * (-1306.423) [-1306.976] (-1308.775) (-1307.090) -- 0:01:01 197000 -- (-1305.880) (-1305.303) (-1307.270) [-1309.036] * (-1313.604) [-1302.688] (-1310.377) (-1302.935) -- 0:01:01 197500 -- (-1305.327) [-1305.372] (-1308.112) (-1311.586) * (-1312.667) (-1303.938) [-1308.599] (-1307.833) -- 0:01:00 198000 -- (-1305.205) [-1304.958] (-1310.941) (-1309.454) * (-1311.337) (-1307.635) (-1307.966) [-1306.411] -- 0:01:00 198500 -- (-1305.867) (-1307.286) (-1309.846) [-1303.616] * (-1312.255) (-1307.139) (-1306.696) [-1310.576] -- 0:01:00 199000 -- (-1305.878) (-1306.528) [-1306.165] (-1306.198) * [-1309.602] (-1308.260) (-1305.243) (-1309.261) -- 0:01:00 199500 -- (-1308.987) (-1305.863) [-1308.897] (-1307.205) * (-1310.583) [-1307.403] (-1312.344) (-1307.387) -- 0:01:00 200000 -- [-1309.086] (-1303.793) (-1305.626) (-1308.454) * (-1310.589) (-1307.363) (-1310.982) [-1304.056] -- 0:00:59 Average standard deviation of split frequencies: 0.021972 200500 -- [-1307.450] (-1304.552) (-1307.583) (-1308.320) * (-1307.811) [-1303.883] (-1310.289) (-1304.653) -- 0:00:59 201000 -- (-1309.700) (-1305.650) (-1304.232) [-1308.489] * [-1307.020] (-1310.032) (-1311.503) (-1304.649) -- 0:00:59 201500 -- (-1312.016) [-1304.935] (-1311.448) (-1304.320) * [-1308.512] (-1305.953) (-1309.077) (-1308.368) -- 0:00:59 202000 -- (-1310.859) (-1305.486) (-1306.508) [-1311.060] * (-1310.353) (-1310.450) [-1311.987] (-1306.999) -- 0:01:03 202500 -- (-1313.167) [-1304.828] (-1305.406) (-1309.556) * (-1310.737) [-1306.692] (-1315.889) (-1311.247) -- 0:01:03 203000 -- (-1311.253) (-1307.275) (-1306.998) [-1308.009] * [-1309.725] (-1309.720) (-1311.237) (-1306.926) -- 0:01:02 203500 -- (-1313.209) (-1308.043) [-1306.751] (-1305.211) * (-1311.872) [-1308.947] (-1308.405) (-1313.446) -- 0:01:02 204000 -- [-1306.129] (-1308.524) (-1310.707) (-1309.764) * [-1307.303] (-1305.953) (-1308.066) (-1310.724) -- 0:01:02 204500 -- (-1306.238) (-1306.112) [-1304.217] (-1308.030) * [-1308.703] (-1305.570) (-1312.556) (-1312.743) -- 0:01:02 205000 -- (-1306.037) [-1309.110] (-1304.997) (-1306.344) * (-1311.288) [-1307.686] (-1308.671) (-1310.331) -- 0:01:02 Average standard deviation of split frequencies: 0.021612 205500 -- [-1306.121] (-1310.970) (-1305.888) (-1304.536) * (-1310.037) (-1308.900) [-1305.744] (-1310.828) -- 0:01:01 206000 -- (-1303.339) (-1312.941) [-1304.780] (-1311.075) * (-1303.641) (-1310.265) [-1307.010] (-1311.374) -- 0:01:01 206500 -- [-1303.772] (-1311.505) (-1302.635) (-1304.703) * (-1311.826) (-1308.280) [-1303.894] (-1313.588) -- 0:01:01 207000 -- [-1305.882] (-1309.521) (-1304.398) (-1305.749) * (-1307.664) (-1304.165) [-1303.381] (-1308.988) -- 0:01:01 207500 -- [-1305.417] (-1306.415) (-1306.019) (-1309.299) * (-1304.723) (-1308.369) (-1307.154) [-1309.726] -- 0:01:01 208000 -- [-1303.164] (-1306.029) (-1308.228) (-1306.473) * [-1303.463] (-1308.973) (-1306.691) (-1313.009) -- 0:01:00 208500 -- (-1308.918) (-1307.482) [-1304.858] (-1309.512) * (-1305.694) (-1312.351) (-1305.962) [-1310.756] -- 0:01:00 209000 -- (-1301.397) [-1307.072] (-1307.514) (-1307.492) * (-1303.567) (-1306.326) (-1308.429) [-1303.363] -- 0:01:00 209500 -- [-1305.836] (-1308.403) (-1305.043) (-1306.877) * (-1302.474) (-1305.972) (-1306.071) [-1308.927] -- 0:01:00 210000 -- (-1311.766) (-1306.394) (-1304.909) [-1303.353] * [-1306.407] (-1307.891) (-1310.973) (-1307.672) -- 0:01:00 Average standard deviation of split frequencies: 0.021631 210500 -- (-1308.680) (-1303.527) (-1301.293) [-1307.500] * [-1304.242] (-1304.012) (-1310.675) (-1306.458) -- 0:01:00 211000 -- (-1305.293) (-1305.381) [-1302.027] (-1303.090) * (-1304.958) [-1303.148] (-1309.529) (-1304.024) -- 0:00:59 211500 -- (-1308.641) [-1311.542] (-1307.104) (-1301.585) * (-1306.347) (-1304.669) (-1304.505) [-1307.768] -- 0:00:59 212000 -- (-1305.492) (-1306.106) (-1309.380) [-1301.367] * (-1308.848) (-1308.102) [-1305.465] (-1309.298) -- 0:00:59 212500 -- (-1308.183) (-1307.963) (-1306.744) [-1306.277] * (-1305.911) [-1302.962] (-1307.706) (-1307.927) -- 0:00:59 213000 -- (-1307.184) (-1306.594) (-1305.385) [-1306.340] * (-1308.703) [-1304.734] (-1303.865) (-1309.818) -- 0:00:59 213500 -- [-1304.738] (-1308.586) (-1304.891) (-1303.361) * [-1305.005] (-1306.883) (-1307.762) (-1306.604) -- 0:00:58 214000 -- [-1314.762] (-1303.282) (-1310.600) (-1304.615) * [-1305.097] (-1307.376) (-1306.264) (-1309.440) -- 0:00:58 214500 -- [-1303.387] (-1309.975) (-1307.941) (-1303.888) * (-1306.654) [-1304.749] (-1307.121) (-1309.444) -- 0:00:58 215000 -- (-1306.893) (-1309.877) (-1310.678) [-1307.253] * (-1307.113) (-1305.281) [-1305.594] (-1307.254) -- 0:00:58 Average standard deviation of split frequencies: 0.021097 215500 -- [-1307.011] (-1309.281) (-1313.037) (-1304.542) * (-1306.748) [-1303.008] (-1306.525) (-1310.292) -- 0:00:58 216000 -- [-1303.884] (-1308.499) (-1308.418) (-1303.702) * [-1306.188] (-1302.871) (-1310.405) (-1305.607) -- 0:00:58 216500 -- [-1304.966] (-1311.112) (-1309.124) (-1302.933) * (-1309.803) (-1303.810) (-1308.847) [-1308.701] -- 0:01:01 217000 -- [-1304.638] (-1309.251) (-1305.778) (-1303.718) * (-1304.901) (-1307.906) (-1311.286) [-1306.850] -- 0:01:01 217500 -- [-1303.204] (-1308.278) (-1308.353) (-1305.297) * (-1308.093) (-1309.855) [-1308.972] (-1305.774) -- 0:01:01 218000 -- (-1307.594) (-1308.820) (-1313.505) [-1303.495] * (-1310.647) [-1305.445] (-1308.662) (-1309.085) -- 0:01:00 218500 -- (-1306.572) [-1307.728] (-1307.610) (-1302.884) * [-1312.334] (-1306.404) (-1306.766) (-1304.204) -- 0:01:00 219000 -- [-1303.424] (-1304.263) (-1308.431) (-1303.422) * (-1308.849) [-1305.709] (-1305.928) (-1308.876) -- 0:01:00 219500 -- (-1306.931) (-1306.543) (-1302.331) [-1301.501] * [-1306.475] (-1306.852) (-1312.060) (-1309.006) -- 0:01:00 220000 -- (-1308.594) (-1306.450) (-1307.653) [-1305.978] * (-1305.429) [-1303.898] (-1306.725) (-1308.680) -- 0:01:00 Average standard deviation of split frequencies: 0.020057 220500 -- (-1306.945) (-1304.807) [-1304.656] (-1307.094) * (-1306.263) [-1302.565] (-1308.908) (-1309.453) -- 0:01:00 221000 -- (-1307.856) (-1301.833) [-1305.893] (-1313.487) * (-1305.857) [-1301.958] (-1309.611) (-1313.611) -- 0:00:59 221500 -- (-1307.321) (-1308.654) [-1307.019] (-1306.819) * [-1305.865] (-1302.492) (-1306.624) (-1311.607) -- 0:00:59 222000 -- (-1309.077) (-1306.656) [-1304.691] (-1301.388) * [-1304.336] (-1303.935) (-1304.538) (-1308.002) -- 0:00:59 222500 -- (-1311.288) (-1309.041) [-1303.024] (-1304.315) * (-1306.299) (-1309.364) [-1307.471] (-1308.806) -- 0:00:59 223000 -- (-1305.789) (-1308.784) (-1302.098) [-1303.324] * [-1306.470] (-1309.621) (-1306.011) (-1307.966) -- 0:00:59 223500 -- (-1306.100) (-1304.326) [-1305.970] (-1304.196) * (-1308.806) [-1307.561] (-1304.600) (-1310.752) -- 0:00:59 224000 -- (-1310.424) (-1304.364) (-1307.087) [-1305.156] * (-1304.397) (-1307.593) (-1307.756) [-1308.244] -- 0:00:58 224500 -- [-1315.224] (-1304.732) (-1304.041) (-1303.534) * (-1305.655) (-1306.215) [-1311.118] (-1309.936) -- 0:00:58 225000 -- (-1305.041) (-1305.357) (-1303.578) [-1302.323] * (-1306.043) [-1303.426] (-1307.712) (-1310.076) -- 0:00:58 Average standard deviation of split frequencies: 0.019816 225500 -- (-1308.743) [-1303.023] (-1306.023) (-1301.507) * (-1308.775) [-1303.439] (-1305.771) (-1308.314) -- 0:00:58 226000 -- (-1308.973) (-1304.353) (-1304.108) [-1306.803] * (-1304.684) (-1304.304) [-1304.253] (-1308.528) -- 0:00:58 226500 -- [-1306.168] (-1304.187) (-1305.597) (-1302.894) * (-1303.271) [-1305.609] (-1308.411) (-1310.012) -- 0:00:58 227000 -- (-1305.958) [-1304.807] (-1302.354) (-1305.742) * [-1307.453] (-1305.364) (-1308.403) (-1310.637) -- 0:00:57 227500 -- (-1305.650) (-1303.460) [-1301.907] (-1305.111) * (-1307.981) [-1309.683] (-1310.141) (-1307.367) -- 0:00:57 228000 -- (-1307.576) (-1306.141) [-1305.872] (-1301.506) * (-1303.077) (-1311.611) [-1303.009] (-1306.278) -- 0:00:57 228500 -- [-1303.722] (-1303.482) (-1308.144) (-1303.431) * [-1303.870] (-1311.024) (-1310.472) (-1308.964) -- 0:00:57 229000 -- [-1307.110] (-1303.691) (-1306.237) (-1306.771) * (-1303.199) [-1302.537] (-1308.450) (-1310.232) -- 0:00:57 229500 -- (-1307.433) (-1306.079) (-1305.089) [-1304.702] * (-1304.161) [-1307.238] (-1309.933) (-1305.434) -- 0:00:57 230000 -- [-1304.302] (-1304.404) (-1304.112) (-1308.669) * [-1305.070] (-1306.076) (-1305.500) (-1303.954) -- 0:00:56 Average standard deviation of split frequencies: 0.019301 230500 -- (-1310.417) (-1304.412) (-1303.493) [-1308.599] * [-1305.610] (-1307.919) (-1302.672) (-1307.663) -- 0:01:00 231000 -- (-1303.780) (-1306.305) (-1304.624) [-1306.201] * (-1303.888) [-1306.090] (-1305.211) (-1311.948) -- 0:00:59 231500 -- (-1303.747) (-1304.097) [-1303.632] (-1306.181) * (-1305.847) (-1307.630) (-1304.496) [-1303.716] -- 0:00:59 232000 -- (-1305.485) [-1306.459] (-1303.876) (-1307.161) * (-1302.243) (-1307.059) [-1303.416] (-1309.147) -- 0:00:59 232500 -- (-1304.741) (-1307.985) [-1308.522] (-1308.774) * (-1306.588) [-1307.886] (-1307.408) (-1308.320) -- 0:00:59 233000 -- (-1305.211) (-1305.480) [-1307.382] (-1309.979) * (-1306.785) (-1306.629) (-1305.621) [-1308.794] -- 0:00:59 233500 -- (-1304.466) (-1309.002) [-1307.381] (-1305.994) * (-1302.479) [-1307.386] (-1303.466) (-1308.505) -- 0:00:59 234000 -- (-1307.694) [-1304.998] (-1305.313) (-1303.073) * (-1303.643) (-1304.901) [-1306.703] (-1306.344) -- 0:00:58 234500 -- (-1306.825) (-1304.996) [-1302.941] (-1305.841) * [-1303.440] (-1309.360) (-1303.345) (-1305.323) -- 0:00:58 235000 -- (-1306.010) (-1304.349) (-1305.298) [-1306.684] * [-1306.126] (-1308.796) (-1304.320) (-1304.316) -- 0:00:58 Average standard deviation of split frequencies: 0.018976 235500 -- [-1309.308] (-1302.318) (-1308.838) (-1306.151) * [-1307.667] (-1310.831) (-1305.318) (-1305.507) -- 0:00:58 236000 -- (-1306.361) [-1304.425] (-1306.970) (-1310.124) * [-1304.329] (-1310.020) (-1305.781) (-1306.172) -- 0:00:58 236500 -- [-1305.043] (-1303.990) (-1305.936) (-1304.333) * (-1308.847) (-1305.802) (-1307.806) [-1303.764] -- 0:00:58 237000 -- (-1303.289) [-1303.139] (-1307.604) (-1307.107) * (-1309.235) (-1306.610) [-1306.198] (-1304.852) -- 0:00:57 237500 -- (-1306.442) [-1301.543] (-1305.104) (-1305.794) * [-1302.455] (-1306.235) (-1303.196) (-1306.112) -- 0:00:57 238000 -- (-1306.021) [-1305.124] (-1307.447) (-1306.249) * (-1307.801) [-1306.033] (-1305.808) (-1305.130) -- 0:00:57 238500 -- (-1305.989) [-1305.614] (-1307.788) (-1304.229) * [-1303.723] (-1304.166) (-1308.749) (-1302.788) -- 0:00:57 239000 -- (-1305.228) (-1305.693) (-1310.635) [-1308.497] * [-1306.129] (-1308.258) (-1304.512) (-1303.415) -- 0:00:57 239500 -- [-1306.229] (-1306.049) (-1306.226) (-1310.180) * (-1304.358) (-1303.282) [-1303.596] (-1308.437) -- 0:00:57 240000 -- (-1308.722) [-1304.068] (-1308.406) (-1304.572) * [-1305.899] (-1306.311) (-1304.198) (-1304.973) -- 0:00:56 Average standard deviation of split frequencies: 0.020349 240500 -- (-1305.824) (-1302.319) [-1303.592] (-1308.561) * [-1308.799] (-1307.552) (-1306.864) (-1312.082) -- 0:00:56 241000 -- (-1303.912) [-1305.165] (-1307.955) (-1311.188) * (-1310.591) (-1307.452) [-1305.143] (-1306.036) -- 0:00:56 241500 -- (-1305.209) [-1308.147] (-1308.218) (-1310.352) * (-1309.326) (-1307.198) (-1304.402) [-1304.242] -- 0:00:56 242000 -- (-1304.711) [-1304.333] (-1307.351) (-1305.827) * (-1307.408) (-1304.085) [-1306.819] (-1308.405) -- 0:00:56 242500 -- (-1307.160) [-1303.569] (-1308.971) (-1311.157) * [-1302.910] (-1308.817) (-1304.819) (-1307.963) -- 0:00:56 243000 -- [-1308.899] (-1303.771) (-1308.857) (-1307.406) * (-1304.293) [-1303.787] (-1307.676) (-1310.535) -- 0:00:56 243500 -- (-1308.659) [-1303.303] (-1303.308) (-1308.635) * [-1304.175] (-1308.724) (-1307.421) (-1307.734) -- 0:00:55 244000 -- [-1304.821] (-1309.088) (-1303.784) (-1308.923) * (-1305.549) (-1305.193) (-1306.279) [-1302.049] -- 0:00:55 244500 -- (-1304.647) [-1307.259] (-1303.814) (-1308.512) * (-1305.808) (-1306.806) [-1305.752] (-1305.556) -- 0:00:55 245000 -- (-1306.503) (-1308.392) [-1306.427] (-1302.871) * (-1308.406) (-1303.774) (-1306.182) [-1309.198] -- 0:00:58 Average standard deviation of split frequencies: 0.020547 245500 -- (-1306.881) [-1306.371] (-1304.114) (-1305.961) * (-1308.064) [-1307.434] (-1307.393) (-1306.362) -- 0:00:58 246000 -- (-1304.806) [-1302.028] (-1305.276) (-1304.633) * (-1313.173) (-1305.524) (-1305.019) [-1308.931] -- 0:00:58 246500 -- (-1310.381) (-1309.429) [-1305.384] (-1308.797) * (-1308.344) (-1310.102) (-1302.462) [-1307.604] -- 0:00:58 247000 -- (-1313.754) [-1306.683] (-1310.751) (-1308.189) * (-1306.775) (-1315.721) [-1305.805] (-1309.044) -- 0:00:57 247500 -- (-1308.540) [-1307.636] (-1309.130) (-1308.584) * (-1308.231) (-1311.119) [-1301.260] (-1306.297) -- 0:00:57 248000 -- (-1307.220) (-1305.792) (-1306.167) [-1304.019] * (-1310.142) (-1311.562) [-1303.899] (-1307.342) -- 0:00:57 248500 -- (-1305.353) (-1308.597) [-1305.999] (-1305.425) * (-1310.946) (-1310.249) [-1304.977] (-1305.597) -- 0:00:57 249000 -- (-1306.782) (-1304.395) (-1309.269) [-1306.729] * (-1311.850) (-1313.658) [-1307.824] (-1303.564) -- 0:00:57 249500 -- [-1305.981] (-1304.591) (-1301.094) (-1306.288) * (-1315.161) (-1308.627) (-1306.576) [-1308.129] -- 0:00:57 250000 -- (-1305.409) [-1302.002] (-1305.231) (-1310.025) * (-1311.759) [-1308.670] (-1303.538) (-1305.898) -- 0:00:57 Average standard deviation of split frequencies: 0.021314 250500 -- [-1305.534] (-1304.513) (-1306.752) (-1311.458) * (-1307.648) (-1309.947) (-1305.417) [-1306.546] -- 0:00:56 251000 -- (-1306.987) [-1304.943] (-1306.747) (-1305.734) * (-1310.762) (-1314.832) (-1305.627) [-1305.304] -- 0:00:56 251500 -- [-1309.654] (-1302.900) (-1303.445) (-1305.517) * (-1308.201) (-1310.265) [-1308.273] (-1308.527) -- 0:00:56 252000 -- (-1304.710) (-1302.792) (-1308.778) [-1306.491] * (-1309.462) [-1309.605] (-1308.119) (-1304.092) -- 0:00:56 252500 -- (-1307.591) [-1305.830] (-1302.424) (-1307.651) * (-1307.366) (-1310.081) (-1304.396) [-1304.790] -- 0:00:56 253000 -- (-1311.309) (-1305.144) (-1303.864) [-1303.151] * [-1304.304] (-1308.900) (-1306.967) (-1310.286) -- 0:00:56 253500 -- (-1309.800) (-1311.103) [-1301.665] (-1304.168) * (-1305.104) (-1306.132) [-1310.019] (-1308.541) -- 0:00:55 254000 -- (-1308.199) (-1303.999) [-1302.605] (-1308.756) * (-1306.747) [-1311.102] (-1306.128) (-1304.701) -- 0:00:55 254500 -- (-1306.622) [-1301.571] (-1303.653) (-1305.331) * (-1304.218) (-1310.822) [-1305.190] (-1312.054) -- 0:00:55 255000 -- (-1308.260) [-1303.076] (-1307.344) (-1304.003) * (-1308.071) (-1309.977) [-1305.341] (-1313.701) -- 0:00:55 Average standard deviation of split frequencies: 0.019949 255500 -- (-1309.732) (-1306.642) [-1306.314] (-1301.208) * (-1304.713) (-1309.333) [-1309.329] (-1311.222) -- 0:00:55 256000 -- [-1302.712] (-1309.101) (-1305.482) (-1307.392) * (-1308.076) [-1313.177] (-1314.336) (-1311.467) -- 0:00:55 256500 -- (-1305.696) [-1307.548] (-1307.239) (-1305.266) * (-1306.189) [-1310.439] (-1313.273) (-1305.579) -- 0:00:55 257000 -- (-1306.242) (-1305.616) (-1305.471) [-1304.880] * (-1309.309) (-1306.801) [-1306.838] (-1308.899) -- 0:00:54 257500 -- (-1304.773) [-1305.615] (-1305.224) (-1301.875) * [-1309.461] (-1308.838) (-1307.578) (-1308.630) -- 0:00:54 258000 -- (-1308.569) (-1308.049) (-1306.885) [-1307.284] * (-1319.371) [-1309.527] (-1307.127) (-1308.214) -- 0:00:54 258500 -- (-1308.150) [-1303.218] (-1303.625) (-1304.285) * (-1303.788) (-1309.636) [-1304.353] (-1310.624) -- 0:00:54 259000 -- (-1309.751) [-1303.033] (-1304.127) (-1304.159) * [-1309.259] (-1309.325) (-1306.018) (-1311.135) -- 0:00:57 259500 -- (-1305.462) (-1300.875) [-1304.897] (-1305.093) * (-1310.754) (-1307.172) (-1306.086) [-1313.150] -- 0:00:57 260000 -- (-1307.929) (-1312.592) (-1309.469) [-1307.234] * [-1308.843] (-1310.234) (-1306.913) (-1309.466) -- 0:00:56 Average standard deviation of split frequencies: 0.017884 260500 -- (-1306.263) (-1309.946) [-1308.606] (-1310.148) * (-1307.456) (-1307.426) [-1303.484] (-1311.005) -- 0:00:56 261000 -- (-1305.623) (-1307.712) [-1305.849] (-1308.230) * (-1307.393) (-1309.266) [-1306.274] (-1306.861) -- 0:00:56 261500 -- (-1310.205) (-1306.966) [-1304.750] (-1305.475) * (-1309.615) (-1308.771) (-1305.936) [-1304.971] -- 0:00:56 262000 -- (-1307.708) (-1308.690) [-1306.144] (-1305.143) * (-1307.034) (-1309.197) [-1307.325] (-1306.321) -- 0:00:56 262500 -- (-1308.188) [-1304.520] (-1308.832) (-1302.466) * (-1307.631) [-1306.603] (-1306.401) (-1306.140) -- 0:00:56 263000 -- (-1310.921) (-1303.438) (-1308.069) [-1307.656] * (-1308.785) [-1306.590] (-1307.466) (-1308.432) -- 0:00:56 263500 -- (-1307.762) [-1304.343] (-1304.408) (-1305.737) * (-1308.627) [-1303.120] (-1305.278) (-1306.206) -- 0:00:55 264000 -- (-1314.202) [-1303.487] (-1306.313) (-1306.188) * (-1307.986) (-1309.731) (-1308.877) [-1303.147] -- 0:00:55 264500 -- (-1305.462) (-1302.649) (-1306.607) [-1304.107] * (-1311.393) [-1306.407] (-1304.178) (-1302.518) -- 0:00:55 265000 -- [-1307.128] (-1309.239) (-1310.838) (-1300.243) * [-1307.249] (-1308.302) (-1305.801) (-1307.043) -- 0:00:55 Average standard deviation of split frequencies: 0.016344 265500 -- (-1304.582) (-1306.742) (-1307.616) [-1305.099] * (-1312.258) [-1303.411] (-1306.940) (-1307.946) -- 0:00:55 266000 -- (-1308.807) (-1307.928) [-1309.161] (-1304.266) * (-1307.138) (-1307.116) (-1306.138) [-1310.181] -- 0:00:55 266500 -- [-1313.282] (-1305.717) (-1309.736) (-1303.070) * (-1305.246) [-1308.253] (-1306.868) (-1306.910) -- 0:00:55 267000 -- [-1303.968] (-1307.535) (-1310.538) (-1303.244) * (-1306.575) (-1304.488) [-1305.128] (-1305.717) -- 0:00:54 267500 -- (-1306.901) (-1306.332) (-1310.384) [-1303.477] * (-1309.396) [-1306.156] (-1308.632) (-1304.349) -- 0:00:54 268000 -- [-1305.303] (-1304.128) (-1309.535) (-1304.887) * [-1307.254] (-1309.174) (-1306.139) (-1305.964) -- 0:00:54 268500 -- (-1316.220) (-1305.741) [-1312.979] (-1303.959) * (-1308.212) (-1306.525) [-1304.270] (-1305.682) -- 0:00:54 269000 -- (-1308.961) [-1304.869] (-1312.521) (-1305.989) * (-1307.115) [-1308.885] (-1308.194) (-1310.597) -- 0:00:54 269500 -- [-1307.086] (-1304.344) (-1309.896) (-1306.338) * (-1313.775) (-1305.036) [-1305.223] (-1317.418) -- 0:00:54 270000 -- [-1308.887] (-1308.259) (-1309.398) (-1306.019) * (-1311.845) [-1310.278] (-1305.017) (-1310.131) -- 0:00:54 Average standard deviation of split frequencies: 0.014223 270500 -- (-1305.724) (-1306.059) (-1308.383) [-1304.709] * (-1307.682) (-1311.559) [-1307.319] (-1308.614) -- 0:00:53 271000 -- (-1307.971) [-1305.917] (-1308.686) (-1305.763) * (-1310.326) (-1308.980) [-1305.773] (-1306.525) -- 0:00:53 271500 -- [-1307.148] (-1304.963) (-1312.468) (-1306.771) * [-1306.641] (-1309.464) (-1304.356) (-1306.793) -- 0:00:53 272000 -- (-1308.438) (-1303.818) [-1309.637] (-1304.227) * (-1306.427) (-1316.446) (-1306.776) [-1304.999] -- 0:00:53 272500 -- (-1305.626) (-1305.653) [-1310.013] (-1305.601) * (-1310.572) [-1311.619] (-1309.896) (-1304.501) -- 0:00:53 273000 -- (-1305.900) (-1307.415) (-1310.515) [-1305.063] * (-1308.603) [-1311.946] (-1306.086) (-1303.745) -- 0:00:55 273500 -- [-1306.511] (-1306.254) (-1307.538) (-1307.217) * [-1308.983] (-1303.776) (-1305.110) (-1304.088) -- 0:00:55 274000 -- (-1308.830) (-1305.355) [-1306.780] (-1302.954) * (-1306.603) (-1304.213) [-1306.073] (-1309.177) -- 0:00:55 274500 -- (-1304.204) [-1304.153] (-1306.790) (-1307.303) * (-1309.202) (-1306.167) [-1306.385] (-1305.790) -- 0:00:55 275000 -- (-1308.149) (-1307.372) (-1310.699) [-1303.447] * (-1312.263) [-1305.312] (-1303.177) (-1311.050) -- 0:00:55 Average standard deviation of split frequencies: 0.013854 275500 -- [-1308.117] (-1308.206) (-1307.696) (-1305.268) * (-1307.489) (-1305.853) (-1307.602) [-1307.645] -- 0:00:55 276000 -- (-1307.747) (-1304.483) (-1305.926) [-1305.560] * (-1304.738) (-1302.524) (-1307.028) [-1308.117] -- 0:00:55 276500 -- [-1309.024] (-1305.907) (-1305.022) (-1305.664) * (-1306.227) (-1305.852) (-1308.801) [-1305.650] -- 0:00:54 277000 -- (-1305.706) (-1308.700) (-1306.043) [-1303.853] * (-1306.587) (-1305.777) [-1309.217] (-1308.967) -- 0:00:54 277500 -- [-1306.022] (-1307.482) (-1309.820) (-1303.983) * (-1311.525) [-1303.404] (-1304.888) (-1315.863) -- 0:00:54 278000 -- (-1306.464) (-1312.345) [-1309.154] (-1305.434) * (-1308.158) (-1307.978) [-1304.291] (-1310.948) -- 0:00:54 278500 -- (-1307.532) (-1314.255) (-1309.228) [-1303.497] * [-1310.021] (-1307.309) (-1304.715) (-1311.678) -- 0:00:54 279000 -- (-1308.938) [-1309.213] (-1312.961) (-1305.302) * (-1304.942) [-1309.611] (-1308.900) (-1310.310) -- 0:00:54 279500 -- (-1307.821) (-1306.404) (-1303.727) [-1304.151] * [-1305.152] (-1309.500) (-1304.173) (-1307.429) -- 0:00:54 280000 -- (-1308.898) (-1305.781) (-1304.601) [-1308.221] * (-1308.337) (-1303.838) (-1306.358) [-1306.652] -- 0:00:53 Average standard deviation of split frequencies: 0.012912 280500 -- (-1309.487) (-1304.403) (-1305.705) [-1304.364] * (-1306.413) [-1304.194] (-1308.826) (-1310.746) -- 0:00:53 281000 -- (-1305.252) (-1305.038) [-1306.476] (-1304.253) * (-1307.995) [-1303.505] (-1307.883) (-1313.817) -- 0:00:53 281500 -- (-1310.179) (-1308.638) [-1303.018] (-1306.850) * [-1306.295] (-1306.161) (-1303.259) (-1309.105) -- 0:00:53 282000 -- (-1306.755) (-1304.666) [-1306.009] (-1306.532) * (-1305.072) [-1304.039] (-1306.126) (-1304.798) -- 0:00:53 282500 -- (-1308.883) (-1308.915) (-1306.002) [-1306.772] * [-1306.390] (-1306.645) (-1306.096) (-1308.173) -- 0:00:53 283000 -- (-1308.390) [-1302.579] (-1309.077) (-1314.630) * [-1308.153] (-1312.114) (-1307.107) (-1308.359) -- 0:00:53 283500 -- [-1305.545] (-1306.839) (-1308.256) (-1307.238) * (-1310.173) [-1304.749] (-1304.728) (-1307.818) -- 0:00:53 284000 -- (-1309.279) (-1306.330) [-1308.928] (-1308.959) * (-1309.785) [-1307.124] (-1307.831) (-1310.023) -- 0:00:52 284500 -- (-1309.894) [-1305.658] (-1310.580) (-1307.149) * (-1311.040) (-1304.396) (-1305.419) [-1311.288] -- 0:00:52 285000 -- (-1306.255) (-1305.594) [-1309.049] (-1303.990) * (-1308.582) (-1304.807) (-1304.793) [-1309.508] -- 0:00:52 Average standard deviation of split frequencies: 0.012980 285500 -- (-1303.439) [-1305.812] (-1303.684) (-1306.526) * (-1304.786) [-1303.259] (-1311.136) (-1312.030) -- 0:00:52 286000 -- (-1304.427) (-1305.406) [-1302.673] (-1306.273) * (-1308.754) (-1303.286) [-1308.644] (-1314.886) -- 0:00:52 286500 -- (-1314.173) (-1307.453) [-1309.222] (-1307.414) * (-1307.798) [-1303.653] (-1309.481) (-1309.704) -- 0:00:52 287000 -- (-1303.250) (-1307.479) [-1310.169] (-1307.465) * [-1305.175] (-1305.660) (-1307.314) (-1311.951) -- 0:00:52 287500 -- (-1305.733) (-1304.272) [-1303.614] (-1305.939) * (-1311.058) (-1310.361) (-1307.339) [-1309.608] -- 0:00:54 288000 -- (-1306.929) (-1306.272) (-1308.276) [-1306.699] * (-1308.560) (-1305.108) (-1311.146) [-1307.304] -- 0:00:54 288500 -- (-1308.615) (-1307.341) (-1306.377) [-1305.149] * (-1312.225) [-1303.044] (-1306.493) (-1307.633) -- 0:00:54 289000 -- [-1305.372] (-1304.408) (-1309.629) (-1312.142) * (-1310.687) (-1309.465) [-1306.290] (-1307.329) -- 0:00:54 289500 -- [-1304.042] (-1303.839) (-1307.722) (-1306.059) * (-1308.802) (-1306.543) (-1312.720) [-1309.184] -- 0:00:53 290000 -- [-1305.435] (-1302.563) (-1308.811) (-1307.177) * (-1309.545) (-1311.514) [-1303.955] (-1308.442) -- 0:00:53 Average standard deviation of split frequencies: 0.011961 290500 -- (-1301.904) (-1307.455) [-1302.253] (-1303.459) * (-1308.602) (-1307.884) [-1306.878] (-1306.605) -- 0:00:53 291000 -- (-1306.770) (-1305.019) (-1306.168) [-1302.806] * [-1309.177] (-1303.558) (-1308.442) (-1310.021) -- 0:00:53 291500 -- (-1307.519) (-1304.091) (-1310.575) [-1307.099] * (-1307.326) [-1305.952] (-1308.911) (-1306.879) -- 0:00:53 292000 -- (-1310.855) (-1308.322) [-1305.705] (-1304.053) * [-1305.625] (-1304.428) (-1310.783) (-1306.625) -- 0:00:53 292500 -- (-1310.183) (-1305.678) (-1307.561) [-1305.297] * (-1309.525) (-1307.971) [-1306.489] (-1304.523) -- 0:00:53 293000 -- (-1307.711) (-1306.123) [-1305.104] (-1303.681) * (-1313.618) (-1304.238) (-1306.427) [-1311.288] -- 0:00:53 293500 -- (-1304.331) [-1305.682] (-1307.507) (-1307.252) * (-1308.682) (-1305.768) (-1307.444) [-1307.880] -- 0:00:52 294000 -- (-1304.759) (-1304.800) [-1306.065] (-1308.835) * (-1306.822) (-1306.586) [-1307.782] (-1307.143) -- 0:00:52 294500 -- (-1307.991) (-1308.394) (-1306.442) [-1305.824] * [-1306.840] (-1307.048) (-1305.097) (-1302.065) -- 0:00:52 295000 -- (-1308.933) (-1309.970) (-1309.347) [-1303.057] * (-1309.271) [-1306.310] (-1305.200) (-1306.376) -- 0:00:52 Average standard deviation of split frequencies: 0.011546 295500 -- (-1308.645) (-1303.548) (-1307.864) [-1309.034] * (-1307.931) (-1307.094) (-1306.456) [-1306.405] -- 0:00:52 296000 -- (-1307.767) [-1303.422] (-1306.276) (-1307.985) * (-1305.813) [-1306.202] (-1303.089) (-1314.465) -- 0:00:52 296500 -- (-1308.576) (-1307.674) [-1306.980] (-1306.412) * (-1308.044) (-1304.176) [-1305.344] (-1309.668) -- 0:00:52 297000 -- (-1309.112) (-1304.814) [-1301.848] (-1307.615) * (-1305.617) (-1306.521) [-1303.218] (-1310.790) -- 0:00:52 297500 -- [-1305.618] (-1304.694) (-1307.495) (-1306.265) * (-1302.715) (-1305.061) [-1308.853] (-1308.212) -- 0:00:51 298000 -- (-1310.531) (-1309.802) [-1306.106] (-1307.976) * [-1307.745] (-1307.724) (-1305.839) (-1308.118) -- 0:00:51 298500 -- (-1313.951) (-1308.257) [-1302.551] (-1309.411) * (-1309.624) [-1305.300] (-1305.295) (-1307.296) -- 0:00:51 299000 -- (-1308.657) [-1303.763] (-1305.675) (-1306.758) * [-1302.573] (-1304.972) (-1302.220) (-1309.947) -- 0:00:51 299500 -- (-1309.007) [-1307.918] (-1303.887) (-1305.335) * (-1311.822) (-1302.651) (-1306.700) [-1307.294] -- 0:00:51 300000 -- [-1305.088] (-1304.692) (-1303.895) (-1306.054) * [-1306.720] (-1310.482) (-1305.126) (-1308.392) -- 0:00:51 Average standard deviation of split frequencies: 0.013189 300500 -- (-1304.730) (-1303.442) [-1301.471] (-1303.880) * (-1312.257) (-1301.589) [-1307.065] (-1307.035) -- 0:00:51 301000 -- (-1308.007) [-1305.983] (-1308.756) (-1303.479) * [-1307.912] (-1305.988) (-1308.682) (-1303.993) -- 0:00:51 301500 -- (-1306.844) [-1303.669] (-1303.706) (-1305.383) * [-1306.313] (-1305.779) (-1307.051) (-1310.625) -- 0:00:53 302000 -- (-1307.443) (-1306.464) [-1304.925] (-1311.453) * [-1306.809] (-1307.647) (-1308.876) (-1312.335) -- 0:00:53 302500 -- [-1305.654] (-1304.907) (-1304.110) (-1305.919) * [-1307.370] (-1310.458) (-1308.674) (-1310.788) -- 0:00:53 303000 -- [-1301.843] (-1307.381) (-1303.510) (-1306.533) * [-1307.147] (-1307.456) (-1308.553) (-1309.724) -- 0:00:52 303500 -- (-1306.708) (-1304.077) (-1305.229) [-1305.545] * [-1306.969] (-1308.237) (-1307.415) (-1312.883) -- 0:00:52 304000 -- (-1308.100) (-1310.894) [-1302.997] (-1308.157) * (-1307.367) (-1307.348) [-1309.891] (-1309.253) -- 0:00:52 304500 -- [-1306.274] (-1309.969) (-1308.556) (-1309.893) * (-1308.627) (-1306.823) [-1308.768] (-1305.597) -- 0:00:52 305000 -- (-1306.340) (-1307.509) [-1303.017] (-1309.606) * (-1307.910) (-1310.165) (-1307.470) [-1307.660] -- 0:00:52 Average standard deviation of split frequencies: 0.012052 305500 -- (-1305.509) (-1305.569) (-1307.503) [-1308.193] * [-1306.453] (-1307.775) (-1307.915) (-1306.148) -- 0:00:52 306000 -- (-1304.271) (-1306.025) [-1309.171] (-1306.793) * (-1301.025) [-1307.531] (-1307.085) (-1305.690) -- 0:00:52 306500 -- [-1313.768] (-1304.558) (-1307.587) (-1308.751) * [-1305.873] (-1308.224) (-1310.401) (-1313.215) -- 0:00:52 307000 -- (-1307.946) (-1305.947) [-1311.753] (-1309.334) * (-1306.786) (-1305.089) (-1309.278) [-1308.382] -- 0:00:51 307500 -- (-1307.725) (-1304.186) [-1303.263] (-1306.195) * (-1304.896) (-1306.407) [-1308.068] (-1308.255) -- 0:00:51 308000 -- (-1307.149) (-1305.543) [-1308.441] (-1306.414) * (-1310.500) (-1308.201) [-1309.291] (-1306.342) -- 0:00:51 308500 -- (-1305.944) (-1307.187) (-1311.082) [-1306.792] * (-1309.436) (-1304.194) [-1305.271] (-1308.675) -- 0:00:51 309000 -- (-1307.916) (-1307.587) [-1300.709] (-1307.816) * (-1305.733) (-1302.104) [-1307.002] (-1307.250) -- 0:00:51 309500 -- [-1304.122] (-1303.496) (-1307.132) (-1308.687) * (-1303.443) [-1301.997] (-1308.377) (-1306.447) -- 0:00:51 310000 -- (-1310.530) (-1309.958) (-1306.382) [-1308.286] * (-1303.842) [-1306.870] (-1309.797) (-1307.618) -- 0:00:51 Average standard deviation of split frequencies: 0.012407 310500 -- (-1310.788) [-1306.021] (-1304.648) (-1308.179) * [-1305.635] (-1309.449) (-1303.477) (-1308.036) -- 0:00:51 311000 -- (-1305.481) (-1306.416) (-1307.073) [-1303.924] * [-1304.577] (-1306.183) (-1302.933) (-1310.085) -- 0:00:50 311500 -- (-1304.227) (-1308.759) [-1306.197] (-1310.722) * [-1303.970] (-1307.548) (-1308.512) (-1303.724) -- 0:00:50 312000 -- [-1305.763] (-1305.574) (-1307.053) (-1307.171) * [-1304.818] (-1302.867) (-1305.922) (-1307.133) -- 0:00:50 312500 -- (-1307.784) [-1301.765] (-1309.315) (-1309.108) * [-1302.744] (-1310.341) (-1305.366) (-1309.249) -- 0:00:50 313000 -- (-1305.221) [-1304.848] (-1306.676) (-1307.324) * (-1310.617) (-1304.456) [-1308.411] (-1312.732) -- 0:00:50 313500 -- (-1306.357) (-1302.245) (-1305.998) [-1305.541] * [-1309.824] (-1303.191) (-1306.448) (-1310.599) -- 0:00:50 314000 -- (-1307.566) (-1306.961) [-1303.645] (-1305.203) * [-1302.266] (-1304.490) (-1304.306) (-1307.422) -- 0:00:50 314500 -- (-1307.552) (-1312.175) [-1302.210] (-1306.180) * (-1306.493) [-1307.517] (-1305.346) (-1307.277) -- 0:00:50 315000 -- [-1304.666] (-1309.255) (-1311.364) (-1306.624) * (-1308.316) [-1305.953] (-1305.870) (-1304.007) -- 0:00:50 Average standard deviation of split frequencies: 0.012432 315500 -- (-1307.514) [-1308.763] (-1305.723) (-1306.947) * (-1305.967) (-1304.638) (-1305.395) [-1303.896] -- 0:00:52 316000 -- [-1304.327] (-1307.614) (-1306.192) (-1307.355) * (-1301.977) [-1303.745] (-1309.284) (-1306.618) -- 0:00:51 316500 -- (-1306.064) [-1310.915] (-1307.467) (-1306.512) * (-1304.985) (-1305.753) (-1311.115) [-1304.240] -- 0:00:51 317000 -- (-1308.226) [-1305.572] (-1303.592) (-1308.002) * [-1303.762] (-1304.925) (-1311.400) (-1306.863) -- 0:00:51 317500 -- (-1310.129) (-1307.863) (-1308.943) [-1306.698] * (-1304.074) (-1306.608) (-1306.655) [-1302.340] -- 0:00:51 318000 -- (-1313.499) [-1308.811] (-1306.369) (-1306.839) * (-1307.011) (-1303.065) (-1305.476) [-1309.963] -- 0:00:51 318500 -- (-1311.038) (-1309.544) (-1307.289) [-1306.815] * [-1307.304] (-1304.313) (-1306.073) (-1306.820) -- 0:00:51 319000 -- (-1304.940) (-1307.080) [-1303.914] (-1307.360) * (-1308.474) [-1308.495] (-1305.321) (-1313.788) -- 0:00:51 319500 -- (-1305.132) [-1303.201] (-1306.812) (-1305.859) * (-1305.754) [-1308.231] (-1303.115) (-1310.140) -- 0:00:51 320000 -- (-1307.703) [-1302.182] (-1305.417) (-1307.859) * (-1304.070) (-1307.019) [-1306.417] (-1308.339) -- 0:00:50 Average standard deviation of split frequencies: 0.013139 320500 -- (-1304.721) (-1305.741) [-1302.170] (-1314.855) * (-1306.195) (-1303.623) (-1305.023) [-1309.469] -- 0:00:50 321000 -- [-1306.207] (-1307.683) (-1302.765) (-1306.071) * (-1305.782) (-1306.389) (-1308.742) [-1308.982] -- 0:00:50 321500 -- (-1307.680) (-1310.172) [-1304.886] (-1309.075) * (-1308.490) (-1308.727) [-1306.361] (-1305.514) -- 0:00:50 322000 -- [-1305.406] (-1306.576) (-1311.409) (-1309.791) * (-1304.870) (-1305.232) [-1307.433] (-1309.343) -- 0:00:50 322500 -- (-1311.728) (-1305.650) [-1306.096] (-1314.416) * (-1306.038) (-1310.652) [-1304.891] (-1305.207) -- 0:00:50 323000 -- [-1310.734] (-1306.540) (-1309.208) (-1313.627) * (-1306.498) (-1308.238) (-1309.732) [-1306.255] -- 0:00:50 323500 -- [-1309.928] (-1305.830) (-1308.384) (-1311.427) * (-1302.706) (-1311.848) [-1307.592] (-1305.410) -- 0:00:50 324000 -- (-1305.059) [-1311.763] (-1305.379) (-1310.992) * [-1303.598] (-1306.476) (-1312.567) (-1308.297) -- 0:00:50 324500 -- [-1307.452] (-1309.852) (-1301.187) (-1311.886) * (-1301.615) [-1306.192] (-1309.364) (-1303.158) -- 0:00:49 325000 -- (-1308.975) (-1311.941) [-1308.370] (-1312.111) * (-1312.249) (-1315.833) [-1311.078] (-1304.830) -- 0:00:49 Average standard deviation of split frequencies: 0.013184 325500 -- [-1308.384] (-1310.811) (-1307.314) (-1305.708) * [-1305.243] (-1307.295) (-1307.026) (-1306.068) -- 0:00:49 326000 -- (-1312.851) [-1306.468] (-1304.806) (-1311.775) * (-1304.377) (-1308.599) [-1304.903] (-1310.027) -- 0:00:49 326500 -- [-1308.726] (-1307.898) (-1307.149) (-1304.210) * (-1304.506) (-1306.116) [-1304.818] (-1307.104) -- 0:00:49 327000 -- [-1306.533] (-1309.834) (-1305.627) (-1307.133) * (-1305.405) [-1305.065] (-1309.973) (-1306.391) -- 0:00:49 327500 -- (-1309.860) [-1305.637] (-1302.964) (-1306.195) * (-1308.655) [-1302.641] (-1314.693) (-1305.258) -- 0:00:51 328000 -- (-1312.515) (-1307.623) [-1304.345] (-1308.876) * [-1308.058] (-1306.340) (-1307.213) (-1306.593) -- 0:00:51 328500 -- (-1309.898) [-1312.112] (-1307.243) (-1313.943) * (-1304.011) (-1306.985) (-1305.386) [-1304.230] -- 0:00:51 329000 -- (-1308.443) (-1308.155) [-1311.662] (-1312.598) * [-1305.952] (-1309.601) (-1304.402) (-1308.468) -- 0:00:50 329500 -- [-1311.340] (-1306.256) (-1307.499) (-1307.301) * (-1305.656) (-1305.931) [-1307.128] (-1305.694) -- 0:00:50 330000 -- (-1312.602) [-1309.477] (-1309.462) (-1309.014) * (-1302.041) (-1305.817) [-1305.500] (-1306.141) -- 0:00:50 Average standard deviation of split frequencies: 0.013669 330500 -- (-1308.580) (-1309.062) [-1304.021] (-1303.713) * [-1302.122] (-1303.704) (-1305.721) (-1310.852) -- 0:00:50 331000 -- (-1308.096) (-1311.805) [-1306.001] (-1309.944) * (-1305.583) (-1308.096) [-1307.083] (-1305.711) -- 0:00:50 331500 -- (-1308.815) (-1309.741) (-1311.471) [-1307.789] * [-1303.547] (-1306.573) (-1303.831) (-1305.499) -- 0:00:50 332000 -- (-1309.466) [-1306.615] (-1307.777) (-1308.780) * (-1302.921) [-1306.795] (-1308.082) (-1307.528) -- 0:00:50 332500 -- (-1309.049) (-1306.502) (-1305.072) [-1304.839] * (-1307.752) (-1305.114) (-1311.789) [-1306.857] -- 0:00:50 333000 -- (-1309.975) (-1310.765) (-1304.799) [-1305.217] * (-1308.310) [-1304.204] (-1307.709) (-1307.298) -- 0:00:50 333500 -- (-1309.436) (-1308.089) [-1305.254] (-1304.201) * [-1305.463] (-1309.806) (-1311.599) (-1308.628) -- 0:00:49 334000 -- (-1310.141) (-1307.774) [-1305.195] (-1306.169) * (-1308.193) (-1307.393) [-1306.954] (-1306.876) -- 0:00:49 334500 -- (-1309.712) (-1306.877) [-1303.610] (-1303.497) * [-1303.616] (-1305.082) (-1307.484) (-1307.808) -- 0:00:49 335000 -- (-1312.135) (-1306.343) (-1308.278) [-1305.989] * (-1303.140) (-1308.188) (-1309.685) [-1308.370] -- 0:00:49 Average standard deviation of split frequencies: 0.013947 335500 -- [-1308.450] (-1305.061) (-1308.468) (-1306.557) * (-1305.259) [-1304.406] (-1306.676) (-1308.002) -- 0:00:49 336000 -- (-1311.124) [-1305.550] (-1306.344) (-1313.425) * (-1303.954) [-1304.391] (-1304.082) (-1304.303) -- 0:00:49 336500 -- (-1318.555) [-1307.129] (-1305.609) (-1309.054) * [-1306.614] (-1309.141) (-1304.603) (-1308.409) -- 0:00:49 337000 -- (-1310.027) (-1309.500) [-1305.936] (-1303.945) * (-1310.472) (-1307.339) [-1306.753] (-1309.417) -- 0:00:49 337500 -- (-1309.718) (-1307.366) (-1305.086) [-1305.223] * (-1312.004) (-1305.932) (-1303.372) [-1311.837] -- 0:00:49 338000 -- (-1309.181) (-1303.653) [-1306.599] (-1305.897) * (-1311.085) (-1311.229) (-1309.094) [-1305.596] -- 0:00:48 338500 -- (-1309.879) (-1306.047) (-1303.935) [-1304.961] * [-1303.296] (-1306.253) (-1310.111) (-1310.074) -- 0:00:48 339000 -- (-1310.850) (-1308.023) [-1302.302] (-1305.952) * (-1305.259) [-1304.217] (-1306.561) (-1305.825) -- 0:00:48 339500 -- (-1309.011) [-1304.597] (-1307.166) (-1310.126) * (-1308.293) [-1307.366] (-1305.360) (-1312.604) -- 0:00:48 340000 -- (-1309.215) (-1306.742) [-1306.397] (-1310.133) * [-1305.070] (-1305.140) (-1303.323) (-1308.432) -- 0:00:48 Average standard deviation of split frequencies: 0.013105 340500 -- (-1308.357) (-1306.075) (-1309.260) [-1305.383] * [-1305.328] (-1307.310) (-1303.339) (-1309.082) -- 0:00:48 341000 -- (-1311.201) [-1306.300] (-1308.395) (-1306.413) * (-1307.218) (-1303.338) (-1306.497) [-1307.863] -- 0:00:50 341500 -- (-1310.863) (-1308.882) [-1306.547] (-1304.530) * (-1305.320) [-1306.975] (-1310.712) (-1309.890) -- 0:00:50 342000 -- (-1308.495) [-1306.476] (-1305.590) (-1306.845) * (-1307.223) (-1312.683) [-1309.557] (-1311.434) -- 0:00:50 342500 -- (-1309.387) (-1305.923) [-1304.948] (-1308.205) * (-1308.561) (-1313.015) (-1308.379) [-1304.200] -- 0:00:49 343000 -- (-1313.880) (-1306.809) [-1309.837] (-1306.395) * (-1308.970) (-1304.606) [-1310.942] (-1309.464) -- 0:00:49 343500 -- (-1309.513) (-1309.392) [-1307.666] (-1304.424) * (-1310.115) [-1310.038] (-1312.430) (-1307.073) -- 0:00:49 344000 -- (-1308.495) (-1306.992) [-1307.373] (-1309.554) * (-1307.141) (-1310.416) (-1306.480) [-1305.847] -- 0:00:49 344500 -- (-1308.755) (-1306.112) [-1305.800] (-1303.897) * (-1306.746) [-1304.609] (-1308.796) (-1307.839) -- 0:00:49 345000 -- (-1309.574) (-1304.053) [-1304.150] (-1306.908) * (-1307.759) (-1305.906) (-1306.972) [-1304.533] -- 0:00:49 Average standard deviation of split frequencies: 0.012338 345500 -- [-1305.023] (-1303.169) (-1306.598) (-1313.531) * (-1305.271) (-1309.636) (-1304.190) [-1307.428] -- 0:00:49 346000 -- [-1307.477] (-1309.457) (-1302.820) (-1306.920) * [-1301.295] (-1310.966) (-1306.999) (-1306.440) -- 0:00:49 346500 -- (-1307.897) (-1308.362) (-1306.420) [-1302.627] * (-1307.574) (-1310.686) (-1307.539) [-1306.557] -- 0:00:49 347000 -- (-1305.733) [-1305.764] (-1311.750) (-1304.055) * (-1304.341) (-1308.892) (-1309.204) [-1306.444] -- 0:00:48 347500 -- (-1308.774) [-1306.018] (-1311.087) (-1304.238) * (-1307.461) (-1308.727) (-1309.577) [-1311.554] -- 0:00:48 348000 -- (-1308.080) (-1305.740) [-1308.590] (-1308.012) * [-1305.874] (-1308.430) (-1309.602) (-1309.324) -- 0:00:48 348500 -- (-1308.272) (-1307.335) [-1307.045] (-1307.001) * [-1302.540] (-1307.358) (-1309.975) (-1304.765) -- 0:00:48 349000 -- [-1310.074] (-1305.285) (-1306.679) (-1309.630) * (-1303.554) (-1306.336) [-1312.419] (-1303.720) -- 0:00:48 349500 -- (-1312.809) (-1310.741) (-1303.682) [-1305.121] * [-1305.545] (-1313.431) (-1311.541) (-1304.284) -- 0:00:48 350000 -- [-1307.244] (-1304.367) (-1308.199) (-1304.921) * (-1302.519) (-1303.891) (-1308.257) [-1309.532] -- 0:00:48 Average standard deviation of split frequencies: 0.012024 350500 -- (-1312.606) (-1309.012) (-1307.138) [-1305.342] * (-1304.200) (-1308.406) (-1308.140) [-1306.936] -- 0:00:48 351000 -- [-1308.240] (-1305.197) (-1308.284) (-1306.433) * (-1305.162) (-1307.683) [-1310.130] (-1308.376) -- 0:00:48 351500 -- (-1312.832) (-1308.232) [-1309.952] (-1311.310) * (-1306.612) (-1307.695) (-1309.197) [-1305.963] -- 0:00:47 352000 -- (-1308.652) (-1311.838) [-1303.301] (-1308.495) * (-1308.441) (-1310.519) (-1306.808) [-1306.697] -- 0:00:47 352500 -- (-1307.812) (-1307.190) [-1303.719] (-1304.519) * (-1309.262) (-1312.769) [-1308.230] (-1303.793) -- 0:00:47 353000 -- [-1313.427] (-1308.835) (-1305.063) (-1311.184) * (-1307.848) (-1310.169) (-1308.611) [-1306.896] -- 0:00:47 353500 -- (-1307.443) (-1309.428) [-1307.083] (-1308.443) * (-1308.396) (-1307.248) [-1310.296] (-1310.887) -- 0:00:47 354000 -- (-1308.418) (-1307.328) (-1310.782) [-1307.956] * [-1311.173] (-1308.541) (-1311.029) (-1306.429) -- 0:00:47 354500 -- [-1306.238] (-1308.204) (-1304.440) (-1303.771) * (-1307.738) (-1307.755) (-1311.420) [-1306.469] -- 0:00:47 355000 -- (-1307.966) (-1311.078) (-1305.750) [-1304.558] * [-1310.879] (-1310.855) (-1308.902) (-1310.112) -- 0:00:49 Average standard deviation of split frequencies: 0.012073 355500 -- (-1306.097) [-1306.280] (-1306.268) (-1305.368) * (-1307.390) (-1308.681) (-1309.262) [-1308.802] -- 0:00:48 356000 -- (-1306.121) [-1306.769] (-1304.354) (-1303.695) * (-1303.045) (-1308.589) (-1310.116) [-1306.098] -- 0:00:48 356500 -- [-1304.861] (-1305.414) (-1305.202) (-1304.763) * [-1303.346] (-1307.850) (-1306.951) (-1309.057) -- 0:00:48 357000 -- (-1303.756) (-1306.616) [-1306.917] (-1307.727) * (-1307.422) (-1310.403) [-1307.953] (-1305.576) -- 0:00:48 357500 -- (-1308.172) (-1306.817) (-1305.989) [-1304.782] * (-1309.489) (-1308.324) (-1308.177) [-1304.892] -- 0:00:48 358000 -- (-1306.856) (-1305.241) (-1304.321) [-1312.429] * [-1304.622] (-1304.838) (-1307.525) (-1314.364) -- 0:00:48 358500 -- [-1309.785] (-1305.294) (-1308.895) (-1307.391) * [-1305.461] (-1309.116) (-1307.593) (-1308.723) -- 0:00:48 359000 -- (-1304.808) [-1304.611] (-1307.578) (-1306.114) * [-1304.291] (-1308.791) (-1307.120) (-1308.840) -- 0:00:48 359500 -- (-1305.553) [-1305.384] (-1305.192) (-1304.789) * (-1306.076) (-1310.828) (-1307.358) [-1308.419] -- 0:00:48 360000 -- (-1305.869) (-1310.999) [-1307.280] (-1305.792) * (-1304.770) [-1309.509] (-1309.140) (-1306.686) -- 0:00:47 Average standard deviation of split frequencies: 0.011273 360500 -- (-1308.049) [-1307.784] (-1309.152) (-1302.677) * (-1306.146) (-1306.931) [-1303.110] (-1305.692) -- 0:00:47 361000 -- [-1312.273] (-1305.622) (-1311.778) (-1306.646) * [-1303.756] (-1306.507) (-1305.678) (-1309.304) -- 0:00:47 361500 -- (-1312.177) (-1303.760) [-1304.817] (-1304.775) * [-1307.185] (-1309.999) (-1309.041) (-1309.226) -- 0:00:47 362000 -- (-1307.390) (-1304.268) [-1305.943] (-1303.102) * (-1308.645) (-1309.785) [-1307.543] (-1310.215) -- 0:00:47 362500 -- (-1306.776) (-1303.474) [-1303.284] (-1305.469) * (-1308.906) [-1308.862] (-1308.881) (-1311.564) -- 0:00:47 363000 -- (-1307.538) (-1306.931) (-1305.431) [-1303.525] * (-1305.692) (-1309.242) (-1303.683) [-1308.312] -- 0:00:47 363500 -- (-1312.209) (-1310.238) (-1304.892) [-1302.719] * (-1305.304) [-1311.412] (-1306.325) (-1307.834) -- 0:00:47 364000 -- (-1307.915) (-1308.928) [-1306.596] (-1302.994) * [-1305.929] (-1309.055) (-1305.630) (-1306.154) -- 0:00:47 364500 -- (-1311.063) (-1305.759) [-1304.365] (-1307.450) * (-1306.271) (-1308.530) [-1305.736] (-1308.490) -- 0:00:47 365000 -- [-1305.098] (-1305.663) (-1309.150) (-1305.176) * (-1307.794) (-1309.819) [-1305.609] (-1307.076) -- 0:00:46 Average standard deviation of split frequencies: 0.010948 365500 -- (-1309.757) (-1305.250) [-1308.968] (-1305.630) * (-1307.714) [-1303.036] (-1305.047) (-1302.868) -- 0:00:46 366000 -- (-1308.592) (-1305.894) (-1309.897) [-1307.207] * (-1308.058) [-1302.937] (-1306.416) (-1303.737) -- 0:00:46 366500 -- (-1306.347) (-1307.918) (-1312.010) [-1304.623] * (-1307.332) [-1304.832] (-1304.573) (-1303.218) -- 0:00:46 367000 -- [-1306.292] (-1304.155) (-1310.713) (-1305.727) * (-1309.473) (-1312.490) (-1304.367) [-1304.329] -- 0:00:46 367500 -- (-1312.995) [-1305.354] (-1306.601) (-1312.430) * (-1307.845) (-1312.352) [-1306.685] (-1306.665) -- 0:00:46 368000 -- (-1307.764) (-1307.150) (-1306.056) [-1308.632] * (-1306.293) (-1310.290) [-1302.829] (-1308.560) -- 0:00:46 368500 -- [-1307.156] (-1307.037) (-1305.543) (-1308.089) * [-1303.757] (-1304.277) (-1304.642) (-1306.245) -- 0:00:46 369000 -- (-1308.974) (-1303.480) [-1303.170] (-1308.671) * (-1304.975) (-1309.712) [-1306.326] (-1305.821) -- 0:00:46 369500 -- (-1310.050) (-1305.597) [-1305.714] (-1307.999) * (-1302.699) (-1310.349) (-1302.530) [-1305.432] -- 0:00:47 370000 -- (-1308.451) (-1306.564) [-1301.776] (-1306.680) * (-1304.546) [-1307.911] (-1305.126) (-1306.563) -- 0:00:47 Average standard deviation of split frequencies: 0.010698 370500 -- [-1305.201] (-1302.255) (-1305.540) (-1304.214) * (-1308.928) (-1311.985) [-1310.944] (-1308.256) -- 0:00:47 371000 -- [-1307.526] (-1305.917) (-1308.036) (-1307.523) * (-1307.413) (-1307.124) (-1304.212) [-1305.488] -- 0:00:47 371500 -- (-1305.785) [-1305.704] (-1308.031) (-1314.335) * [-1303.937] (-1306.337) (-1311.277) (-1303.930) -- 0:00:47 372000 -- (-1303.689) [-1304.810] (-1306.654) (-1314.690) * (-1304.510) (-1307.087) [-1306.406] (-1305.905) -- 0:00:47 372500 -- [-1305.361] (-1306.261) (-1305.080) (-1307.687) * (-1306.070) (-1308.585) (-1309.305) [-1304.191] -- 0:00:47 373000 -- [-1307.305] (-1303.709) (-1304.650) (-1310.359) * (-1304.762) [-1307.897] (-1310.532) (-1306.089) -- 0:00:47 373500 -- [-1305.257] (-1308.227) (-1307.547) (-1306.148) * [-1303.391] (-1309.277) (-1310.183) (-1307.935) -- 0:00:46 374000 -- [-1305.137] (-1310.641) (-1305.519) (-1310.805) * [-1304.052] (-1308.474) (-1314.381) (-1303.038) -- 0:00:46 374500 -- (-1304.036) (-1307.804) [-1304.779] (-1305.550) * (-1306.155) (-1309.921) (-1311.047) [-1304.053] -- 0:00:46 375000 -- [-1306.650] (-1304.823) (-1309.096) (-1307.583) * [-1302.693] (-1310.410) (-1313.138) (-1307.329) -- 0:00:46 Average standard deviation of split frequencies: 0.009795 375500 -- (-1301.969) (-1309.025) [-1306.481] (-1306.543) * (-1303.883) (-1308.260) (-1311.337) [-1305.347] -- 0:00:46 376000 -- [-1307.161] (-1308.139) (-1310.689) (-1310.852) * (-1308.046) (-1310.776) [-1306.397] (-1307.773) -- 0:00:46 376500 -- (-1307.832) (-1307.716) (-1306.204) [-1304.071] * (-1306.933) (-1311.692) (-1310.518) [-1303.362] -- 0:00:46 377000 -- [-1304.104] (-1308.868) (-1308.612) (-1306.722) * (-1303.992) (-1308.526) (-1314.441) [-1305.414] -- 0:00:46 377500 -- [-1303.566] (-1309.674) (-1310.221) (-1307.599) * [-1305.405] (-1311.812) (-1307.647) (-1305.715) -- 0:00:46 378000 -- [-1308.869] (-1304.703) (-1309.468) (-1314.695) * (-1305.301) (-1308.577) [-1305.656] (-1306.323) -- 0:00:46 378500 -- (-1304.583) [-1303.762] (-1307.930) (-1311.795) * (-1308.253) (-1308.062) (-1304.957) [-1307.528] -- 0:00:45 379000 -- (-1301.850) [-1306.628] (-1307.555) (-1310.664) * (-1305.021) (-1311.520) (-1309.205) [-1306.467] -- 0:00:45 379500 -- [-1306.323] (-1302.513) (-1305.728) (-1304.866) * (-1305.522) (-1308.159) (-1306.238) [-1303.112] -- 0:00:45 380000 -- (-1308.689) (-1307.040) [-1306.137] (-1307.571) * [-1303.347] (-1308.757) (-1306.267) (-1305.745) -- 0:00:45 Average standard deviation of split frequencies: 0.009742 380500 -- (-1308.968) (-1306.445) [-1306.803] (-1302.173) * (-1304.071) (-1305.562) (-1305.768) [-1306.337] -- 0:00:45 381000 -- [-1308.694] (-1305.605) (-1306.682) (-1306.557) * (-1307.984) [-1306.577] (-1310.670) (-1311.590) -- 0:00:45 381500 -- (-1310.035) (-1307.565) (-1310.050) [-1303.098] * (-1309.404) [-1308.100] (-1307.909) (-1307.859) -- 0:00:45 382000 -- (-1307.484) (-1310.145) [-1305.099] (-1305.371) * (-1310.341) [-1309.995] (-1306.023) (-1305.988) -- 0:00:45 382500 -- (-1309.900) (-1309.987) (-1307.678) [-1305.365] * (-1308.570) (-1307.140) (-1313.899) [-1306.384] -- 0:00:45 383000 -- [-1309.171] (-1311.200) (-1306.915) (-1310.322) * [-1307.616] (-1315.007) (-1307.835) (-1306.121) -- 0:00:45 383500 -- (-1304.824) (-1308.698) (-1304.156) [-1306.532] * (-1306.703) (-1311.440) [-1304.906] (-1311.956) -- 0:00:46 384000 -- (-1304.459) [-1304.866] (-1306.776) (-1306.871) * (-1307.291) (-1308.877) [-1304.249] (-1303.187) -- 0:00:46 384500 -- (-1307.290) (-1307.335) [-1305.756] (-1306.713) * (-1307.657) [-1307.081] (-1309.518) (-1305.325) -- 0:00:46 385000 -- (-1306.636) (-1303.628) [-1305.026] (-1308.156) * (-1307.672) (-1309.174) [-1307.332] (-1303.913) -- 0:00:46 Average standard deviation of split frequencies: 0.008874 385500 -- [-1303.478] (-1307.747) (-1305.018) (-1305.448) * (-1304.962) (-1309.030) (-1308.487) [-1305.449] -- 0:00:46 386000 -- [-1304.201] (-1310.118) (-1306.148) (-1303.770) * (-1305.564) (-1308.918) (-1308.515) [-1303.213] -- 0:00:46 386500 -- (-1301.906) (-1307.555) [-1304.737] (-1306.249) * (-1306.147) (-1305.143) [-1303.878] (-1307.901) -- 0:00:46 387000 -- (-1310.110) (-1310.001) (-1302.280) [-1302.276] * (-1305.606) (-1306.118) (-1306.930) [-1304.802] -- 0:00:45 387500 -- (-1305.611) (-1303.496) [-1304.829] (-1305.432) * [-1302.309] (-1308.337) (-1304.961) (-1305.472) -- 0:00:45 388000 -- (-1305.485) (-1303.819) [-1303.932] (-1304.578) * (-1309.310) (-1306.911) (-1305.993) [-1306.817] -- 0:00:45 388500 -- [-1303.368] (-1304.524) (-1312.216) (-1309.430) * (-1306.251) [-1306.435] (-1303.664) (-1305.189) -- 0:00:45 389000 -- (-1306.714) [-1312.573] (-1309.425) (-1312.503) * (-1306.648) (-1304.800) [-1304.984] (-1304.230) -- 0:00:45 389500 -- [-1305.053] (-1312.701) (-1303.119) (-1303.953) * (-1309.810) (-1307.540) (-1305.592) [-1307.687] -- 0:00:45 390000 -- (-1308.594) (-1302.677) (-1308.426) [-1307.842] * (-1307.899) [-1306.903] (-1306.512) (-1308.616) -- 0:00:45 Average standard deviation of split frequencies: 0.009171 390500 -- (-1309.504) [-1307.245] (-1310.782) (-1305.444) * (-1308.406) [-1305.743] (-1307.979) (-1308.530) -- 0:00:45 391000 -- (-1310.347) (-1304.507) (-1306.371) [-1301.860] * [-1303.683] (-1306.985) (-1311.527) (-1307.444) -- 0:00:45 391500 -- (-1306.735) (-1307.823) [-1304.678] (-1304.950) * [-1302.627] (-1310.992) (-1306.591) (-1306.518) -- 0:00:45 392000 -- (-1310.851) (-1307.293) [-1305.279] (-1305.788) * (-1304.681) [-1306.049] (-1310.220) (-1304.579) -- 0:00:44 392500 -- (-1304.362) (-1308.565) [-1304.028] (-1303.658) * (-1306.389) [-1304.650] (-1303.108) (-1308.193) -- 0:00:44 393000 -- (-1307.114) [-1303.189] (-1302.515) (-1304.901) * [-1305.761] (-1307.805) (-1305.971) (-1304.802) -- 0:00:44 393500 -- [-1304.002] (-1305.621) (-1306.167) (-1306.067) * (-1310.716) (-1305.604) (-1305.162) [-1306.564] -- 0:00:44 394000 -- (-1308.224) [-1304.942] (-1306.296) (-1308.707) * (-1310.449) (-1304.316) (-1306.877) [-1305.185] -- 0:00:44 394500 -- [-1306.345] (-1307.070) (-1308.551) (-1308.283) * [-1304.822] (-1305.265) (-1309.663) (-1303.757) -- 0:00:44 395000 -- (-1308.419) (-1310.621) (-1309.578) [-1307.769] * (-1309.152) (-1312.244) [-1306.017] (-1304.202) -- 0:00:44 Average standard deviation of split frequencies: 0.009047 395500 -- [-1303.597] (-1311.692) (-1305.885) (-1308.844) * (-1305.132) (-1303.173) (-1307.790) [-1308.837] -- 0:00:44 396000 -- (-1310.834) [-1303.852] (-1302.451) (-1308.027) * (-1305.782) (-1305.594) (-1306.740) [-1303.937] -- 0:00:44 396500 -- (-1306.715) [-1306.222] (-1305.676) (-1306.870) * (-1305.669) [-1307.320] (-1304.514) (-1307.660) -- 0:00:44 397000 -- [-1301.680] (-1304.185) (-1305.742) (-1309.539) * [-1307.442] (-1304.817) (-1305.422) (-1306.715) -- 0:00:44 397500 -- (-1306.404) (-1308.809) (-1305.281) [-1307.933] * (-1306.198) (-1301.773) (-1304.155) [-1309.101] -- 0:00:45 398000 -- (-1305.825) (-1307.172) [-1306.869] (-1312.854) * (-1302.211) (-1309.301) [-1302.103] (-1308.238) -- 0:00:45 398500 -- (-1304.067) (-1304.975) [-1303.677] (-1309.256) * (-1305.878) (-1305.312) (-1311.222) [-1306.010] -- 0:00:45 399000 -- (-1304.254) [-1306.732] (-1307.690) (-1312.098) * (-1307.646) [-1301.637] (-1306.887) (-1305.245) -- 0:00:45 399500 -- (-1305.008) (-1310.499) [-1304.996] (-1310.414) * (-1304.614) [-1304.221] (-1309.233) (-1303.854) -- 0:00:45 400000 -- (-1307.337) [-1309.004] (-1304.434) (-1309.174) * (-1304.513) [-1304.133] (-1310.108) (-1304.757) -- 0:00:44 Average standard deviation of split frequencies: 0.008309 400500 -- [-1304.777] (-1317.097) (-1304.895) (-1307.826) * [-1303.791] (-1308.646) (-1308.701) (-1312.749) -- 0:00:44 401000 -- [-1304.388] (-1313.648) (-1309.115) (-1309.913) * (-1302.261) [-1306.156] (-1307.693) (-1302.586) -- 0:00:44 401500 -- (-1305.281) [-1308.154] (-1309.978) (-1313.831) * (-1304.401) [-1302.636] (-1314.322) (-1305.820) -- 0:00:44 402000 -- (-1308.733) (-1308.284) (-1307.988) [-1313.531] * [-1310.755] (-1304.578) (-1314.949) (-1305.209) -- 0:00:44 402500 -- [-1305.994] (-1310.975) (-1309.411) (-1313.151) * [-1305.956] (-1308.035) (-1314.925) (-1306.936) -- 0:00:44 403000 -- [-1303.142] (-1309.529) (-1303.338) (-1309.905) * (-1305.721) [-1304.593] (-1309.170) (-1311.092) -- 0:00:44 403500 -- (-1306.770) (-1308.129) (-1307.560) [-1309.748] * (-1307.081) (-1303.504) (-1308.599) [-1302.707] -- 0:00:44 404000 -- (-1306.034) [-1306.461] (-1303.644) (-1308.994) * (-1307.747) (-1302.770) [-1305.372] (-1308.589) -- 0:00:44 404500 -- (-1308.204) (-1305.652) [-1303.384] (-1308.341) * [-1307.465] (-1309.467) (-1304.890) (-1311.565) -- 0:00:44 405000 -- (-1308.578) [-1303.794] (-1308.312) (-1309.615) * (-1307.182) (-1309.734) [-1303.623] (-1309.636) -- 0:00:44 Average standard deviation of split frequencies: 0.008636 405500 -- [-1308.040] (-1308.708) (-1309.165) (-1309.889) * (-1301.442) [-1305.644] (-1305.265) (-1308.844) -- 0:00:43 406000 -- (-1307.157) (-1307.486) [-1309.002] (-1313.118) * (-1306.453) (-1309.856) (-1302.549) [-1306.609] -- 0:00:43 406500 -- (-1311.171) (-1304.284) [-1311.580] (-1308.702) * [-1306.841] (-1308.903) (-1303.393) (-1308.319) -- 0:00:43 407000 -- (-1307.034) [-1306.334] (-1307.240) (-1314.312) * [-1306.385] (-1306.896) (-1303.058) (-1310.031) -- 0:00:43 407500 -- (-1305.175) [-1305.279] (-1308.437) (-1307.416) * (-1307.477) (-1306.489) [-1304.457] (-1310.177) -- 0:00:43 408000 -- (-1304.444) (-1307.315) (-1302.735) [-1307.767] * (-1305.761) (-1304.762) [-1305.153] (-1304.176) -- 0:00:43 408500 -- (-1303.599) (-1303.859) [-1306.259] (-1308.721) * (-1306.927) (-1304.438) [-1307.258] (-1307.039) -- 0:00:43 409000 -- (-1304.679) (-1305.904) (-1310.357) [-1308.635] * [-1305.784] (-1306.979) (-1306.105) (-1314.300) -- 0:00:43 409500 -- [-1302.602] (-1307.173) (-1309.525) (-1306.491) * [-1304.428] (-1304.403) (-1308.444) (-1307.799) -- 0:00:43 410000 -- (-1308.084) [-1303.834] (-1309.056) (-1306.849) * (-1304.982) (-1307.965) (-1307.022) [-1306.417] -- 0:00:43 Average standard deviation of split frequencies: 0.007820 410500 -- (-1304.897) (-1309.111) [-1307.536] (-1308.508) * (-1308.928) (-1305.382) [-1304.487] (-1306.696) -- 0:00:43 411000 -- (-1307.511) (-1311.869) [-1304.668] (-1306.998) * (-1309.485) (-1306.397) (-1306.695) [-1308.883] -- 0:00:42 411500 -- [-1303.562] (-1305.409) (-1309.620) (-1311.612) * (-1307.503) (-1307.608) [-1302.105] (-1305.249) -- 0:00:42 412000 -- (-1306.603) [-1304.717] (-1308.070) (-1307.093) * [-1303.847] (-1308.980) (-1303.908) (-1310.025) -- 0:00:44 412500 -- [-1301.770] (-1303.698) (-1305.657) (-1308.274) * (-1305.822) [-1309.546] (-1306.739) (-1307.262) -- 0:00:44 413000 -- [-1303.124] (-1309.146) (-1308.654) (-1311.038) * (-1310.726) (-1310.600) [-1302.777] (-1309.275) -- 0:00:44 413500 -- (-1305.932) [-1304.217] (-1304.723) (-1307.833) * [-1304.465] (-1308.614) (-1312.279) (-1302.526) -- 0:00:43 414000 -- (-1308.894) (-1307.757) (-1306.754) [-1308.225] * [-1305.722] (-1308.801) (-1311.222) (-1309.116) -- 0:00:43 414500 -- (-1304.714) (-1307.340) [-1306.343] (-1307.819) * [-1306.838] (-1309.300) (-1303.141) (-1306.089) -- 0:00:43 415000 -- [-1302.952] (-1308.442) (-1309.183) (-1307.697) * (-1305.583) (-1309.644) [-1303.848] (-1307.499) -- 0:00:43 Average standard deviation of split frequencies: 0.008357 415500 -- (-1310.234) (-1307.213) (-1307.706) [-1312.118] * (-1312.037) (-1306.855) [-1304.967] (-1306.205) -- 0:00:43 416000 -- (-1306.686) (-1303.526) [-1304.683] (-1307.368) * [-1310.007] (-1305.282) (-1303.419) (-1305.765) -- 0:00:43 416500 -- (-1308.639) [-1307.917] (-1307.947) (-1307.374) * [-1304.797] (-1307.720) (-1306.348) (-1305.646) -- 0:00:43 417000 -- (-1312.140) [-1306.941] (-1311.937) (-1313.523) * (-1308.388) [-1307.095] (-1306.034) (-1307.301) -- 0:00:43 417500 -- (-1304.665) [-1308.262] (-1305.218) (-1311.997) * (-1309.212) (-1310.786) [-1306.548] (-1305.493) -- 0:00:43 418000 -- (-1313.171) (-1307.198) (-1307.311) [-1312.413] * [-1305.853] (-1307.743) (-1309.504) (-1307.225) -- 0:00:43 418500 -- (-1309.185) [-1309.311] (-1306.477) (-1309.735) * (-1307.392) (-1306.707) [-1308.085] (-1307.504) -- 0:00:43 419000 -- (-1311.016) (-1303.873) (-1308.075) [-1306.526] * (-1311.975) (-1307.441) (-1305.992) [-1302.037] -- 0:00:42 419500 -- (-1315.782) (-1307.722) (-1312.443) [-1304.767] * (-1306.057) (-1309.208) (-1304.350) [-1304.762] -- 0:00:42 420000 -- (-1313.001) (-1313.974) [-1309.095] (-1310.165) * [-1310.293] (-1305.437) (-1307.113) (-1306.559) -- 0:00:42 Average standard deviation of split frequencies: 0.008054 420500 -- (-1306.987) [-1306.174] (-1308.307) (-1305.192) * (-1308.063) (-1307.379) (-1307.844) [-1308.024] -- 0:00:42 421000 -- [-1306.416] (-1309.587) (-1306.140) (-1307.897) * (-1309.433) (-1307.317) [-1301.536] (-1307.896) -- 0:00:42 421500 -- [-1304.893] (-1309.715) (-1304.703) (-1307.972) * [-1308.928] (-1307.399) (-1306.209) (-1308.048) -- 0:00:42 422000 -- (-1309.168) (-1304.925) [-1309.085] (-1307.447) * (-1305.952) (-1309.353) (-1302.987) [-1307.856] -- 0:00:42 422500 -- [-1310.487] (-1305.773) (-1308.095) (-1309.813) * (-1306.379) (-1308.012) [-1305.871] (-1308.621) -- 0:00:42 423000 -- (-1309.264) (-1306.429) [-1304.564] (-1307.852) * (-1305.529) [-1308.185] (-1303.466) (-1308.843) -- 0:00:42 423500 -- (-1309.574) (-1306.136) (-1306.493) [-1308.986] * (-1308.848) (-1308.720) [-1303.133] (-1309.941) -- 0:00:42 424000 -- [-1302.532] (-1308.261) (-1308.432) (-1309.038) * [-1306.667] (-1308.309) (-1310.570) (-1307.530) -- 0:00:42 424500 -- (-1314.486) (-1306.671) [-1306.748] (-1308.420) * (-1307.089) (-1306.056) [-1305.875] (-1303.691) -- 0:00:42 425000 -- [-1305.088] (-1307.160) (-1303.818) (-1308.400) * (-1305.937) (-1308.743) (-1305.716) [-1303.481] -- 0:00:41 Average standard deviation of split frequencies: 0.008161 425500 -- [-1305.975] (-1306.012) (-1306.369) (-1310.654) * (-1309.776) (-1304.831) [-1304.932] (-1308.438) -- 0:00:41 426000 -- (-1308.112) (-1307.255) [-1309.386] (-1311.633) * (-1308.806) [-1303.371] (-1306.905) (-1310.877) -- 0:00:43 426500 -- (-1307.751) (-1306.946) [-1308.152] (-1310.349) * (-1307.356) (-1306.406) (-1311.000) [-1304.782] -- 0:00:43 427000 -- (-1309.960) [-1310.213] (-1306.964) (-1314.871) * (-1306.101) [-1303.835] (-1313.792) (-1305.309) -- 0:00:42 427500 -- (-1304.830) [-1306.075] (-1306.086) (-1312.322) * (-1307.506) (-1303.751) (-1303.978) [-1304.434] -- 0:00:42 428000 -- (-1306.149) (-1305.240) [-1306.504] (-1309.152) * [-1307.858] (-1307.853) (-1304.288) (-1304.820) -- 0:00:42 428500 -- (-1305.145) [-1305.865] (-1311.143) (-1311.338) * (-1307.671) (-1307.233) (-1306.519) [-1307.152] -- 0:00:42 429000 -- (-1303.711) [-1307.637] (-1305.892) (-1309.264) * (-1308.075) (-1307.426) (-1308.633) [-1305.046] -- 0:00:42 429500 -- (-1303.753) (-1310.076) (-1304.038) [-1309.436] * (-1307.733) (-1304.224) (-1306.366) [-1306.714] -- 0:00:42 430000 -- [-1305.060] (-1303.973) (-1309.650) (-1308.739) * [-1307.718] (-1304.788) (-1304.121) (-1306.064) -- 0:00:42 Average standard deviation of split frequencies: 0.008209 430500 -- [-1309.634] (-1309.141) (-1310.113) (-1308.521) * (-1310.141) [-1306.382] (-1306.974) (-1304.698) -- 0:00:42 431000 -- (-1307.330) (-1307.811) (-1311.362) [-1307.574] * (-1305.161) (-1309.626) (-1305.534) [-1304.469] -- 0:00:42 431500 -- (-1306.998) [-1303.638] (-1309.267) (-1307.981) * (-1306.262) (-1305.535) (-1304.901) [-1305.455] -- 0:00:42 432000 -- (-1310.237) (-1307.654) (-1311.904) [-1309.722] * (-1305.359) (-1309.602) (-1306.571) [-1305.488] -- 0:00:42 432500 -- (-1307.669) [-1307.827] (-1310.253) (-1310.336) * (-1308.311) [-1305.801] (-1305.815) (-1305.438) -- 0:00:41 433000 -- [-1306.004] (-1304.019) (-1303.540) (-1313.114) * (-1311.308) [-1306.499] (-1307.259) (-1309.351) -- 0:00:41 433500 -- [-1305.890] (-1305.356) (-1306.594) (-1311.907) * (-1308.486) (-1307.266) (-1304.376) [-1306.219] -- 0:00:41 434000 -- [-1305.791] (-1308.284) (-1310.597) (-1309.761) * (-1306.318) (-1305.129) (-1306.042) [-1310.297] -- 0:00:41 434500 -- (-1307.284) [-1303.452] (-1305.839) (-1311.317) * (-1305.435) [-1306.358] (-1308.402) (-1309.746) -- 0:00:41 435000 -- [-1307.213] (-1303.301) (-1309.862) (-1309.851) * (-1306.405) [-1308.027] (-1303.619) (-1311.443) -- 0:00:41 Average standard deviation of split frequencies: 0.007713 435500 -- [-1305.424] (-1308.502) (-1304.745) (-1306.372) * (-1307.175) (-1305.745) [-1305.834] (-1308.390) -- 0:00:41 436000 -- [-1304.573] (-1304.691) (-1307.934) (-1306.912) * (-1306.883) (-1303.930) (-1304.698) [-1306.366] -- 0:00:41 436500 -- (-1305.462) (-1306.932) (-1308.652) [-1302.620] * (-1305.952) [-1306.467] (-1307.429) (-1309.406) -- 0:00:41 437000 -- (-1307.870) (-1305.731) [-1305.276] (-1306.383) * (-1308.620) (-1308.731) [-1306.325] (-1307.411) -- 0:00:41 437500 -- (-1303.941) (-1305.524) (-1304.552) [-1308.785] * (-1307.773) (-1304.712) [-1306.664] (-1308.490) -- 0:00:41 438000 -- (-1308.462) [-1305.399] (-1307.937) (-1306.103) * [-1311.471] (-1312.095) (-1303.864) (-1315.653) -- 0:00:41 438500 -- (-1305.876) (-1308.825) [-1303.360] (-1303.722) * (-1309.058) [-1307.210] (-1303.878) (-1314.210) -- 0:00:40 439000 -- (-1309.026) (-1308.341) (-1304.287) [-1309.770] * (-1307.324) [-1307.064] (-1304.684) (-1311.584) -- 0:00:40 439500 -- (-1302.382) [-1303.345] (-1308.009) (-1307.988) * [-1307.954] (-1314.485) (-1306.406) (-1308.167) -- 0:00:40 440000 -- (-1302.685) (-1306.925) [-1303.991] (-1304.371) * [-1306.766] (-1308.461) (-1304.430) (-1309.455) -- 0:00:40 Average standard deviation of split frequencies: 0.007916 440500 -- (-1305.977) [-1304.594] (-1310.595) (-1309.155) * (-1307.392) [-1307.445] (-1308.605) (-1307.289) -- 0:00:41 441000 -- (-1310.151) (-1307.310) [-1304.727] (-1314.797) * (-1307.002) [-1306.484] (-1304.227) (-1306.846) -- 0:00:41 441500 -- [-1303.912] (-1310.815) (-1307.647) (-1314.995) * [-1307.440] (-1309.135) (-1305.049) (-1306.902) -- 0:00:41 442000 -- [-1306.442] (-1312.515) (-1312.047) (-1303.537) * [-1309.196] (-1309.641) (-1311.077) (-1305.895) -- 0:00:41 442500 -- (-1308.957) (-1310.575) (-1308.792) [-1307.343] * [-1307.267] (-1308.616) (-1307.130) (-1306.456) -- 0:00:41 443000 -- (-1307.795) (-1313.266) [-1310.815] (-1307.666) * (-1307.178) [-1306.606] (-1303.517) (-1309.830) -- 0:00:41 443500 -- (-1304.195) [-1307.478] (-1314.533) (-1306.868) * (-1309.155) [-1309.433] (-1308.968) (-1304.473) -- 0:00:41 444000 -- (-1303.672) (-1306.806) (-1308.563) [-1312.698] * (-1307.501) (-1309.269) [-1309.868] (-1305.261) -- 0:00:41 444500 -- (-1305.779) (-1309.219) (-1314.220) [-1305.036] * (-1306.859) (-1307.732) (-1308.307) [-1307.476] -- 0:00:41 445000 -- (-1303.423) (-1305.848) (-1307.960) [-1313.273] * (-1307.125) (-1312.165) (-1308.456) [-1302.698] -- 0:00:41 Average standard deviation of split frequencies: 0.008191 445500 -- (-1306.022) (-1306.430) (-1307.017) [-1310.067] * (-1302.619) [-1307.419] (-1309.048) (-1302.587) -- 0:00:41 446000 -- (-1305.292) [-1305.760] (-1311.222) (-1306.284) * (-1307.323) [-1306.709] (-1310.294) (-1303.312) -- 0:00:40 446500 -- (-1305.042) (-1308.203) [-1308.796] (-1305.470) * [-1309.951] (-1310.201) (-1310.191) (-1304.009) -- 0:00:40 447000 -- (-1311.964) [-1306.443] (-1310.804) (-1309.042) * (-1308.248) (-1311.662) (-1308.973) [-1304.264] -- 0:00:40 447500 -- (-1308.099) (-1305.828) [-1304.859] (-1309.961) * (-1307.786) [-1308.712] (-1311.979) (-1304.492) -- 0:00:40 448000 -- (-1301.620) (-1312.229) (-1308.051) [-1305.547] * (-1313.961) (-1308.808) (-1309.327) [-1304.804] -- 0:00:40 448500 -- [-1308.926] (-1307.395) (-1313.491) (-1307.121) * (-1304.639) (-1308.305) (-1306.848) [-1303.512] -- 0:00:40 449000 -- (-1306.578) [-1309.390] (-1309.398) (-1306.476) * (-1305.643) (-1305.705) [-1304.881] (-1307.436) -- 0:00:40 449500 -- (-1305.134) [-1306.000] (-1309.005) (-1306.209) * [-1309.041] (-1304.254) (-1309.927) (-1303.279) -- 0:00:40 450000 -- [-1306.542] (-1308.682) (-1315.492) (-1307.063) * (-1307.410) (-1307.297) (-1307.429) [-1306.537] -- 0:00:40 Average standard deviation of split frequencies: 0.007741 450500 -- [-1305.730] (-1305.716) (-1309.284) (-1307.009) * (-1306.669) (-1307.159) (-1309.825) [-1304.344] -- 0:00:40 451000 -- (-1305.767) (-1307.473) (-1308.055) [-1305.628] * (-1307.286) (-1307.779) [-1304.272] (-1307.614) -- 0:00:40 451500 -- (-1305.101) (-1307.333) [-1303.756] (-1305.505) * [-1306.681] (-1307.661) (-1304.240) (-1305.585) -- 0:00:40 452000 -- (-1308.545) [-1302.821] (-1305.552) (-1306.369) * (-1309.190) (-1312.272) [-1305.245] (-1306.577) -- 0:00:40 452500 -- (-1310.427) (-1302.869) (-1307.081) [-1307.567] * (-1307.844) (-1313.229) (-1303.195) [-1307.048] -- 0:00:39 453000 -- (-1306.153) [-1307.733] (-1306.158) (-1307.629) * (-1309.150) (-1308.900) [-1304.369] (-1308.114) -- 0:00:39 453500 -- [-1303.565] (-1306.027) (-1308.406) (-1307.245) * [-1304.519] (-1306.593) (-1302.520) (-1307.806) -- 0:00:39 454000 -- [-1306.225] (-1310.831) (-1307.781) (-1305.373) * (-1304.671) [-1310.906] (-1304.883) (-1305.169) -- 0:00:39 454500 -- [-1303.704] (-1309.991) (-1303.734) (-1306.595) * (-1304.198) (-1310.925) [-1308.119] (-1303.166) -- 0:00:40 455000 -- (-1305.764) (-1304.384) (-1304.148) [-1305.712] * (-1306.192) (-1306.637) (-1308.579) [-1305.761] -- 0:00:40 Average standard deviation of split frequencies: 0.008063 455500 -- (-1306.407) (-1309.654) (-1309.857) [-1305.214] * [-1309.310] (-1308.367) (-1310.232) (-1306.452) -- 0:00:40 456000 -- [-1304.570] (-1308.957) (-1307.092) (-1307.226) * (-1307.067) (-1309.592) (-1309.836) [-1309.514] -- 0:00:40 456500 -- (-1302.362) (-1305.240) (-1307.943) [-1307.720] * (-1306.024) [-1306.599] (-1310.692) (-1309.899) -- 0:00:40 457000 -- (-1311.507) (-1306.099) [-1307.516] (-1304.150) * [-1307.049] (-1305.508) (-1310.205) (-1303.149) -- 0:00:40 457500 -- (-1306.275) (-1310.411) (-1305.707) [-1305.455] * (-1311.459) [-1307.368] (-1311.177) (-1308.621) -- 0:00:40 458000 -- (-1306.414) [-1313.413] (-1308.328) (-1309.799) * (-1307.630) (-1302.703) [-1303.693] (-1306.926) -- 0:00:40 458500 -- (-1309.667) (-1306.447) [-1305.309] (-1303.413) * (-1311.943) (-1308.667) [-1307.301] (-1304.895) -- 0:00:40 459000 -- (-1308.270) (-1304.036) (-1304.898) [-1306.173] * (-1312.954) [-1305.793] (-1305.906) (-1303.617) -- 0:00:40 459500 -- (-1309.741) (-1311.213) [-1309.497] (-1308.138) * (-1308.698) (-1307.887) (-1306.772) [-1304.193] -- 0:00:39 460000 -- (-1314.967) (-1308.645) (-1306.734) [-1305.489] * (-1305.075) (-1306.549) [-1305.272] (-1304.502) -- 0:00:39 Average standard deviation of split frequencies: 0.008050 460500 -- (-1311.874) [-1310.100] (-1303.977) (-1304.654) * (-1311.804) [-1308.992] (-1308.827) (-1306.864) -- 0:00:39 461000 -- [-1307.514] (-1313.713) (-1304.635) (-1304.709) * [-1308.592] (-1304.510) (-1306.893) (-1307.983) -- 0:00:39 461500 -- (-1306.750) (-1310.607) (-1307.758) [-1303.681] * (-1302.304) (-1308.687) (-1305.988) [-1311.288] -- 0:00:39 462000 -- (-1310.536) (-1310.907) [-1308.634] (-1304.736) * [-1302.914] (-1305.337) (-1308.217) (-1306.749) -- 0:00:39 462500 -- [-1307.330] (-1307.285) (-1308.285) (-1306.629) * (-1305.490) (-1303.416) [-1305.973] (-1310.484) -- 0:00:39 463000 -- (-1307.579) (-1315.328) (-1313.682) [-1311.220] * (-1311.416) [-1303.436] (-1304.723) (-1306.673) -- 0:00:39 463500 -- (-1306.467) (-1309.057) [-1311.979] (-1304.976) * (-1312.722) (-1304.716) (-1309.301) [-1305.881] -- 0:00:39 464000 -- (-1304.952) (-1305.300) (-1305.011) [-1306.828] * (-1306.872) (-1302.602) (-1305.008) [-1308.337] -- 0:00:39 464500 -- [-1304.741] (-1306.449) (-1308.968) (-1304.508) * [-1306.776] (-1306.378) (-1307.888) (-1306.814) -- 0:00:39 465000 -- [-1305.654] (-1305.167) (-1315.406) (-1309.474) * (-1307.646) (-1307.277) (-1308.523) [-1305.215] -- 0:00:39 Average standard deviation of split frequencies: 0.007621 465500 -- [-1303.821] (-1307.636) (-1308.136) (-1308.764) * (-1306.319) [-1303.586] (-1311.143) (-1304.505) -- 0:00:39 466000 -- [-1307.128] (-1308.364) (-1308.288) (-1309.294) * (-1303.826) [-1303.128] (-1309.089) (-1307.417) -- 0:00:38 466500 -- (-1308.038) [-1309.004] (-1309.473) (-1306.128) * (-1309.952) [-1308.887] (-1312.333) (-1308.994) -- 0:00:38 467000 -- (-1303.072) (-1304.100) (-1310.418) [-1310.721] * (-1308.618) (-1311.827) [-1309.194] (-1313.027) -- 0:00:38 467500 -- (-1307.315) (-1307.826) [-1306.354] (-1308.489) * [-1304.625] (-1306.864) (-1310.413) (-1304.568) -- 0:00:38 468000 -- (-1304.124) (-1311.948) [-1306.397] (-1305.435) * (-1309.706) (-1307.685) (-1305.619) [-1304.772] -- 0:00:38 468500 -- (-1305.599) (-1308.680) [-1305.999] (-1311.872) * [-1311.251] (-1305.674) (-1305.527) (-1303.326) -- 0:00:39 469000 -- (-1306.815) (-1307.271) [-1306.133] (-1304.519) * (-1310.200) (-1310.077) [-1306.280] (-1305.348) -- 0:00:39 469500 -- [-1302.242] (-1308.812) (-1308.361) (-1302.922) * (-1309.741) [-1306.206] (-1305.745) (-1309.744) -- 0:00:39 470000 -- [-1303.628] (-1307.885) (-1304.654) (-1307.237) * [-1308.718] (-1314.058) (-1307.006) (-1311.743) -- 0:00:39 Average standard deviation of split frequencies: 0.008079 470500 -- (-1309.044) [-1306.915] (-1305.056) (-1305.119) * (-1308.678) (-1310.446) (-1307.270) [-1303.449] -- 0:00:39 471000 -- [-1303.745] (-1306.243) (-1305.044) (-1310.097) * [-1304.599] (-1305.962) (-1308.621) (-1304.513) -- 0:00:39 471500 -- (-1304.393) [-1303.868] (-1306.523) (-1309.587) * (-1307.039) (-1307.134) [-1307.724] (-1306.407) -- 0:00:39 472000 -- (-1303.750) (-1308.689) [-1302.827] (-1304.940) * (-1307.264) [-1304.993] (-1305.529) (-1306.938) -- 0:00:39 472500 -- (-1311.081) [-1312.581] (-1306.779) (-1309.367) * (-1306.845) (-1304.134) (-1305.854) [-1307.241] -- 0:00:39 473000 -- (-1304.464) (-1311.707) [-1304.373] (-1307.914) * (-1307.719) [-1306.877] (-1307.365) (-1305.707) -- 0:00:38 473500 -- (-1305.501) (-1309.178) (-1310.642) [-1308.548] * (-1304.979) (-1308.114) [-1305.509] (-1313.284) -- 0:00:38 474000 -- (-1307.996) (-1308.681) [-1311.978] (-1307.744) * (-1308.590) (-1304.851) [-1305.720] (-1306.310) -- 0:00:38 474500 -- (-1304.515) (-1308.774) [-1304.815] (-1310.017) * [-1306.343] (-1306.523) (-1304.891) (-1304.934) -- 0:00:38 475000 -- (-1309.307) (-1309.385) [-1307.015] (-1307.030) * (-1313.158) (-1304.202) [-1303.464] (-1304.919) -- 0:00:38 Average standard deviation of split frequencies: 0.007329 475500 -- (-1306.473) (-1308.790) (-1303.616) [-1310.058] * (-1307.401) (-1308.072) (-1302.900) [-1307.368] -- 0:00:38 476000 -- (-1307.323) (-1311.472) (-1306.052) [-1307.620] * (-1310.531) (-1305.329) (-1305.438) [-1308.703] -- 0:00:38 476500 -- (-1306.039) (-1313.857) [-1305.549] (-1309.525) * (-1303.823) (-1305.004) (-1305.177) [-1308.602] -- 0:00:38 477000 -- (-1306.045) (-1309.201) [-1305.522] (-1305.786) * [-1306.124] (-1309.111) (-1307.724) (-1305.126) -- 0:00:38 477500 -- [-1304.680] (-1309.177) (-1305.203) (-1305.124) * [-1302.922] (-1309.088) (-1302.488) (-1306.246) -- 0:00:38 478000 -- (-1307.227) (-1307.823) [-1301.889] (-1305.068) * (-1304.639) (-1314.688) (-1307.816) [-1306.870] -- 0:00:38 478500 -- [-1308.254] (-1303.682) (-1305.077) (-1304.989) * [-1302.622] (-1304.956) (-1308.640) (-1311.969) -- 0:00:38 479000 -- [-1303.938] (-1309.949) (-1309.613) (-1306.230) * (-1304.374) (-1305.897) (-1309.965) [-1308.315] -- 0:00:38 479500 -- (-1306.659) (-1311.685) (-1306.090) [-1305.128] * (-1305.760) (-1306.012) [-1308.020] (-1311.386) -- 0:00:37 480000 -- (-1308.033) (-1309.030) (-1302.124) [-1303.948] * (-1303.852) [-1304.395] (-1308.910) (-1302.738) -- 0:00:37 Average standard deviation of split frequencies: 0.006538 480500 -- [-1306.154] (-1309.716) (-1303.437) (-1304.399) * [-1302.913] (-1307.803) (-1307.102) (-1305.185) -- 0:00:37 481000 -- (-1309.131) (-1309.311) (-1306.237) [-1304.382] * (-1309.737) (-1308.278) (-1305.559) [-1306.151] -- 0:00:37 481500 -- (-1308.156) (-1307.844) (-1306.738) [-1301.438] * (-1310.596) [-1308.481] (-1307.308) (-1307.928) -- 0:00:37 482000 -- (-1305.491) (-1304.904) (-1305.820) [-1304.524] * [-1305.810] (-1307.970) (-1309.990) (-1302.661) -- 0:00:37 482500 -- (-1311.585) (-1305.530) (-1304.423) [-1303.132] * (-1308.920) [-1308.315] (-1304.201) (-1303.575) -- 0:00:37 483000 -- (-1307.531) (-1310.938) [-1304.708] (-1305.497) * [-1303.853] (-1308.090) (-1307.978) (-1305.165) -- 0:00:38 483500 -- (-1306.142) (-1307.246) (-1308.639) [-1303.241] * (-1306.920) (-1309.591) [-1305.724] (-1306.011) -- 0:00:38 484000 -- (-1304.603) (-1305.530) [-1302.461] (-1305.162) * (-1308.299) (-1310.102) (-1304.444) [-1311.147] -- 0:00:38 484500 -- (-1305.404) (-1307.747) (-1303.461) [-1305.246] * (-1306.311) (-1307.709) (-1306.355) [-1302.643] -- 0:00:38 485000 -- [-1306.365] (-1309.308) (-1304.375) (-1306.737) * (-1305.894) (-1311.397) [-1303.784] (-1304.833) -- 0:00:38 Average standard deviation of split frequencies: 0.006919 485500 -- (-1308.438) (-1309.378) [-1304.022] (-1308.178) * (-1309.800) (-1309.352) [-1304.782] (-1307.901) -- 0:00:38 486000 -- (-1308.540) (-1306.216) [-1305.457] (-1306.748) * (-1310.155) (-1310.435) (-1303.925) [-1305.287] -- 0:00:38 486500 -- [-1307.894] (-1303.744) (-1305.436) (-1304.829) * [-1307.195] (-1310.475) (-1306.533) (-1305.016) -- 0:00:37 487000 -- (-1302.183) (-1309.380) [-1309.197] (-1306.348) * (-1307.753) (-1314.695) [-1302.170] (-1310.892) -- 0:00:37 487500 -- [-1310.403] (-1304.459) (-1307.396) (-1308.753) * (-1304.387) [-1308.869] (-1306.262) (-1313.631) -- 0:00:37 488000 -- [-1309.146] (-1304.153) (-1311.090) (-1306.981) * [-1306.103] (-1311.857) (-1306.796) (-1308.078) -- 0:00:37 488500 -- (-1307.370) (-1311.579) (-1307.512) [-1307.064] * (-1302.814) (-1306.934) (-1307.079) [-1305.525] -- 0:00:37 489000 -- (-1306.961) [-1306.083] (-1310.078) (-1307.756) * (-1306.727) (-1306.829) [-1306.204] (-1306.139) -- 0:00:37 489500 -- [-1305.700] (-1304.739) (-1309.404) (-1311.508) * (-1305.005) (-1309.494) [-1306.828] (-1304.363) -- 0:00:37 490000 -- (-1305.592) [-1305.254] (-1310.646) (-1311.146) * (-1305.000) [-1307.378] (-1308.046) (-1306.084) -- 0:00:37 Average standard deviation of split frequencies: 0.006725 490500 -- (-1308.048) [-1304.523] (-1307.893) (-1305.328) * (-1303.809) (-1311.337) (-1309.367) [-1303.875] -- 0:00:37 491000 -- (-1312.005) (-1309.783) (-1307.745) [-1305.348] * [-1302.827] (-1307.895) (-1305.271) (-1306.097) -- 0:00:37 491500 -- (-1303.901) (-1305.770) (-1305.050) [-1304.364] * (-1304.185) [-1306.986] (-1304.035) (-1304.034) -- 0:00:37 492000 -- (-1307.021) (-1305.643) (-1308.668) [-1305.890] * (-1306.862) (-1305.392) (-1310.974) [-1306.433] -- 0:00:37 492500 -- (-1306.213) (-1305.051) (-1306.162) [-1305.965] * (-1303.984) (-1306.002) (-1305.979) [-1306.340] -- 0:00:37 493000 -- [-1305.762] (-1306.187) (-1305.816) (-1308.678) * (-1306.014) (-1304.466) [-1302.853] (-1305.967) -- 0:00:37 493500 -- (-1304.264) (-1308.689) [-1305.303] (-1308.541) * (-1302.414) (-1304.020) (-1305.600) [-1308.671] -- 0:00:36 494000 -- (-1306.570) (-1303.738) (-1305.331) [-1303.014] * (-1305.957) (-1309.829) [-1306.045] (-1306.481) -- 0:00:36 494500 -- [-1304.588] (-1306.916) (-1311.351) (-1304.298) * (-1307.558) (-1303.771) [-1306.884] (-1307.573) -- 0:00:36 495000 -- (-1306.024) [-1302.636] (-1308.305) (-1307.840) * [-1305.463] (-1305.258) (-1307.685) (-1305.739) -- 0:00:36 Average standard deviation of split frequencies: 0.007128 495500 -- (-1309.043) [-1305.615] (-1302.531) (-1306.710) * (-1309.315) [-1307.483] (-1304.789) (-1311.315) -- 0:00:36 496000 -- [-1306.753] (-1307.547) (-1305.796) (-1305.581) * (-1305.392) [-1305.086] (-1308.775) (-1309.370) -- 0:00:36 496500 -- [-1303.329] (-1306.349) (-1304.299) (-1309.383) * (-1303.297) [-1305.410] (-1306.218) (-1310.883) -- 0:00:36 497000 -- (-1306.811) [-1306.568] (-1303.413) (-1309.515) * [-1303.004] (-1306.974) (-1309.333) (-1306.100) -- 0:00:37 497500 -- (-1307.785) (-1307.657) [-1308.954] (-1308.162) * [-1302.512] (-1306.686) (-1310.926) (-1305.670) -- 0:00:37 498000 -- (-1309.736) (-1310.660) [-1305.987] (-1308.184) * (-1304.660) (-1303.823) [-1307.413] (-1308.297) -- 0:00:37 498500 -- (-1309.226) (-1309.899) [-1308.258] (-1307.215) * [-1302.217] (-1307.682) (-1309.034) (-1307.770) -- 0:00:37 499000 -- (-1306.371) (-1308.379) (-1306.521) [-1304.707] * [-1304.108] (-1304.405) (-1307.475) (-1307.648) -- 0:00:37 499500 -- (-1307.052) (-1310.728) (-1303.931) [-1310.971] * [-1300.724] (-1308.083) (-1304.884) (-1307.466) -- 0:00:37 500000 -- (-1308.742) (-1313.148) (-1301.149) [-1304.290] * (-1311.390) (-1306.108) (-1304.471) [-1308.363] -- 0:00:37 Average standard deviation of split frequencies: 0.006650 500500 -- (-1306.986) (-1304.064) [-1305.124] (-1306.769) * [-1307.599] (-1308.871) (-1309.247) (-1308.445) -- 0:00:36 501000 -- (-1304.196) (-1304.203) (-1305.620) [-1306.587] * [-1310.865] (-1304.919) (-1310.368) (-1307.437) -- 0:00:36 501500 -- (-1309.475) [-1304.609] (-1303.689) (-1310.246) * [-1304.155] (-1304.066) (-1308.117) (-1310.832) -- 0:00:36 502000 -- (-1311.145) (-1304.158) (-1307.571) [-1303.484] * [-1303.828] (-1306.012) (-1309.649) (-1306.258) -- 0:00:36 502500 -- (-1304.526) [-1303.570] (-1302.316) (-1302.948) * (-1305.924) [-1310.938] (-1308.199) (-1309.826) -- 0:00:36 503000 -- [-1306.417] (-1306.569) (-1306.392) (-1310.017) * (-1309.628) [-1308.508] (-1315.194) (-1309.000) -- 0:00:36 503500 -- [-1311.042] (-1305.118) (-1306.291) (-1307.541) * [-1303.188] (-1305.726) (-1307.259) (-1308.847) -- 0:00:36 504000 -- (-1305.479) [-1303.119] (-1306.798) (-1308.385) * [-1304.030] (-1307.755) (-1309.645) (-1309.546) -- 0:00:36 504500 -- (-1306.191) [-1308.008] (-1305.331) (-1308.409) * [-1307.377] (-1305.749) (-1310.117) (-1311.572) -- 0:00:36 505000 -- [-1303.188] (-1305.588) (-1305.949) (-1304.424) * [-1305.050] (-1306.582) (-1307.827) (-1309.302) -- 0:00:36 Average standard deviation of split frequencies: 0.006638 505500 -- [-1309.192] (-1305.690) (-1309.522) (-1306.376) * (-1303.195) (-1306.497) [-1308.266] (-1310.614) -- 0:00:36 506000 -- (-1307.527) (-1307.038) [-1306.033] (-1305.642) * (-1302.746) (-1306.753) [-1305.857] (-1312.364) -- 0:00:36 506500 -- [-1306.593] (-1305.801) (-1304.745) (-1305.062) * [-1306.518] (-1306.552) (-1310.234) (-1309.200) -- 0:00:36 507000 -- [-1302.079] (-1306.189) (-1307.042) (-1309.276) * (-1305.854) [-1306.016] (-1307.036) (-1305.643) -- 0:00:35 507500 -- (-1305.784) (-1306.712) [-1305.650] (-1304.739) * [-1303.818] (-1307.342) (-1304.021) (-1306.604) -- 0:00:35 508000 -- (-1309.182) (-1306.056) [-1303.809] (-1304.149) * (-1306.049) (-1305.066) (-1310.653) [-1306.770] -- 0:00:35 508500 -- (-1309.416) (-1309.918) (-1308.485) [-1312.379] * [-1307.586] (-1305.728) (-1306.516) (-1313.475) -- 0:00:35 509000 -- (-1307.143) (-1304.079) [-1305.625] (-1308.302) * (-1303.941) (-1304.805) (-1307.986) [-1303.539] -- 0:00:35 509500 -- [-1311.744] (-1306.644) (-1310.056) (-1304.503) * (-1304.880) [-1304.914] (-1307.935) (-1307.372) -- 0:00:35 510000 -- (-1308.201) (-1308.293) [-1305.599] (-1313.427) * (-1307.649) (-1307.998) (-1312.012) [-1309.802] -- 0:00:36 Average standard deviation of split frequencies: 0.006346 510500 -- (-1308.616) (-1311.413) [-1305.049] (-1307.959) * (-1307.886) (-1308.203) [-1306.394] (-1306.347) -- 0:00:36 511000 -- [-1306.899] (-1305.653) (-1311.038) (-1307.331) * (-1305.618) [-1305.126] (-1304.843) (-1304.364) -- 0:00:36 511500 -- [-1307.036] (-1309.125) (-1307.839) (-1306.915) * [-1302.986] (-1304.712) (-1307.656) (-1308.180) -- 0:00:36 512000 -- (-1307.439) (-1313.402) (-1308.593) [-1303.864] * (-1307.652) (-1305.057) [-1306.016] (-1308.067) -- 0:00:36 512500 -- [-1305.945] (-1307.834) (-1310.222) (-1303.785) * (-1305.032) [-1303.120] (-1305.720) (-1308.903) -- 0:00:36 513000 -- (-1305.377) (-1311.122) [-1306.671] (-1306.764) * (-1307.891) [-1307.114] (-1303.504) (-1308.331) -- 0:00:36 513500 -- [-1307.189] (-1304.797) (-1306.898) (-1311.710) * (-1309.929) (-1308.654) (-1306.437) [-1307.759] -- 0:00:36 514000 -- [-1308.678] (-1306.752) (-1305.107) (-1309.735) * (-1310.608) [-1303.279] (-1309.920) (-1309.078) -- 0:00:35 514500 -- (-1308.240) (-1310.719) (-1308.279) [-1306.798] * (-1307.536) (-1305.429) (-1306.915) [-1305.262] -- 0:00:35 515000 -- (-1313.613) (-1310.117) (-1306.488) [-1307.786] * (-1305.920) [-1302.853] (-1307.435) (-1307.504) -- 0:00:35 Average standard deviation of split frequencies: 0.006338 515500 -- [-1308.508] (-1311.203) (-1306.081) (-1304.776) * (-1306.455) (-1309.343) (-1306.627) [-1308.307] -- 0:00:35 516000 -- [-1304.895] (-1308.976) (-1306.194) (-1302.160) * (-1312.583) (-1308.626) (-1308.569) [-1309.339] -- 0:00:35 516500 -- (-1312.421) (-1312.486) [-1305.632] (-1306.872) * (-1306.191) (-1305.367) (-1304.059) [-1305.239] -- 0:00:35 517000 -- (-1306.684) (-1307.747) (-1305.270) [-1304.775] * [-1305.781] (-1305.371) (-1304.155) (-1303.648) -- 0:00:35 517500 -- (-1308.584) [-1307.879] (-1313.119) (-1303.476) * (-1306.138) [-1302.530] (-1305.695) (-1304.693) -- 0:00:35 518000 -- [-1306.977] (-1314.363) (-1306.567) (-1301.522) * (-1303.865) (-1308.803) [-1307.930] (-1308.563) -- 0:00:35 518500 -- (-1305.535) (-1313.487) [-1305.588] (-1303.896) * (-1307.045) (-1306.815) (-1307.910) [-1303.010] -- 0:00:35 519000 -- (-1306.060) [-1309.548] (-1308.027) (-1307.321) * (-1305.673) (-1302.818) [-1311.198] (-1306.769) -- 0:00:35 519500 -- (-1310.080) [-1306.745] (-1305.571) (-1301.511) * [-1301.880] (-1307.094) (-1310.233) (-1310.999) -- 0:00:35 520000 -- (-1307.589) (-1309.688) [-1304.804] (-1305.042) * [-1302.715] (-1305.787) (-1303.091) (-1306.893) -- 0:00:35 Average standard deviation of split frequencies: 0.006451 520500 -- (-1307.186) (-1311.825) [-1306.011] (-1308.952) * (-1304.499) [-1303.853] (-1303.701) (-1306.016) -- 0:00:35 521000 -- [-1308.667] (-1313.748) (-1305.662) (-1303.747) * (-1303.438) (-1307.622) [-1303.314] (-1304.694) -- 0:00:34 521500 -- [-1306.750] (-1312.110) (-1309.719) (-1308.443) * (-1304.753) (-1305.450) [-1304.169] (-1307.997) -- 0:00:34 522000 -- (-1308.069) (-1312.705) (-1307.458) [-1306.495] * [-1303.308] (-1306.883) (-1301.648) (-1306.717) -- 0:00:34 522500 -- (-1307.577) (-1310.228) [-1306.220] (-1304.375) * (-1302.192) [-1306.235] (-1304.523) (-1303.291) -- 0:00:34 523000 -- (-1305.332) [-1304.496] (-1304.929) (-1305.481) * (-1309.002) (-1312.048) (-1309.231) [-1303.910] -- 0:00:34 523500 -- (-1306.885) (-1308.378) [-1307.987] (-1307.794) * [-1308.110] (-1308.242) (-1315.147) (-1309.347) -- 0:00:34 524000 -- (-1306.858) (-1308.509) (-1309.175) [-1306.869] * (-1309.830) (-1307.003) (-1304.398) [-1305.871] -- 0:00:35 524500 -- (-1305.337) (-1311.676) [-1309.170] (-1302.656) * (-1310.793) (-1307.695) [-1304.598] (-1307.597) -- 0:00:35 525000 -- (-1308.000) (-1310.681) [-1307.913] (-1303.168) * (-1308.893) (-1310.167) [-1303.789] (-1303.365) -- 0:00:35 Average standard deviation of split frequencies: 0.006441 525500 -- (-1308.675) [-1310.882] (-1308.833) (-1308.672) * (-1303.836) (-1307.073) (-1309.816) [-1307.587] -- 0:00:35 526000 -- (-1304.995) (-1314.026) (-1313.603) [-1301.274] * (-1304.834) (-1303.551) [-1306.382] (-1309.463) -- 0:00:35 526500 -- (-1308.713) (-1310.245) (-1313.606) [-1304.312] * (-1306.953) (-1309.711) [-1306.368] (-1308.036) -- 0:00:35 527000 -- (-1309.987) (-1308.072) (-1307.989) [-1307.349] * (-1304.438) [-1307.733] (-1303.782) (-1309.002) -- 0:00:35 527500 -- (-1304.912) (-1308.422) [-1303.489] (-1306.429) * (-1308.532) (-1305.566) (-1307.596) [-1304.417] -- 0:00:34 528000 -- [-1308.676] (-1307.677) (-1310.085) (-1308.204) * (-1307.592) (-1307.599) (-1311.341) [-1308.775] -- 0:00:34 528500 -- (-1307.568) (-1308.023) (-1303.876) [-1306.545] * (-1304.316) (-1306.062) [-1302.425] (-1310.992) -- 0:00:34 529000 -- [-1305.770] (-1308.783) (-1309.623) (-1308.401) * (-1310.742) [-1305.489] (-1304.932) (-1308.829) -- 0:00:34 529500 -- [-1311.289] (-1308.851) (-1310.701) (-1307.613) * (-1313.444) (-1307.355) [-1303.307] (-1303.637) -- 0:00:34 530000 -- (-1306.165) (-1310.682) (-1312.002) [-1305.398] * (-1307.848) (-1308.557) [-1304.070] (-1307.685) -- 0:00:34 Average standard deviation of split frequencies: 0.006551 530500 -- (-1306.359) (-1307.038) (-1308.499) [-1304.427] * (-1303.871) [-1303.916] (-1304.889) (-1306.409) -- 0:00:34 531000 -- [-1305.145] (-1310.556) (-1308.257) (-1305.797) * (-1306.703) (-1307.557) [-1304.728] (-1308.386) -- 0:00:34 531500 -- (-1303.333) (-1307.403) [-1304.026] (-1306.280) * (-1306.836) (-1307.239) (-1303.272) [-1304.429] -- 0:00:34 532000 -- (-1309.192) (-1305.618) (-1310.687) [-1308.424] * (-1313.203) (-1307.147) [-1306.594] (-1305.590) -- 0:00:34 532500 -- (-1308.326) [-1305.522] (-1310.257) (-1306.407) * (-1306.293) (-1308.904) [-1305.317] (-1306.798) -- 0:00:34 533000 -- (-1307.861) (-1305.130) [-1309.572] (-1304.116) * [-1306.133] (-1305.084) (-1306.684) (-1305.901) -- 0:00:34 533500 -- (-1308.372) [-1309.623] (-1306.203) (-1306.481) * (-1306.396) (-1308.595) (-1302.320) [-1303.807] -- 0:00:34 534000 -- [-1305.943] (-1309.897) (-1309.329) (-1305.808) * (-1309.935) [-1305.724] (-1309.377) (-1306.846) -- 0:00:34 534500 -- (-1307.184) [-1307.170] (-1311.285) (-1305.907) * (-1311.734) (-1308.682) (-1308.414) [-1308.165] -- 0:00:33 535000 -- [-1304.943] (-1305.593) (-1304.236) (-1309.574) * (-1307.387) [-1309.943] (-1306.776) (-1306.156) -- 0:00:33 Average standard deviation of split frequencies: 0.006871 535500 -- (-1309.919) (-1314.122) (-1307.102) [-1310.862] * [-1305.938] (-1306.928) (-1304.389) (-1309.562) -- 0:00:33 536000 -- (-1306.045) [-1311.705] (-1306.628) (-1307.898) * (-1307.084) [-1310.726] (-1303.789) (-1307.305) -- 0:00:33 536500 -- (-1304.674) (-1310.778) [-1306.024] (-1304.695) * (-1309.232) (-1307.909) [-1307.024] (-1304.854) -- 0:00:33 537000 -- [-1305.154] (-1310.706) (-1309.674) (-1315.289) * [-1303.548] (-1305.102) (-1305.262) (-1304.985) -- 0:00:33 537500 -- (-1306.119) (-1309.961) [-1305.593] (-1308.543) * (-1305.033) (-1303.779) (-1305.511) [-1309.689] -- 0:00:33 538000 -- [-1307.664] (-1310.156) (-1306.278) (-1307.885) * (-1307.238) (-1307.820) [-1306.810] (-1308.976) -- 0:00:34 538500 -- (-1307.760) [-1308.984] (-1306.291) (-1312.738) * [-1308.533] (-1304.721) (-1303.918) (-1306.190) -- 0:00:34 539000 -- [-1307.007] (-1307.560) (-1305.849) (-1305.112) * (-1303.243) (-1306.267) [-1303.270] (-1305.864) -- 0:00:34 539500 -- (-1309.865) (-1308.868) [-1304.065] (-1308.786) * (-1308.664) (-1304.891) (-1306.270) [-1303.820] -- 0:00:34 540000 -- (-1310.370) (-1308.074) [-1303.582] (-1303.212) * (-1308.004) [-1305.503] (-1303.577) (-1308.217) -- 0:00:34 Average standard deviation of split frequencies: 0.006859 540500 -- (-1309.119) (-1309.988) (-1307.297) [-1305.048] * [-1307.160] (-1302.746) (-1308.707) (-1307.059) -- 0:00:34 541000 -- (-1305.678) (-1310.445) [-1307.471] (-1306.702) * (-1302.016) (-1304.745) [-1307.616] (-1304.346) -- 0:00:33 541500 -- [-1310.456] (-1310.105) (-1306.357) (-1305.484) * (-1305.561) (-1308.966) (-1304.881) [-1304.210] -- 0:00:33 542000 -- (-1309.442) (-1309.264) (-1304.760) [-1305.628] * (-1303.707) (-1307.254) [-1306.355] (-1306.836) -- 0:00:33 542500 -- (-1311.571) [-1305.342] (-1305.858) (-1303.421) * [-1304.946] (-1303.969) (-1308.056) (-1305.691) -- 0:00:33 543000 -- (-1305.011) [-1305.840] (-1303.790) (-1307.689) * (-1310.370) (-1310.156) [-1308.852] (-1308.349) -- 0:00:33 543500 -- (-1305.739) (-1312.455) [-1303.157] (-1307.622) * (-1306.994) [-1306.709] (-1308.239) (-1305.351) -- 0:00:33 544000 -- (-1307.091) (-1304.953) (-1306.728) [-1308.085] * (-1306.103) [-1306.095] (-1303.289) (-1307.301) -- 0:00:33 544500 -- (-1306.571) (-1308.983) (-1308.344) [-1303.385] * (-1310.984) (-1308.004) (-1310.318) [-1311.662] -- 0:00:33 545000 -- (-1308.045) (-1305.900) [-1306.890] (-1306.723) * [-1308.005] (-1304.232) (-1306.421) (-1304.943) -- 0:00:33 Average standard deviation of split frequencies: 0.006799 545500 -- [-1306.151] (-1305.473) (-1307.538) (-1309.550) * (-1311.270) (-1308.839) (-1308.199) [-1306.528] -- 0:00:33 546000 -- (-1306.868) (-1309.075) (-1306.222) [-1306.131] * (-1309.135) (-1308.691) [-1302.190] (-1305.291) -- 0:00:33 546500 -- (-1304.400) (-1306.934) [-1303.257] (-1310.836) * [-1305.694] (-1308.244) (-1305.138) (-1307.192) -- 0:00:33 547000 -- [-1308.809] (-1304.078) (-1311.898) (-1306.602) * (-1304.060) (-1311.371) (-1305.019) [-1308.812] -- 0:00:33 547500 -- (-1309.523) (-1309.382) (-1306.881) [-1304.557] * (-1310.674) [-1308.931] (-1308.918) (-1307.108) -- 0:00:33 548000 -- (-1307.662) (-1304.671) (-1303.001) [-1305.182] * (-1307.662) (-1305.596) (-1303.360) [-1307.320] -- 0:00:32 548500 -- [-1312.706] (-1308.406) (-1307.972) (-1308.233) * (-1309.346) (-1305.987) (-1307.160) [-1305.479] -- 0:00:32 549000 -- (-1307.123) (-1304.838) [-1311.154] (-1305.818) * [-1304.935] (-1307.305) (-1304.410) (-1311.304) -- 0:00:32 549500 -- (-1307.846) (-1301.763) (-1308.384) [-1306.449] * (-1304.360) (-1305.532) [-1304.776] (-1307.081) -- 0:00:32 550000 -- (-1309.794) [-1305.286] (-1308.405) (-1306.890) * (-1304.030) [-1303.938] (-1308.224) (-1306.560) -- 0:00:32 Average standard deviation of split frequencies: 0.006741 550500 -- [-1306.184] (-1310.290) (-1308.005) (-1307.057) * (-1303.587) (-1307.623) [-1306.832] (-1302.689) -- 0:00:32 551000 -- (-1306.414) (-1307.312) [-1301.637] (-1304.817) * (-1304.269) [-1305.119] (-1306.008) (-1305.474) -- 0:00:32 551500 -- [-1305.214] (-1307.224) (-1307.556) (-1306.804) * (-1305.501) (-1305.775) [-1306.460] (-1305.564) -- 0:00:33 552000 -- (-1310.069) (-1308.097) (-1307.375) [-1309.717] * (-1305.083) (-1302.671) (-1301.032) [-1305.147] -- 0:00:33 552500 -- (-1304.976) (-1304.222) [-1304.326] (-1309.425) * [-1303.605] (-1304.552) (-1306.940) (-1313.035) -- 0:00:33 553000 -- (-1308.359) (-1306.556) [-1304.679] (-1306.044) * (-1303.232) (-1306.216) (-1308.618) [-1308.315] -- 0:00:33 553500 -- (-1310.017) (-1306.377) (-1305.253) [-1305.586] * [-1304.759] (-1306.871) (-1309.926) (-1305.284) -- 0:00:33 554000 -- (-1311.159) (-1312.951) (-1309.480) [-1312.830] * [-1306.459] (-1306.524) (-1309.938) (-1304.965) -- 0:00:33 554500 -- (-1306.293) [-1306.945] (-1304.300) (-1309.075) * (-1310.977) (-1305.005) [-1304.612] (-1306.881) -- 0:00:32 555000 -- [-1302.151] (-1308.279) (-1306.900) (-1308.998) * (-1311.517) (-1309.912) (-1304.775) [-1308.778] -- 0:00:32 Average standard deviation of split frequencies: 0.006942 555500 -- (-1304.875) (-1305.599) (-1309.817) [-1308.491] * (-1307.514) [-1307.709] (-1305.353) (-1307.520) -- 0:00:32 556000 -- (-1302.188) (-1312.557) [-1307.309] (-1310.423) * (-1306.249) (-1313.561) [-1304.091] (-1308.466) -- 0:00:32 556500 -- (-1306.403) (-1306.726) (-1305.167) [-1308.977] * [-1307.357] (-1314.938) (-1306.470) (-1309.404) -- 0:00:32 557000 -- (-1307.339) (-1308.764) [-1305.598] (-1304.268) * [-1301.292] (-1308.059) (-1307.875) (-1307.562) -- 0:00:32 557500 -- (-1304.289) [-1305.450] (-1308.548) (-1308.720) * [-1308.204] (-1304.109) (-1306.099) (-1303.814) -- 0:00:32 558000 -- [-1301.989] (-1310.115) (-1307.753) (-1305.247) * [-1307.330] (-1307.492) (-1308.656) (-1308.106) -- 0:00:32 558500 -- (-1305.025) [-1309.366] (-1304.137) (-1309.372) * [-1304.027] (-1306.082) (-1305.860) (-1309.943) -- 0:00:32 559000 -- (-1307.028) [-1308.021] (-1307.742) (-1303.379) * (-1303.317) (-1304.432) [-1309.720] (-1309.728) -- 0:00:32 559500 -- (-1310.717) (-1310.278) [-1306.222] (-1306.666) * (-1305.513) (-1305.430) [-1308.434] (-1310.040) -- 0:00:32 560000 -- [-1305.078] (-1306.134) (-1306.873) (-1303.895) * (-1308.757) (-1310.018) [-1309.375] (-1307.915) -- 0:00:32 Average standard deviation of split frequencies: 0.006614 560500 -- [-1307.217] (-1305.659) (-1309.651) (-1305.619) * (-1306.614) (-1305.631) (-1308.634) [-1303.948] -- 0:00:32 561000 -- [-1308.265] (-1304.441) (-1309.307) (-1303.301) * (-1310.944) (-1314.494) [-1303.385] (-1311.104) -- 0:00:32 561500 -- (-1309.018) (-1307.746) [-1307.064] (-1307.046) * [-1305.114] (-1311.479) (-1307.243) (-1307.109) -- 0:00:32 562000 -- (-1308.101) [-1304.325] (-1310.249) (-1310.068) * (-1305.293) (-1309.057) [-1303.778] (-1309.892) -- 0:00:31 562500 -- (-1310.622) (-1306.654) (-1308.538) [-1305.433] * (-1304.987) (-1306.110) [-1306.650] (-1309.058) -- 0:00:31 563000 -- [-1303.861] (-1307.490) (-1311.210) (-1304.449) * (-1307.846) [-1304.435] (-1309.303) (-1307.257) -- 0:00:31 563500 -- [-1305.074] (-1309.056) (-1305.960) (-1305.036) * (-1310.425) (-1303.161) [-1308.454] (-1315.765) -- 0:00:31 564000 -- (-1309.833) (-1309.908) (-1309.937) [-1305.031] * (-1307.227) (-1305.164) (-1306.505) [-1305.774] -- 0:00:31 564500 -- (-1307.675) (-1306.067) (-1308.075) [-1307.817] * (-1309.907) [-1306.650] (-1306.615) (-1312.090) -- 0:00:31 565000 -- (-1307.056) (-1312.490) (-1312.265) [-1304.867] * [-1305.297] (-1308.554) (-1307.010) (-1307.248) -- 0:00:31 Average standard deviation of split frequencies: 0.006441 565500 -- [-1306.226] (-1314.836) (-1310.904) (-1309.287) * (-1307.961) (-1308.162) [-1306.351] (-1306.188) -- 0:00:32 566000 -- (-1304.749) (-1313.371) (-1305.343) [-1308.719] * (-1307.890) (-1306.865) (-1308.344) [-1305.837] -- 0:00:32 566500 -- (-1308.987) (-1306.052) (-1309.100) [-1306.576] * (-1308.190) [-1308.583] (-1304.132) (-1308.683) -- 0:00:32 567000 -- (-1308.161) (-1305.612) (-1309.643) [-1304.047] * (-1306.204) [-1305.934] (-1304.149) (-1309.503) -- 0:00:32 567500 -- [-1306.983] (-1309.218) (-1310.786) (-1311.591) * (-1305.406) (-1305.767) [-1305.685] (-1310.508) -- 0:00:32 568000 -- (-1305.138) (-1310.126) [-1313.058] (-1306.858) * (-1304.516) [-1306.683] (-1306.601) (-1307.918) -- 0:00:31 568500 -- (-1308.083) (-1309.562) (-1311.199) [-1302.877] * [-1310.718] (-1306.006) (-1308.040) (-1304.112) -- 0:00:31 569000 -- [-1306.542] (-1308.518) (-1305.765) (-1312.485) * (-1308.378) (-1305.567) (-1309.974) [-1311.522] -- 0:00:31 569500 -- (-1306.064) [-1309.444] (-1306.791) (-1308.138) * (-1307.124) (-1306.438) [-1307.361] (-1314.137) -- 0:00:31 570000 -- [-1306.728] (-1307.819) (-1305.617) (-1305.361) * [-1309.101] (-1310.736) (-1308.213) (-1309.177) -- 0:00:31 Average standard deviation of split frequencies: 0.007125 570500 -- (-1307.208) (-1309.437) [-1306.781] (-1303.751) * (-1309.280) (-1304.243) [-1309.061] (-1305.063) -- 0:00:31 571000 -- (-1310.404) (-1311.704) (-1303.419) [-1309.302] * (-1307.132) [-1309.827] (-1310.335) (-1307.516) -- 0:00:31 571500 -- (-1304.202) (-1309.448) [-1304.064] (-1310.014) * (-1309.953) (-1309.108) (-1307.996) [-1309.528] -- 0:00:31 572000 -- (-1309.810) (-1308.385) (-1304.483) [-1303.164] * (-1306.591) (-1303.344) (-1307.379) [-1307.710] -- 0:00:31 572500 -- (-1304.565) (-1309.307) (-1307.622) [-1305.031] * (-1308.116) [-1306.106] (-1311.618) (-1307.367) -- 0:00:31 573000 -- [-1302.609] (-1308.816) (-1302.297) (-1303.919) * (-1306.266) (-1304.888) (-1304.751) [-1307.026] -- 0:00:31 573500 -- (-1305.295) [-1308.040] (-1302.348) (-1304.391) * [-1307.157] (-1305.153) (-1303.814) (-1304.340) -- 0:00:31 574000 -- [-1304.156] (-1306.109) (-1306.032) (-1304.188) * (-1316.751) [-1306.518] (-1303.996) (-1309.992) -- 0:00:31 574500 -- (-1308.469) (-1308.218) [-1302.018] (-1303.894) * (-1308.772) (-1303.178) [-1305.866] (-1308.066) -- 0:00:31 575000 -- (-1307.791) [-1305.159] (-1305.083) (-1310.964) * (-1310.223) (-1305.737) [-1304.665] (-1306.456) -- 0:00:31 Average standard deviation of split frequencies: 0.007366 575500 -- (-1309.893) (-1308.368) [-1307.058] (-1305.130) * (-1313.610) (-1306.314) [-1304.183] (-1306.855) -- 0:00:30 576000 -- (-1308.567) (-1306.579) [-1305.243] (-1304.458) * (-1306.285) [-1304.924] (-1305.585) (-1303.920) -- 0:00:30 576500 -- (-1309.771) [-1307.997] (-1305.654) (-1304.057) * (-1309.601) (-1304.505) [-1306.150] (-1307.199) -- 0:00:30 577000 -- [-1304.543] (-1303.733) (-1305.076) (-1305.441) * (-1309.780) (-1306.517) (-1306.252) [-1306.999] -- 0:00:30 577500 -- (-1308.152) (-1308.068) [-1303.872] (-1306.226) * (-1313.848) (-1305.221) (-1308.407) [-1311.296] -- 0:00:30 578000 -- (-1306.417) (-1307.636) (-1305.794) [-1306.664] * (-1311.816) [-1304.444] (-1306.992) (-1305.945) -- 0:00:30 578500 -- (-1304.794) [-1306.839] (-1306.445) (-1304.086) * [-1312.566] (-1305.747) (-1304.661) (-1304.888) -- 0:00:30 579000 -- (-1307.962) (-1307.433) (-1305.662) [-1304.336] * (-1307.975) (-1304.614) (-1307.078) [-1304.624] -- 0:00:30 579500 -- [-1304.439] (-1304.476) (-1306.942) (-1302.392) * (-1306.535) (-1307.556) [-1306.662] (-1308.182) -- 0:00:31 580000 -- (-1306.832) (-1304.097) (-1309.361) [-1306.418] * (-1308.584) (-1306.531) [-1302.973] (-1306.339) -- 0:00:31 Average standard deviation of split frequencies: 0.008423 580500 -- (-1304.913) (-1304.742) (-1310.214) [-1303.426] * (-1305.310) (-1307.651) [-1306.265] (-1308.427) -- 0:00:31 581000 -- (-1308.392) (-1303.896) [-1305.317] (-1309.211) * (-1308.816) (-1304.853) (-1305.651) [-1311.051] -- 0:00:31 581500 -- (-1308.778) (-1304.797) [-1304.639] (-1310.240) * (-1306.944) [-1303.539] (-1304.801) (-1311.034) -- 0:00:30 582000 -- [-1305.523] (-1306.479) (-1308.425) (-1306.266) * [-1307.570] (-1308.759) (-1310.179) (-1311.108) -- 0:00:30 582500 -- (-1303.968) [-1302.932] (-1309.130) (-1312.599) * (-1306.324) (-1306.275) (-1310.327) [-1310.581] -- 0:00:30 583000 -- (-1303.988) (-1308.538) (-1311.071) [-1305.718] * (-1306.588) (-1304.011) [-1306.020] (-1309.530) -- 0:00:30 583500 -- (-1307.350) (-1305.014) (-1303.971) [-1303.053] * (-1309.870) (-1306.407) [-1304.402] (-1307.821) -- 0:00:30 584000 -- (-1312.588) (-1305.974) (-1310.841) [-1303.324] * (-1307.583) (-1306.470) [-1304.164] (-1307.280) -- 0:00:30 584500 -- [-1307.975] (-1305.213) (-1305.988) (-1302.945) * (-1308.041) (-1307.839) (-1303.692) [-1306.329] -- 0:00:30 585000 -- (-1308.400) [-1303.792] (-1307.453) (-1305.640) * (-1308.904) [-1304.180] (-1305.974) (-1309.489) -- 0:00:30 Average standard deviation of split frequencies: 0.008547 585500 -- (-1310.954) (-1306.506) [-1304.059] (-1304.857) * (-1308.577) (-1303.953) [-1308.274] (-1307.947) -- 0:00:30 586000 -- (-1310.375) (-1307.819) [-1302.900] (-1303.448) * (-1308.549) (-1302.892) [-1305.158] (-1309.470) -- 0:00:30 586500 -- (-1308.411) (-1304.958) (-1305.232) [-1303.808] * (-1308.729) (-1318.125) (-1303.487) [-1307.820] -- 0:00:30 587000 -- [-1308.825] (-1305.438) (-1307.355) (-1301.345) * (-1305.327) (-1314.696) (-1305.041) [-1309.082] -- 0:00:30 587500 -- (-1310.001) (-1307.317) (-1309.581) [-1308.242] * (-1308.269) (-1310.251) [-1307.243] (-1313.343) -- 0:00:30 588000 -- (-1310.785) (-1304.781) [-1305.428] (-1307.646) * [-1309.251] (-1307.157) (-1309.560) (-1304.890) -- 0:00:30 588500 -- (-1314.159) (-1305.159) [-1302.593] (-1306.440) * (-1306.281) [-1310.212] (-1308.786) (-1308.659) -- 0:00:30 589000 -- [-1311.718] (-1304.787) (-1305.455) (-1308.246) * (-1311.719) [-1304.818] (-1308.023) (-1308.009) -- 0:00:30 589500 -- (-1306.187) (-1309.338) (-1306.057) [-1309.083] * [-1303.626] (-1308.009) (-1304.539) (-1309.829) -- 0:00:29 590000 -- [-1303.342] (-1307.563) (-1304.341) (-1303.560) * (-1305.003) (-1312.508) [-1308.827] (-1310.111) -- 0:00:29 Average standard deviation of split frequencies: 0.009378 590500 -- (-1301.766) (-1312.169) [-1304.292] (-1305.621) * [-1304.024] (-1308.895) (-1311.295) (-1304.687) -- 0:00:29 591000 -- (-1305.923) [-1310.048] (-1301.058) (-1306.244) * (-1310.452) (-1312.491) [-1310.083] (-1307.174) -- 0:00:29 591500 -- (-1309.064) (-1307.623) [-1301.563] (-1304.623) * (-1312.595) (-1305.196) (-1309.424) [-1305.019] -- 0:00:29 592000 -- (-1302.202) [-1305.451] (-1303.821) (-1304.110) * [-1305.795] (-1309.377) (-1313.335) (-1309.629) -- 0:00:29 592500 -- (-1305.612) (-1306.829) (-1304.617) [-1304.830] * [-1307.496] (-1307.002) (-1310.726) (-1311.536) -- 0:00:29 593000 -- [-1304.477] (-1303.730) (-1303.000) (-1307.714) * (-1307.069) [-1306.605] (-1308.879) (-1309.500) -- 0:00:29 593500 -- [-1303.562] (-1306.790) (-1301.889) (-1303.460) * (-1303.227) [-1308.381] (-1308.469) (-1307.920) -- 0:00:30 594000 -- (-1302.581) [-1306.171] (-1304.090) (-1305.548) * (-1308.773) (-1303.239) (-1308.976) [-1304.566] -- 0:00:30 594500 -- (-1304.701) (-1305.903) [-1302.619] (-1307.327) * [-1307.936] (-1306.840) (-1308.775) (-1304.730) -- 0:00:30 595000 -- [-1306.067] (-1307.604) (-1306.908) (-1305.841) * (-1303.867) [-1309.649] (-1310.510) (-1309.028) -- 0:00:29 Average standard deviation of split frequencies: 0.009046 595500 -- [-1306.751] (-1309.325) (-1305.148) (-1306.796) * (-1305.393) [-1304.346] (-1308.411) (-1304.387) -- 0:00:29 596000 -- (-1307.609) [-1308.748] (-1308.787) (-1304.442) * (-1310.206) [-1308.909] (-1310.033) (-1306.181) -- 0:00:29 596500 -- (-1312.806) (-1306.142) [-1301.765] (-1301.933) * (-1308.672) (-1305.795) (-1309.693) [-1306.365] -- 0:00:29 597000 -- (-1313.187) (-1305.323) (-1307.030) [-1304.797] * (-1310.404) (-1311.624) (-1309.761) [-1307.814] -- 0:00:29 597500 -- (-1308.379) (-1305.942) (-1311.937) [-1307.393] * (-1308.184) (-1310.240) [-1307.803] (-1305.378) -- 0:00:29 598000 -- (-1309.977) [-1305.539] (-1309.225) (-1309.696) * (-1303.968) (-1311.612) (-1310.259) [-1305.693] -- 0:00:29 598500 -- (-1309.339) (-1308.017) [-1308.257] (-1304.684) * (-1306.627) (-1312.354) [-1307.667] (-1307.035) -- 0:00:29 599000 -- (-1311.782) [-1305.181] (-1305.443) (-1305.248) * (-1306.752) (-1309.994) (-1306.890) [-1305.399] -- 0:00:29 599500 -- [-1308.649] (-1306.316) (-1306.453) (-1308.700) * (-1308.464) (-1308.381) [-1310.585] (-1305.613) -- 0:00:29 600000 -- (-1306.314) (-1311.148) [-1312.585] (-1305.129) * (-1309.619) (-1310.174) [-1307.101] (-1305.033) -- 0:00:29 Average standard deviation of split frequencies: 0.009320 600500 -- [-1305.900] (-1310.184) (-1314.020) (-1306.890) * (-1311.393) (-1309.480) [-1304.697] (-1305.902) -- 0:00:29 601000 -- [-1310.894] (-1305.042) (-1315.258) (-1308.191) * (-1310.089) (-1304.390) [-1306.401] (-1309.543) -- 0:00:29 601500 -- (-1307.312) [-1309.546] (-1311.663) (-1303.184) * [-1305.134] (-1303.431) (-1309.518) (-1309.206) -- 0:00:29 602000 -- (-1310.624) [-1306.910] (-1313.264) (-1307.046) * (-1305.687) [-1303.429] (-1308.959) (-1306.798) -- 0:00:29 602500 -- (-1313.674) (-1303.429) [-1307.258] (-1314.642) * (-1315.437) [-1304.120] (-1307.142) (-1306.841) -- 0:00:29 603000 -- [-1309.718] (-1305.935) (-1306.533) (-1310.719) * (-1309.351) (-1304.119) (-1311.891) [-1305.208] -- 0:00:28 603500 -- (-1309.043) (-1304.321) [-1308.159] (-1312.002) * (-1307.334) [-1303.521] (-1306.370) (-1306.195) -- 0:00:28 604000 -- (-1312.267) (-1305.581) (-1304.537) [-1304.467] * (-1308.044) [-1306.723] (-1310.005) (-1306.375) -- 0:00:28 604500 -- (-1312.767) (-1307.439) [-1305.591] (-1305.843) * (-1304.607) (-1307.671) (-1306.059) [-1302.795] -- 0:00:28 605000 -- (-1305.024) (-1309.273) (-1313.295) [-1307.335] * (-1311.423) (-1304.649) (-1306.009) [-1307.190] -- 0:00:28 Average standard deviation of split frequencies: 0.009383 605500 -- (-1306.473) (-1312.503) [-1309.111] (-1305.321) * (-1310.172) (-1303.316) [-1301.368] (-1306.641) -- 0:00:28 606000 -- (-1306.443) (-1302.949) [-1306.740] (-1302.807) * (-1310.866) (-1306.814) (-1304.128) [-1304.114] -- 0:00:28 606500 -- [-1302.796] (-1308.637) (-1310.517) (-1303.367) * (-1310.177) (-1305.932) (-1310.036) [-1305.258] -- 0:00:28 607000 -- (-1308.155) (-1305.905) [-1311.392] (-1306.829) * (-1306.118) (-1307.408) (-1304.258) [-1307.327] -- 0:00:28 607500 -- [-1305.702] (-1304.842) (-1305.173) (-1302.742) * (-1308.673) (-1306.868) (-1306.651) [-1309.345] -- 0:00:28 608000 -- [-1303.293] (-1304.360) (-1304.860) (-1302.850) * [-1307.141] (-1306.500) (-1307.241) (-1304.917) -- 0:00:29 608500 -- [-1305.066] (-1306.540) (-1306.777) (-1305.733) * [-1308.136] (-1305.990) (-1305.498) (-1308.680) -- 0:00:28 609000 -- [-1305.693] (-1305.224) (-1303.524) (-1310.220) * [-1307.787] (-1305.046) (-1309.698) (-1305.070) -- 0:00:28 609500 -- [-1304.450] (-1301.221) (-1304.047) (-1306.272) * (-1304.744) (-1305.698) (-1306.598) [-1306.761] -- 0:00:28 610000 -- (-1306.944) (-1303.055) (-1303.946) [-1303.169] * (-1305.718) (-1309.773) (-1304.030) [-1305.389] -- 0:00:28 Average standard deviation of split frequencies: 0.009167 610500 -- (-1311.155) (-1303.794) (-1305.163) [-1307.154] * (-1306.197) [-1303.765] (-1306.548) (-1305.077) -- 0:00:28 611000 -- (-1310.029) (-1303.798) (-1302.892) [-1304.407] * (-1310.466) (-1303.251) (-1302.802) [-1308.249] -- 0:00:28 611500 -- (-1309.901) [-1303.955] (-1307.594) (-1304.686) * (-1310.822) (-1301.550) (-1304.969) [-1311.125] -- 0:00:28 612000 -- (-1308.818) [-1306.551] (-1306.598) (-1303.223) * (-1313.175) [-1303.064] (-1306.900) (-1308.563) -- 0:00:28 612500 -- (-1309.519) (-1310.781) (-1303.924) [-1305.280] * (-1309.635) (-1302.095) (-1307.544) [-1308.884] -- 0:00:28 613000 -- (-1307.619) (-1309.658) (-1308.746) [-1303.254] * (-1310.028) [-1303.792] (-1303.941) (-1309.164) -- 0:00:28 613500 -- (-1305.835) [-1304.732] (-1307.121) (-1311.790) * (-1309.634) (-1304.135) (-1307.586) [-1305.136] -- 0:00:28 614000 -- (-1304.654) (-1310.720) (-1309.460) [-1307.983] * [-1309.643] (-1306.336) (-1307.875) (-1305.476) -- 0:00:28 614500 -- (-1304.624) (-1306.128) [-1303.463] (-1304.815) * (-1309.384) [-1304.160] (-1305.367) (-1313.855) -- 0:00:28 615000 -- (-1306.321) (-1302.140) [-1307.514] (-1312.694) * (-1309.985) [-1303.112] (-1304.373) (-1308.932) -- 0:00:28 Average standard deviation of split frequencies: 0.009363 615500 -- (-1305.612) [-1307.731] (-1309.798) (-1307.875) * (-1308.881) (-1305.385) [-1303.744] (-1309.559) -- 0:00:28 616000 -- (-1305.623) (-1306.954) [-1306.839] (-1307.446) * (-1311.289) (-1305.314) [-1301.543] (-1305.449) -- 0:00:28 616500 -- (-1308.611) (-1307.993) [-1306.370] (-1312.223) * (-1306.074) (-1308.011) (-1310.767) [-1303.952] -- 0:00:27 617000 -- (-1306.286) [-1306.249] (-1310.813) (-1307.652) * (-1308.492) (-1309.933) (-1306.566) [-1305.140] -- 0:00:27 617500 -- (-1309.692) (-1309.817) [-1303.278] (-1305.769) * [-1305.751] (-1307.837) (-1308.784) (-1307.196) -- 0:00:27 618000 -- [-1305.167] (-1302.493) (-1306.753) (-1302.525) * (-1310.404) (-1307.219) [-1305.373] (-1306.331) -- 0:00:27 618500 -- (-1304.083) (-1309.006) [-1305.983] (-1309.914) * (-1317.676) (-1307.937) (-1307.515) [-1307.387] -- 0:00:27 619000 -- (-1303.161) (-1307.376) (-1306.935) [-1315.023] * (-1316.063) [-1304.567] (-1305.614) (-1309.357) -- 0:00:27 619500 -- (-1304.442) [-1305.127] (-1308.593) (-1310.852) * (-1305.084) [-1304.013] (-1303.888) (-1307.051) -- 0:00:27 620000 -- (-1311.941) [-1305.715] (-1307.077) (-1309.796) * (-1311.726) (-1305.805) [-1304.763] (-1312.496) -- 0:00:27 Average standard deviation of split frequencies: 0.009019 620500 -- (-1311.538) (-1304.987) [-1308.556] (-1311.628) * (-1312.992) [-1302.886] (-1308.246) (-1308.044) -- 0:00:27 621000 -- (-1306.446) [-1302.160] (-1304.618) (-1306.827) * (-1307.824) (-1303.974) (-1306.097) [-1314.212] -- 0:00:27 621500 -- (-1309.864) [-1302.119] (-1306.220) (-1313.954) * (-1313.559) [-1304.454] (-1303.892) (-1308.964) -- 0:00:28 622000 -- (-1308.604) (-1302.352) [-1304.010] (-1310.067) * (-1309.115) [-1305.314] (-1307.889) (-1303.684) -- 0:00:27 622500 -- (-1309.783) (-1305.479) (-1304.108) [-1311.853] * (-1305.495) (-1303.562) (-1307.281) [-1304.538] -- 0:00:27 623000 -- (-1307.924) [-1308.956] (-1308.762) (-1309.677) * (-1312.056) [-1304.681] (-1307.695) (-1307.494) -- 0:00:27 623500 -- (-1308.815) [-1308.679] (-1304.365) (-1304.796) * (-1305.411) (-1304.813) [-1303.602] (-1308.957) -- 0:00:27 624000 -- (-1304.782) (-1305.161) [-1303.589] (-1309.369) * (-1307.757) [-1302.737] (-1308.353) (-1304.650) -- 0:00:27 624500 -- [-1307.307] (-1308.099) (-1304.431) (-1308.608) * (-1308.581) [-1302.874] (-1308.564) (-1304.169) -- 0:00:27 625000 -- [-1307.919] (-1312.694) (-1304.342) (-1308.773) * (-1309.955) (-1308.905) (-1310.408) [-1304.896] -- 0:00:27 Average standard deviation of split frequencies: 0.009037 625500 -- (-1307.292) (-1308.690) [-1310.005] (-1309.312) * (-1309.338) [-1307.370] (-1309.573) (-1305.956) -- 0:00:27 626000 -- [-1306.322] (-1304.013) (-1305.103) (-1306.235) * (-1306.819) [-1304.257] (-1306.586) (-1305.204) -- 0:00:27 626500 -- [-1309.435] (-1308.704) (-1302.647) (-1311.451) * (-1306.332) (-1310.962) [-1309.510] (-1304.505) -- 0:00:27 627000 -- (-1308.834) [-1306.659] (-1306.072) (-1309.806) * (-1308.031) [-1305.370] (-1303.474) (-1309.778) -- 0:00:27 627500 -- (-1311.367) (-1305.407) [-1307.110] (-1309.648) * [-1311.179] (-1305.927) (-1304.937) (-1302.803) -- 0:00:27 628000 -- (-1310.852) (-1303.272) (-1306.230) [-1310.782] * (-1308.228) (-1308.721) [-1305.035] (-1307.341) -- 0:00:27 628500 -- [-1311.647] (-1306.168) (-1304.003) (-1311.928) * (-1307.947) (-1306.756) [-1304.322] (-1307.813) -- 0:00:27 629000 -- [-1307.789] (-1305.940) (-1310.189) (-1308.708) * (-1307.216) (-1310.851) [-1306.055] (-1304.943) -- 0:00:27 629500 -- [-1306.529] (-1303.846) (-1308.922) (-1305.386) * (-1305.718) (-1304.997) [-1305.760] (-1309.075) -- 0:00:27 630000 -- (-1304.649) [-1308.838] (-1306.329) (-1308.759) * (-1305.992) (-1306.884) (-1305.578) [-1303.905] -- 0:00:27 Average standard deviation of split frequencies: 0.008643 630500 -- (-1307.687) [-1309.949] (-1310.046) (-1306.830) * (-1310.707) [-1307.262] (-1303.143) (-1305.217) -- 0:00:26 631000 -- [-1307.101] (-1306.171) (-1309.153) (-1306.774) * (-1309.240) (-1306.747) (-1307.805) [-1307.712] -- 0:00:26 631500 -- [-1306.763] (-1305.780) (-1306.578) (-1308.820) * (-1309.533) [-1306.517] (-1306.368) (-1309.841) -- 0:00:26 632000 -- (-1311.277) [-1302.965] (-1307.410) (-1304.285) * (-1303.547) [-1303.784] (-1306.903) (-1303.207) -- 0:00:26 632500 -- (-1305.905) (-1310.241) (-1304.595) [-1309.576] * (-1304.413) (-1304.559) (-1306.808) [-1301.985] -- 0:00:26 633000 -- (-1309.461) [-1307.280] (-1310.956) (-1310.926) * (-1304.763) (-1305.416) [-1302.726] (-1303.158) -- 0:00:26 633500 -- (-1308.727) (-1305.807) [-1305.188] (-1305.819) * (-1304.142) (-1306.270) (-1308.218) [-1304.295] -- 0:00:26 634000 -- (-1308.273) (-1309.199) (-1303.524) [-1305.454] * [-1306.026] (-1302.229) (-1306.895) (-1306.045) -- 0:00:26 634500 -- (-1304.553) (-1308.814) (-1307.190) [-1306.916] * (-1305.478) [-1304.862] (-1306.474) (-1303.340) -- 0:00:26 635000 -- (-1306.667) (-1307.700) [-1310.370] (-1309.349) * [-1306.050] (-1307.473) (-1302.008) (-1306.963) -- 0:00:26 Average standard deviation of split frequencies: 0.009265 635500 -- (-1306.322) (-1312.786) (-1309.239) [-1304.220] * (-1304.585) (-1311.403) [-1302.489] (-1309.826) -- 0:00:26 636000 -- [-1305.894] (-1315.180) (-1311.516) (-1308.192) * [-1304.286] (-1304.128) (-1304.144) (-1312.638) -- 0:00:26 636500 -- (-1305.673) (-1309.271) (-1306.263) [-1302.839] * (-1303.439) (-1310.078) (-1308.442) [-1309.760] -- 0:00:26 637000 -- [-1304.642] (-1307.756) (-1307.851) (-1309.055) * (-1304.715) (-1307.338) (-1307.435) [-1306.613] -- 0:00:26 637500 -- (-1308.201) [-1308.893] (-1304.948) (-1303.177) * (-1303.652) (-1310.435) [-1306.740] (-1311.370) -- 0:00:26 638000 -- (-1310.323) (-1304.747) (-1306.494) [-1304.455] * (-1303.420) (-1313.182) (-1306.780) [-1313.187] -- 0:00:26 638500 -- (-1305.721) [-1308.783] (-1305.213) (-1307.727) * (-1302.532) (-1310.763) [-1304.461] (-1309.177) -- 0:00:26 639000 -- (-1307.923) [-1306.482] (-1306.310) (-1307.360) * (-1304.270) (-1314.021) [-1307.645] (-1307.683) -- 0:00:26 639500 -- [-1308.218] (-1310.628) (-1305.729) (-1309.813) * (-1306.904) (-1302.983) [-1306.953] (-1309.382) -- 0:00:26 640000 -- (-1312.562) (-1306.135) [-1306.165] (-1308.172) * (-1302.917) (-1308.868) (-1301.277) [-1305.298] -- 0:00:26 Average standard deviation of split frequencies: 0.009473 640500 -- (-1307.298) [-1304.948] (-1309.183) (-1311.772) * [-1303.996] (-1308.479) (-1302.080) (-1302.965) -- 0:00:26 641000 -- (-1308.625) (-1305.910) (-1306.752) [-1302.840] * [-1307.475] (-1311.165) (-1302.834) (-1308.100) -- 0:00:26 641500 -- (-1308.785) [-1308.866] (-1313.106) (-1308.557) * (-1304.407) [-1304.541] (-1307.092) (-1307.378) -- 0:00:26 642000 -- (-1305.805) (-1310.222) (-1309.996) [-1306.891] * [-1305.111] (-1304.587) (-1308.470) (-1306.314) -- 0:00:26 642500 -- (-1307.862) (-1304.439) (-1307.485) [-1308.909] * (-1313.282) (-1302.631) [-1305.937] (-1305.240) -- 0:00:26 643000 -- [-1306.946] (-1309.363) (-1304.435) (-1303.583) * (-1309.556) (-1304.776) (-1304.702) [-1303.446] -- 0:00:26 643500 -- (-1307.390) (-1305.215) [-1304.670] (-1302.044) * (-1304.579) [-1303.065] (-1304.028) (-1308.320) -- 0:00:26 644000 -- (-1307.539) [-1308.734] (-1308.785) (-1306.965) * (-1302.587) (-1307.074) (-1305.291) [-1304.965] -- 0:00:25 644500 -- [-1304.004] (-1306.595) (-1305.481) (-1306.409) * [-1305.362] (-1308.307) (-1304.439) (-1309.442) -- 0:00:25 645000 -- [-1304.909] (-1309.826) (-1304.111) (-1307.347) * (-1302.891) [-1305.903] (-1303.611) (-1305.757) -- 0:00:25 Average standard deviation of split frequencies: 0.009441 645500 -- (-1309.072) [-1306.969] (-1306.444) (-1306.602) * (-1302.570) [-1306.397] (-1307.494) (-1307.550) -- 0:00:25 646000 -- (-1307.910) (-1306.703) (-1304.373) [-1305.256] * (-1303.149) (-1309.238) (-1309.799) [-1304.560] -- 0:00:25 646500 -- (-1308.169) (-1307.139) [-1302.741] (-1306.520) * (-1304.535) (-1306.993) [-1309.246] (-1307.780) -- 0:00:25 647000 -- (-1314.070) (-1310.306) (-1304.109) [-1304.444] * [-1304.149] (-1306.211) (-1308.882) (-1317.381) -- 0:00:25 647500 -- [-1306.031] (-1310.509) (-1303.710) (-1307.058) * [-1301.084] (-1307.354) (-1308.167) (-1313.533) -- 0:00:25 648000 -- (-1308.084) [-1312.149] (-1301.084) (-1308.252) * (-1307.579) (-1309.139) (-1302.872) [-1305.751] -- 0:00:25 648500 -- (-1307.847) (-1309.001) (-1306.651) [-1307.339] * [-1304.334] (-1305.884) (-1305.379) (-1306.973) -- 0:00:25 649000 -- (-1311.986) (-1306.674) [-1304.746] (-1310.280) * (-1303.170) (-1306.861) [-1305.832] (-1306.003) -- 0:00:25 649500 -- (-1309.121) (-1311.506) (-1305.955) [-1309.383] * (-1308.403) (-1308.629) [-1309.622] (-1306.264) -- 0:00:25 650000 -- (-1307.755) [-1308.625] (-1311.410) (-1312.069) * (-1307.778) [-1314.728] (-1310.069) (-1308.170) -- 0:00:25 Average standard deviation of split frequencies: 0.009011 650500 -- [-1306.286] (-1304.897) (-1308.142) (-1312.815) * (-1306.046) [-1302.908] (-1306.944) (-1309.152) -- 0:00:25 651000 -- [-1308.423] (-1309.577) (-1307.364) (-1305.644) * [-1307.286] (-1307.733) (-1308.330) (-1304.696) -- 0:00:25 651500 -- (-1307.988) (-1305.202) (-1306.199) [-1308.428] * [-1301.332] (-1308.415) (-1306.417) (-1308.955) -- 0:00:25 652000 -- (-1303.453) (-1305.861) (-1305.809) [-1309.969] * (-1305.207) (-1309.020) [-1309.551] (-1305.931) -- 0:00:25 652500 -- [-1304.987] (-1308.631) (-1309.197) (-1312.648) * [-1305.426] (-1309.972) (-1308.413) (-1308.184) -- 0:00:25 653000 -- (-1308.779) (-1305.734) [-1306.417] (-1306.191) * [-1304.230] (-1308.056) (-1306.431) (-1308.831) -- 0:00:25 653500 -- (-1306.523) (-1308.747) [-1309.016] (-1311.580) * (-1306.942) [-1307.825] (-1307.539) (-1303.469) -- 0:00:25 654000 -- (-1306.485) (-1309.228) (-1305.901) [-1311.081] * (-1304.386) [-1312.205] (-1304.580) (-1303.413) -- 0:00:25 654500 -- (-1308.272) (-1305.227) [-1303.706] (-1311.416) * [-1302.297] (-1311.486) (-1307.814) (-1306.679) -- 0:00:25 655000 -- [-1310.927] (-1307.184) (-1302.812) (-1307.922) * (-1302.300) [-1306.480] (-1305.453) (-1307.940) -- 0:00:25 Average standard deviation of split frequencies: 0.008938 655500 -- (-1305.522) [-1308.153] (-1305.006) (-1308.186) * (-1310.379) (-1304.246) [-1309.442] (-1310.752) -- 0:00:25 656000 -- (-1306.522) [-1306.589] (-1304.263) (-1311.130) * (-1304.372) (-1309.472) [-1302.883] (-1307.861) -- 0:00:25 656500 -- (-1308.195) [-1311.803] (-1308.298) (-1307.230) * (-1304.456) (-1306.078) [-1304.302] (-1304.242) -- 0:00:25 657000 -- (-1307.034) [-1306.868] (-1312.885) (-1306.951) * (-1303.674) (-1309.297) (-1306.774) [-1303.177] -- 0:00:25 657500 -- (-1312.834) [-1307.751] (-1312.114) (-1308.329) * (-1307.912) (-1308.996) (-1303.900) [-1305.773] -- 0:00:25 658000 -- (-1308.318) (-1305.086) [-1304.910] (-1313.150) * [-1306.671] (-1308.628) (-1306.980) (-1308.331) -- 0:00:24 658500 -- (-1309.670) [-1303.932] (-1305.319) (-1307.597) * (-1305.626) (-1306.568) [-1305.276] (-1305.988) -- 0:00:24 659000 -- (-1304.113) (-1306.886) [-1306.799] (-1313.278) * (-1311.947) (-1308.656) [-1303.340] (-1306.652) -- 0:00:24 659500 -- (-1307.251) (-1307.879) (-1302.971) [-1303.925] * (-1310.932) (-1306.791) [-1302.648] (-1307.482) -- 0:00:24 660000 -- (-1307.450) (-1305.090) [-1302.429] (-1309.851) * (-1307.746) (-1306.026) [-1303.616] (-1308.301) -- 0:00:24 Average standard deviation of split frequencies: 0.008919 660500 -- (-1307.441) [-1306.435] (-1303.102) (-1302.829) * (-1309.493) (-1310.708) [-1303.395] (-1308.563) -- 0:00:24 661000 -- [-1306.697] (-1308.105) (-1302.581) (-1303.941) * (-1308.264) (-1309.943) (-1304.704) [-1303.937] -- 0:00:24 661500 -- (-1309.251) (-1308.833) [-1304.803] (-1305.673) * (-1304.946) (-1309.907) [-1305.056] (-1306.327) -- 0:00:24 662000 -- (-1313.261) [-1304.126] (-1303.208) (-1309.349) * (-1304.751) [-1305.327] (-1310.095) (-1308.909) -- 0:00:25 662500 -- (-1307.109) (-1305.867) [-1304.865] (-1311.240) * (-1309.380) (-1304.772) [-1305.435] (-1308.601) -- 0:00:24 663000 -- (-1308.435) (-1304.461) (-1314.161) [-1306.261] * (-1306.397) (-1308.877) [-1303.037] (-1309.311) -- 0:00:24 663500 -- (-1308.075) (-1308.651) (-1311.494) [-1303.301] * [-1307.533] (-1305.892) (-1303.655) (-1308.080) -- 0:00:24 664000 -- [-1305.957] (-1307.690) (-1303.265) (-1306.204) * (-1307.164) (-1305.830) (-1312.334) [-1309.553] -- 0:00:24 664500 -- (-1305.496) [-1305.021] (-1307.945) (-1307.926) * [-1306.774] (-1306.504) (-1305.265) (-1306.549) -- 0:00:24 665000 -- [-1308.377] (-1306.688) (-1306.918) (-1308.147) * (-1305.667) (-1313.382) (-1304.587) [-1300.716] -- 0:00:24 Average standard deviation of split frequencies: 0.008759 665500 -- (-1307.563) (-1304.750) [-1303.705] (-1307.150) * (-1310.626) (-1306.665) (-1304.404) [-1302.887] -- 0:00:24 666000 -- (-1306.058) [-1306.011] (-1304.000) (-1308.119) * [-1309.151] (-1302.841) (-1307.763) (-1306.488) -- 0:00:24 666500 -- (-1313.790) [-1305.445] (-1307.165) (-1308.444) * [-1307.371] (-1311.373) (-1309.108) (-1309.664) -- 0:00:24 667000 -- (-1310.678) [-1305.375] (-1305.411) (-1317.796) * (-1305.605) (-1310.884) [-1306.306] (-1302.291) -- 0:00:24 667500 -- (-1310.094) [-1303.254] (-1303.722) (-1308.893) * [-1310.262] (-1309.475) (-1307.507) (-1309.635) -- 0:00:24 668000 -- (-1307.629) (-1305.647) (-1304.369) [-1309.030] * [-1304.552] (-1309.657) (-1305.065) (-1304.027) -- 0:00:24 668500 -- (-1305.771) (-1306.434) [-1303.397] (-1305.885) * (-1306.017) (-1306.955) (-1305.411) [-1302.736] -- 0:00:24 669000 -- (-1305.068) (-1304.098) [-1303.337] (-1309.244) * (-1310.069) (-1308.586) (-1310.836) [-1304.066] -- 0:00:24 669500 -- (-1309.431) [-1304.305] (-1305.470) (-1307.585) * (-1307.960) (-1310.275) [-1306.937] (-1308.778) -- 0:00:24 670000 -- (-1307.708) (-1305.563) [-1304.309] (-1308.312) * (-1305.681) (-1309.485) [-1306.488] (-1306.262) -- 0:00:24 Average standard deviation of split frequencies: 0.008698 670500 -- (-1310.075) (-1303.195) (-1309.288) [-1307.161] * (-1307.817) (-1310.136) [-1302.270] (-1305.753) -- 0:00:24 671000 -- (-1308.008) (-1304.908) (-1307.762) [-1309.584] * (-1311.245) (-1309.920) [-1305.526] (-1308.598) -- 0:00:24 671500 -- [-1305.523] (-1304.444) (-1305.810) (-1309.605) * (-1303.757) [-1306.639] (-1312.939) (-1304.163) -- 0:00:23 672000 -- (-1308.498) (-1311.394) [-1307.346] (-1307.162) * (-1304.965) (-1307.586) (-1305.588) [-1304.743] -- 0:00:23 672500 -- (-1308.857) [-1307.016] (-1306.444) (-1312.635) * (-1306.576) (-1307.258) [-1305.092] (-1304.873) -- 0:00:23 673000 -- [-1307.047] (-1307.121) (-1307.781) (-1310.359) * (-1306.207) (-1309.207) (-1304.257) [-1304.683] -- 0:00:23 673500 -- (-1309.587) [-1305.013] (-1306.471) (-1310.546) * (-1308.930) [-1309.700] (-1303.410) (-1307.671) -- 0:00:23 674000 -- [-1305.060] (-1310.986) (-1303.973) (-1309.435) * [-1307.088] (-1312.039) (-1309.109) (-1306.473) -- 0:00:23 674500 -- (-1311.590) (-1303.750) (-1303.700) [-1305.888] * (-1309.182) [-1308.321] (-1306.833) (-1306.812) -- 0:00:24 675000 -- (-1311.117) [-1308.096] (-1303.755) (-1314.570) * (-1311.850) [-1308.642] (-1307.227) (-1305.752) -- 0:00:24 Average standard deviation of split frequencies: 0.008673 675500 -- (-1310.302) [-1304.583] (-1304.383) (-1309.387) * [-1308.232] (-1307.617) (-1303.346) (-1307.645) -- 0:00:24 676000 -- (-1305.330) [-1304.407] (-1303.536) (-1313.254) * (-1304.969) (-1303.385) (-1308.841) [-1303.809] -- 0:00:23 676500 -- (-1306.124) (-1305.811) [-1305.650] (-1312.076) * (-1310.018) (-1309.257) [-1306.938] (-1305.637) -- 0:00:23 677000 -- (-1305.858) [-1305.694] (-1304.378) (-1308.600) * [-1309.203] (-1308.025) (-1304.598) (-1309.085) -- 0:00:23 677500 -- (-1306.040) (-1307.980) [-1304.101] (-1309.417) * (-1306.617) [-1306.979] (-1304.596) (-1307.592) -- 0:00:23 678000 -- (-1308.535) [-1307.562] (-1304.871) (-1308.376) * (-1308.914) (-1313.321) (-1307.493) [-1305.850] -- 0:00:23 678500 -- (-1311.085) (-1310.341) [-1304.428] (-1308.529) * (-1307.939) (-1307.675) [-1305.665] (-1310.545) -- 0:00:23 679000 -- [-1308.854] (-1305.295) (-1309.462) (-1309.861) * [-1307.726] (-1309.045) (-1306.500) (-1304.798) -- 0:00:23 679500 -- (-1307.178) (-1305.385) [-1307.964] (-1311.472) * (-1308.621) (-1306.036) [-1307.416] (-1304.536) -- 0:00:23 680000 -- (-1306.669) (-1306.398) (-1311.942) [-1308.862] * (-1305.473) [-1305.405] (-1304.783) (-1305.114) -- 0:00:23 Average standard deviation of split frequencies: 0.008527 680500 -- [-1306.122] (-1306.351) (-1306.196) (-1311.325) * [-1307.886] (-1309.414) (-1305.262) (-1304.921) -- 0:00:23 681000 -- (-1305.353) (-1307.915) (-1303.891) [-1313.093] * (-1309.606) (-1311.747) [-1304.810] (-1307.957) -- 0:00:23 681500 -- (-1307.716) (-1311.825) [-1306.191] (-1315.057) * (-1306.979) [-1308.685] (-1305.077) (-1304.907) -- 0:00:23 682000 -- (-1307.006) (-1307.040) (-1306.592) [-1307.278] * (-1311.588) (-1311.836) (-1307.311) [-1305.549] -- 0:00:23 682500 -- [-1301.367] (-1307.219) (-1306.540) (-1307.585) * [-1306.764] (-1311.248) (-1309.993) (-1307.938) -- 0:00:23 683000 -- (-1304.350) [-1307.381] (-1311.833) (-1308.488) * [-1303.184] (-1308.692) (-1303.274) (-1308.243) -- 0:00:23 683500 -- (-1305.456) [-1307.437] (-1307.793) (-1312.272) * (-1304.075) (-1306.162) (-1305.722) [-1312.778] -- 0:00:23 684000 -- (-1310.512) (-1308.376) (-1303.459) [-1312.198] * [-1302.069] (-1307.786) (-1305.748) (-1308.905) -- 0:00:23 684500 -- (-1307.646) [-1309.212] (-1304.326) (-1307.652) * (-1307.309) (-1309.073) (-1304.536) [-1303.632] -- 0:00:23 685000 -- (-1307.383) (-1313.430) [-1306.482] (-1309.357) * (-1303.516) [-1306.255] (-1305.698) (-1307.785) -- 0:00:22 Average standard deviation of split frequencies: 0.008847 685500 -- (-1307.623) (-1308.824) (-1305.956) [-1306.454] * [-1305.688] (-1306.249) (-1306.752) (-1306.989) -- 0:00:22 686000 -- (-1307.924) [-1306.074] (-1306.394) (-1307.805) * (-1307.137) (-1308.266) [-1303.733] (-1303.260) -- 0:00:23 686500 -- (-1306.446) [-1304.311] (-1307.195) (-1312.981) * [-1303.621] (-1305.085) (-1303.560) (-1305.999) -- 0:00:23 687000 -- [-1306.399] (-1307.977) (-1307.632) (-1309.534) * [-1305.086] (-1306.608) (-1307.645) (-1303.134) -- 0:00:23 687500 -- (-1310.579) [-1307.574] (-1309.288) (-1307.865) * (-1305.024) (-1307.878) [-1302.834] (-1306.968) -- 0:00:23 688000 -- (-1305.113) [-1307.018] (-1304.995) (-1311.251) * (-1307.983) (-1304.033) (-1310.064) [-1311.256] -- 0:00:23 688500 -- (-1307.604) [-1307.057] (-1307.667) (-1310.130) * [-1305.954] (-1306.791) (-1307.308) (-1305.029) -- 0:00:23 689000 -- (-1309.124) (-1305.791) (-1306.705) [-1307.755] * (-1307.171) (-1306.980) [-1302.050] (-1305.299) -- 0:00:23 689500 -- (-1308.520) [-1304.574] (-1307.139) (-1307.563) * (-1310.576) (-1310.797) (-1308.729) [-1306.430] -- 0:00:22 690000 -- (-1305.058) [-1303.329] (-1309.032) (-1304.533) * (-1308.529) [-1307.650] (-1307.959) (-1307.758) -- 0:00:22 Average standard deviation of split frequencies: 0.008489 690500 -- [-1302.784] (-1302.840) (-1306.070) (-1309.521) * (-1307.430) [-1306.923] (-1302.959) (-1303.955) -- 0:00:22 691000 -- [-1306.594] (-1307.741) (-1309.804) (-1308.079) * (-1309.209) [-1305.288] (-1308.649) (-1308.960) -- 0:00:22 691500 -- (-1306.132) (-1306.989) (-1309.659) [-1307.380] * (-1305.998) (-1307.757) (-1304.705) [-1310.998] -- 0:00:22 692000 -- (-1305.233) (-1308.551) (-1309.741) [-1308.799] * (-1309.166) [-1307.933] (-1302.858) (-1308.296) -- 0:00:22 692500 -- (-1310.912) (-1309.606) (-1307.479) [-1307.238] * [-1304.657] (-1309.676) (-1304.949) (-1308.990) -- 0:00:22 693000 -- [-1304.746] (-1308.495) (-1312.708) (-1305.468) * [-1303.342] (-1314.152) (-1308.334) (-1310.645) -- 0:00:22 693500 -- (-1309.767) (-1306.037) (-1314.663) [-1305.731] * [-1303.861] (-1309.005) (-1303.597) (-1304.381) -- 0:00:22 694000 -- [-1306.860] (-1304.853) (-1307.079) (-1308.914) * (-1306.519) (-1306.599) (-1304.800) [-1305.705] -- 0:00:22 694500 -- (-1305.953) (-1308.987) [-1309.672] (-1307.444) * (-1303.414) (-1307.374) (-1307.758) [-1307.850] -- 0:00:22 695000 -- [-1304.878] (-1305.689) (-1308.298) (-1307.460) * (-1305.430) (-1304.791) [-1307.427] (-1304.454) -- 0:00:22 Average standard deviation of split frequencies: 0.008890 695500 -- [-1303.712] (-1307.957) (-1307.933) (-1310.679) * (-1306.383) (-1308.378) [-1307.353] (-1303.829) -- 0:00:22 696000 -- (-1306.882) (-1307.754) (-1308.336) [-1310.020] * (-1306.446) [-1306.367] (-1308.974) (-1305.255) -- 0:00:22 696500 -- [-1305.112] (-1310.573) (-1305.060) (-1308.674) * (-1307.571) (-1311.217) (-1306.858) [-1305.465] -- 0:00:22 697000 -- (-1308.862) (-1309.595) (-1310.173) [-1309.465] * (-1304.563) (-1311.778) (-1304.360) [-1304.076] -- 0:00:22 697500 -- (-1308.025) (-1311.022) [-1304.760] (-1306.448) * (-1308.202) (-1307.913) (-1306.932) [-1305.505] -- 0:00:22 698000 -- (-1306.979) (-1307.893) [-1304.832] (-1305.927) * (-1305.398) (-1311.123) (-1304.718) [-1311.350] -- 0:00:22 698500 -- [-1306.093] (-1313.764) (-1306.648) (-1305.490) * [-1304.380] (-1306.266) (-1305.754) (-1306.086) -- 0:00:22 699000 -- (-1307.295) (-1310.448) [-1303.676] (-1307.984) * (-1310.060) (-1309.998) [-1302.881] (-1308.529) -- 0:00:22 699500 -- (-1307.989) (-1310.202) (-1304.334) [-1305.515] * (-1305.894) (-1311.644) (-1303.453) [-1305.406] -- 0:00:22 700000 -- [-1303.764] (-1307.066) (-1305.244) (-1309.594) * (-1303.401) (-1309.832) [-1307.245] (-1308.893) -- 0:00:22 Average standard deviation of split frequencies: 0.008999 700500 -- (-1310.035) [-1306.655] (-1305.928) (-1306.632) * (-1311.632) (-1306.256) [-1305.673] (-1307.527) -- 0:00:22 701000 -- (-1309.193) (-1306.780) (-1310.052) [-1306.912] * (-1304.939) [-1309.595] (-1302.922) (-1313.553) -- 0:00:22 701500 -- (-1309.934) (-1305.952) [-1308.721] (-1303.909) * [-1303.110] (-1308.008) (-1308.241) (-1312.024) -- 0:00:22 702000 -- (-1308.428) [-1309.411] (-1308.361) (-1305.837) * [-1303.555] (-1307.521) (-1308.736) (-1312.758) -- 0:00:22 702500 -- (-1309.388) (-1305.996) (-1305.423) [-1303.238] * (-1308.195) (-1308.338) [-1304.980] (-1309.856) -- 0:00:22 703000 -- (-1310.877) (-1308.314) [-1302.031] (-1311.644) * (-1306.582) (-1308.670) [-1307.277] (-1309.200) -- 0:00:21 703500 -- (-1308.728) (-1309.183) (-1304.276) [-1310.129] * (-1305.982) [-1308.689] (-1307.804) (-1308.301) -- 0:00:21 704000 -- (-1310.820) (-1310.793) (-1308.021) [-1305.566] * (-1308.284) [-1307.216] (-1306.629) (-1308.946) -- 0:00:21 704500 -- (-1310.356) [-1309.279] (-1307.192) (-1314.574) * (-1306.644) (-1306.936) (-1307.695) [-1304.775] -- 0:00:21 705000 -- (-1312.459) (-1307.721) [-1304.639] (-1308.030) * (-1303.140) (-1310.779) [-1310.596] (-1306.976) -- 0:00:21 Average standard deviation of split frequencies: 0.009139 705500 -- [-1313.740] (-1302.948) (-1304.377) (-1310.945) * (-1305.543) (-1314.806) [-1306.875] (-1309.144) -- 0:00:21 706000 -- (-1308.093) (-1309.035) [-1308.099] (-1311.580) * [-1303.310] (-1311.452) (-1310.452) (-1306.853) -- 0:00:21 706500 -- (-1310.831) (-1307.351) [-1308.450] (-1307.117) * [-1306.252] (-1304.280) (-1308.897) (-1307.637) -- 0:00:21 707000 -- (-1308.928) (-1309.187) (-1306.607) [-1305.084] * (-1308.414) (-1309.270) [-1307.552] (-1305.803) -- 0:00:21 707500 -- (-1310.986) [-1304.876] (-1307.031) (-1303.287) * [-1306.701] (-1304.362) (-1311.782) (-1310.694) -- 0:00:21 708000 -- [-1310.124] (-1307.682) (-1306.607) (-1306.560) * (-1302.170) (-1307.594) (-1313.073) [-1309.950] -- 0:00:21 708500 -- (-1309.753) (-1308.349) (-1307.372) [-1304.358] * [-1309.214] (-1306.838) (-1315.469) (-1306.728) -- 0:00:21 709000 -- (-1309.207) (-1310.238) [-1307.628] (-1304.280) * [-1308.281] (-1307.283) (-1313.974) (-1312.124) -- 0:00:21 709500 -- (-1309.649) [-1304.583] (-1304.906) (-1302.195) * (-1307.749) (-1302.562) [-1308.028] (-1308.610) -- 0:00:21 710000 -- (-1308.769) (-1304.890) (-1305.696) [-1306.960] * (-1305.951) [-1304.355] (-1307.859) (-1309.469) -- 0:00:21 Average standard deviation of split frequencies: 0.009204 710500 -- (-1308.317) [-1305.093] (-1309.702) (-1309.145) * [-1307.432] (-1309.692) (-1307.352) (-1307.509) -- 0:00:21 711000 -- [-1302.962] (-1309.128) (-1303.948) (-1307.823) * (-1306.444) (-1307.951) (-1310.192) [-1306.860] -- 0:00:21 711500 -- (-1310.139) [-1305.212] (-1304.450) (-1306.757) * (-1306.347) (-1303.777) (-1309.442) [-1303.546] -- 0:00:21 712000 -- (-1306.181) (-1312.227) (-1302.495) [-1303.913] * (-1308.623) [-1304.906] (-1309.493) (-1306.620) -- 0:00:21 712500 -- (-1305.518) (-1306.293) [-1306.499] (-1305.269) * (-1308.243) [-1309.178] (-1306.872) (-1309.026) -- 0:00:21 713000 -- (-1307.280) (-1311.094) [-1305.334] (-1305.796) * (-1308.745) (-1307.854) (-1304.730) [-1310.086] -- 0:00:21 713500 -- (-1310.286) (-1307.488) (-1302.556) [-1307.473] * (-1308.136) (-1306.392) [-1305.201] (-1310.108) -- 0:00:21 714000 -- (-1306.277) (-1308.871) [-1306.109] (-1304.159) * (-1306.960) (-1303.125) (-1308.801) [-1304.631] -- 0:00:21 714500 -- (-1306.658) [-1309.627] (-1303.707) (-1305.744) * [-1304.555] (-1305.885) (-1310.148) (-1309.386) -- 0:00:21 715000 -- (-1304.844) (-1306.094) [-1304.564] (-1306.083) * [-1308.590] (-1306.369) (-1303.970) (-1307.697) -- 0:00:21 Average standard deviation of split frequencies: 0.009341 715500 -- (-1309.984) [-1305.271] (-1309.835) (-1308.545) * [-1304.138] (-1307.453) (-1306.642) (-1309.561) -- 0:00:21 716000 -- (-1308.217) (-1305.470) (-1309.263) [-1304.927] * (-1305.084) [-1303.290] (-1306.501) (-1309.177) -- 0:00:21 716500 -- (-1304.829) [-1304.199] (-1307.633) (-1305.291) * (-1308.991) (-1307.923) [-1302.739] (-1307.659) -- 0:00:20 717000 -- (-1307.402) (-1307.865) (-1308.332) [-1307.022] * [-1307.247] (-1308.178) (-1310.762) (-1316.092) -- 0:00:20 717500 -- (-1305.935) [-1304.568] (-1308.845) (-1304.560) * [-1305.902] (-1305.014) (-1306.708) (-1309.296) -- 0:00:20 718000 -- (-1310.214) [-1309.696] (-1308.969) (-1306.326) * (-1314.361) (-1307.123) [-1303.301] (-1308.854) -- 0:00:20 718500 -- (-1308.749) (-1307.951) [-1311.548] (-1305.263) * (-1312.472) (-1308.790) (-1308.896) [-1307.271] -- 0:00:20 719000 -- [-1309.070] (-1308.627) (-1309.830) (-1302.578) * (-1307.900) [-1306.565] (-1305.027) (-1306.505) -- 0:00:20 719500 -- [-1307.391] (-1311.291) (-1308.947) (-1305.350) * [-1303.333] (-1309.515) (-1309.286) (-1310.069) -- 0:00:20 720000 -- (-1303.877) (-1307.263) [-1306.772] (-1306.126) * (-1304.842) [-1302.697] (-1311.475) (-1316.816) -- 0:00:20 Average standard deviation of split frequencies: 0.009117 720500 -- (-1304.870) [-1301.949] (-1307.726) (-1310.810) * (-1306.617) [-1307.572] (-1307.069) (-1307.428) -- 0:00:20 721000 -- (-1313.714) [-1308.428] (-1306.513) (-1307.013) * (-1307.303) (-1306.942) [-1304.272] (-1308.603) -- 0:00:20 721500 -- (-1305.398) (-1305.871) [-1308.106] (-1306.151) * (-1303.021) (-1304.209) [-1309.368] (-1309.234) -- 0:00:20 722000 -- (-1306.669) [-1305.189] (-1308.131) (-1307.107) * (-1308.236) [-1310.623] (-1305.300) (-1309.385) -- 0:00:20 722500 -- (-1307.424) [-1306.211] (-1309.703) (-1311.060) * (-1312.537) [-1306.843] (-1312.295) (-1311.538) -- 0:00:20 723000 -- (-1306.470) (-1305.165) (-1308.269) [-1303.380] * (-1310.144) [-1309.992] (-1304.577) (-1307.555) -- 0:00:20 723500 -- (-1310.365) (-1304.771) [-1303.563] (-1306.223) * (-1306.235) (-1303.393) [-1306.777] (-1307.021) -- 0:00:20 724000 -- [-1302.904] (-1305.219) (-1306.493) (-1303.141) * (-1308.484) (-1306.459) [-1301.651] (-1302.275) -- 0:00:20 724500 -- [-1307.912] (-1308.328) (-1309.938) (-1308.055) * (-1310.755) (-1310.283) (-1303.204) [-1307.049] -- 0:00:20 725000 -- (-1305.033) (-1308.173) (-1308.712) [-1311.363] * (-1307.816) (-1305.739) (-1304.163) [-1307.552] -- 0:00:20 Average standard deviation of split frequencies: 0.008806 725500 -- (-1304.128) [-1305.261] (-1307.937) (-1307.463) * (-1305.140) (-1306.760) [-1303.357] (-1307.549) -- 0:00:20 726000 -- (-1305.469) [-1302.744] (-1304.422) (-1311.588) * (-1310.837) (-1307.669) [-1305.741] (-1304.638) -- 0:00:20 726500 -- [-1302.879] (-1308.114) (-1307.498) (-1310.461) * (-1308.988) [-1306.954] (-1309.493) (-1304.994) -- 0:00:20 727000 -- (-1308.242) (-1305.963) (-1305.545) [-1307.145] * (-1306.491) (-1307.070) (-1303.606) [-1303.701] -- 0:00:20 727500 -- (-1305.904) (-1305.755) (-1308.693) [-1309.180] * [-1303.698] (-1310.385) (-1308.569) (-1304.313) -- 0:00:20 728000 -- (-1305.476) (-1304.885) (-1314.938) [-1304.915] * [-1311.077] (-1310.678) (-1308.505) (-1306.402) -- 0:00:20 728500 -- (-1310.860) (-1306.387) [-1303.682] (-1307.434) * (-1308.047) [-1307.819] (-1305.097) (-1308.462) -- 0:00:20 729000 -- [-1307.890] (-1304.432) (-1307.963) (-1306.614) * [-1309.294] (-1308.637) (-1305.513) (-1308.090) -- 0:00:20 729500 -- (-1308.889) (-1305.265) (-1304.525) [-1306.054] * (-1304.991) (-1309.028) (-1305.764) [-1304.969] -- 0:00:20 730000 -- (-1311.747) (-1308.831) (-1305.850) [-1304.703] * (-1306.252) (-1311.203) (-1303.312) [-1307.353] -- 0:00:19 Average standard deviation of split frequencies: 0.008952 730500 -- [-1306.544] (-1306.306) (-1306.634) (-1307.269) * (-1305.978) [-1312.059] (-1305.833) (-1308.169) -- 0:00:19 731000 -- [-1302.802] (-1307.336) (-1303.866) (-1308.611) * (-1311.993) [-1309.674] (-1304.404) (-1307.787) -- 0:00:19 731500 -- (-1308.370) (-1307.145) (-1305.595) [-1305.659] * (-1309.662) (-1304.063) [-1305.959] (-1310.195) -- 0:00:19 732000 -- (-1309.304) (-1310.524) (-1305.525) [-1307.797] * [-1310.291] (-1310.450) (-1306.899) (-1310.120) -- 0:00:19 732500 -- (-1306.627) (-1308.227) (-1305.142) [-1304.948] * (-1309.735) [-1307.787] (-1311.420) (-1310.195) -- 0:00:19 733000 -- (-1303.636) (-1309.002) [-1304.568] (-1306.428) * (-1308.011) (-1306.775) [-1312.894] (-1301.954) -- 0:00:19 733500 -- (-1307.202) (-1308.642) [-1308.550] (-1304.819) * (-1308.805) (-1310.327) (-1306.709) [-1305.844] -- 0:00:19 734000 -- (-1309.439) (-1304.971) [-1307.451] (-1308.736) * (-1308.623) [-1304.278] (-1302.779) (-1304.607) -- 0:00:19 734500 -- [-1302.635] (-1307.205) (-1305.396) (-1303.985) * (-1308.710) (-1307.390) [-1306.801] (-1309.782) -- 0:00:19 735000 -- (-1304.714) (-1308.946) (-1304.879) [-1308.563] * [-1308.622] (-1307.645) (-1302.993) (-1308.282) -- 0:00:19 Average standard deviation of split frequencies: 0.008727 735500 -- (-1308.436) (-1309.809) (-1306.082) [-1305.521] * (-1313.022) [-1305.568] (-1305.405) (-1307.132) -- 0:00:19 736000 -- [-1303.173] (-1308.374) (-1306.070) (-1305.056) * (-1311.256) [-1308.401] (-1304.919) (-1307.009) -- 0:00:19 736500 -- [-1303.003] (-1305.947) (-1312.435) (-1308.498) * (-1311.888) [-1305.536] (-1307.198) (-1305.772) -- 0:00:19 737000 -- (-1313.136) (-1305.949) (-1308.866) [-1307.173] * (-1309.743) (-1310.013) (-1308.056) [-1304.622] -- 0:00:19 737500 -- [-1304.994] (-1309.204) (-1306.027) (-1305.249) * [-1309.263] (-1305.199) (-1316.064) (-1301.714) -- 0:00:19 738000 -- (-1308.214) (-1309.533) [-1304.609] (-1306.981) * (-1307.469) [-1306.890] (-1309.567) (-1306.874) -- 0:00:19 738500 -- (-1310.118) (-1306.210) (-1302.817) [-1304.510] * (-1313.013) (-1305.116) (-1307.099) [-1306.794] -- 0:00:19 739000 -- (-1307.215) [-1307.650] (-1306.252) (-1308.664) * (-1309.017) (-1310.398) (-1307.811) [-1304.323] -- 0:00:19 739500 -- (-1309.539) (-1306.771) [-1309.063] (-1306.711) * (-1307.520) [-1303.611] (-1307.668) (-1305.783) -- 0:00:19 740000 -- (-1306.207) (-1305.238) (-1305.697) [-1304.172] * (-1310.112) (-1308.583) (-1305.405) [-1305.696] -- 0:00:19 Average standard deviation of split frequencies: 0.008234 740500 -- (-1310.486) [-1304.072] (-1306.121) (-1306.117) * (-1309.015) [-1307.187] (-1304.082) (-1309.327) -- 0:00:19 741000 -- (-1308.032) (-1305.750) [-1305.985] (-1309.790) * (-1308.078) [-1307.757] (-1307.229) (-1308.662) -- 0:00:19 741500 -- (-1312.772) (-1305.546) (-1312.223) [-1308.377] * (-1309.917) (-1305.962) [-1307.293] (-1305.662) -- 0:00:19 742000 -- [-1308.536] (-1302.810) (-1308.447) (-1309.705) * (-1309.611) (-1308.747) (-1310.322) [-1304.936] -- 0:00:19 742500 -- (-1308.562) (-1307.842) [-1304.692] (-1303.229) * (-1309.899) (-1306.233) [-1305.129] (-1305.587) -- 0:00:19 743000 -- (-1308.086) (-1303.044) (-1306.292) [-1304.820] * [-1309.560] (-1307.875) (-1308.688) (-1308.647) -- 0:00:19 743500 -- (-1308.564) (-1308.535) [-1302.533] (-1309.385) * [-1310.616] (-1307.530) (-1311.456) (-1309.780) -- 0:00:18 744000 -- (-1308.830) (-1306.315) (-1305.213) [-1309.476] * [-1313.743] (-1306.648) (-1306.173) (-1304.670) -- 0:00:18 744500 -- [-1310.333] (-1306.501) (-1304.836) (-1307.076) * (-1314.180) [-1305.346] (-1305.410) (-1307.622) -- 0:00:18 745000 -- [-1305.543] (-1306.068) (-1309.674) (-1310.826) * (-1311.000) [-1307.053] (-1304.162) (-1302.996) -- 0:00:18 Average standard deviation of split frequencies: 0.008728 745500 -- (-1309.167) (-1310.348) [-1313.506] (-1307.403) * [-1310.800] (-1309.477) (-1307.930) (-1305.478) -- 0:00:18 746000 -- (-1308.019) (-1311.159) [-1307.376] (-1307.878) * [-1307.559] (-1309.312) (-1307.661) (-1311.105) -- 0:00:18 746500 -- (-1310.298) (-1301.992) (-1305.676) [-1306.886] * (-1309.506) (-1310.596) (-1307.222) [-1303.946] -- 0:00:18 747000 -- (-1311.726) (-1304.818) [-1306.104] (-1307.387) * [-1309.784] (-1311.206) (-1304.288) (-1310.215) -- 0:00:18 747500 -- (-1306.667) [-1303.396] (-1303.175) (-1309.823) * (-1311.499) (-1308.255) [-1303.518] (-1312.117) -- 0:00:18 748000 -- (-1309.138) (-1307.283) (-1305.764) [-1304.994] * (-1313.416) (-1309.005) [-1307.536] (-1303.939) -- 0:00:18 748500 -- [-1304.209] (-1303.895) (-1306.094) (-1303.603) * (-1311.768) (-1309.414) [-1307.297] (-1307.639) -- 0:00:18 749000 -- (-1308.372) [-1306.250] (-1307.446) (-1305.831) * [-1306.393] (-1311.517) (-1307.031) (-1308.825) -- 0:00:18 749500 -- [-1305.839] (-1304.235) (-1308.780) (-1304.860) * (-1307.152) (-1309.829) (-1309.773) [-1304.808] -- 0:00:18 750000 -- (-1311.904) (-1308.067) (-1303.622) [-1308.274] * [-1306.295] (-1306.183) (-1306.465) (-1303.815) -- 0:00:18 Average standard deviation of split frequencies: 0.008556 750500 -- (-1308.996) (-1306.698) [-1303.446] (-1310.330) * (-1307.300) (-1303.178) (-1309.239) [-1304.903] -- 0:00:18 751000 -- [-1306.125] (-1304.766) (-1306.902) (-1305.723) * (-1308.955) (-1308.610) (-1307.322) [-1304.357] -- 0:00:18 751500 -- [-1304.473] (-1307.111) (-1307.195) (-1312.356) * [-1307.682] (-1309.145) (-1309.783) (-1310.554) -- 0:00:18 752000 -- (-1306.191) (-1303.112) [-1308.852] (-1306.746) * (-1311.381) (-1306.307) [-1305.864] (-1306.006) -- 0:00:18 752500 -- (-1308.303) (-1303.067) (-1308.068) [-1306.018] * (-1307.154) [-1309.853] (-1308.085) (-1307.889) -- 0:00:18 753000 -- (-1306.600) (-1304.868) [-1304.386] (-1306.122) * (-1307.459) (-1307.162) (-1305.486) [-1305.842] -- 0:00:18 753500 -- [-1305.251] (-1304.609) (-1306.497) (-1307.302) * [-1303.394] (-1306.693) (-1310.349) (-1308.418) -- 0:00:18 754000 -- (-1307.241) (-1306.443) (-1309.623) [-1309.721] * (-1307.423) (-1307.791) (-1307.202) [-1309.929] -- 0:00:18 754500 -- (-1303.360) (-1303.874) [-1309.884] (-1306.665) * (-1306.568) (-1311.804) (-1305.258) [-1307.692] -- 0:00:18 755000 -- [-1305.422] (-1307.650) (-1304.415) (-1307.604) * (-1312.340) (-1305.439) (-1309.666) [-1302.916] -- 0:00:18 Average standard deviation of split frequencies: 0.008613 755500 -- (-1307.585) (-1304.982) (-1305.770) [-1308.967] * (-1309.781) (-1309.180) (-1306.748) [-1305.537] -- 0:00:18 756000 -- [-1306.233] (-1305.799) (-1308.584) (-1304.557) * (-1317.053) [-1303.896] (-1307.684) (-1307.328) -- 0:00:18 756500 -- [-1309.913] (-1306.705) (-1308.752) (-1307.404) * (-1309.115) (-1307.977) [-1306.237] (-1309.047) -- 0:00:18 757000 -- (-1308.448) (-1307.188) [-1308.418] (-1303.971) * (-1308.575) [-1308.585] (-1308.257) (-1304.990) -- 0:00:17 757500 -- [-1307.287] (-1307.562) (-1306.724) (-1304.761) * (-1307.764) (-1309.714) (-1308.612) [-1305.316] -- 0:00:17 758000 -- [-1305.009] (-1308.645) (-1304.829) (-1308.119) * (-1309.069) [-1304.817] (-1306.708) (-1305.687) -- 0:00:17 758500 -- [-1304.940] (-1309.464) (-1305.811) (-1309.714) * (-1310.519) [-1307.132] (-1308.768) (-1304.701) -- 0:00:17 759000 -- [-1309.412] (-1304.861) (-1305.994) (-1307.795) * (-1311.512) (-1308.144) (-1308.706) [-1303.922] -- 0:00:17 759500 -- [-1303.932] (-1309.717) (-1307.021) (-1307.362) * [-1306.701] (-1308.185) (-1306.780) (-1306.388) -- 0:00:17 760000 -- (-1308.367) (-1309.238) (-1308.035) [-1310.862] * (-1308.505) [-1308.620] (-1310.145) (-1308.609) -- 0:00:17 Average standard deviation of split frequencies: 0.008444 760500 -- [-1308.260] (-1308.440) (-1309.862) (-1306.768) * [-1306.776] (-1311.303) (-1308.824) (-1304.248) -- 0:00:17 761000 -- (-1309.650) (-1309.709) [-1304.634] (-1306.115) * (-1311.671) (-1304.717) (-1306.675) [-1307.045] -- 0:00:17 761500 -- [-1305.274] (-1307.488) (-1304.685) (-1304.689) * (-1305.862) (-1307.099) [-1304.281] (-1306.986) -- 0:00:17 762000 -- [-1302.957] (-1306.125) (-1307.175) (-1307.775) * (-1314.949) (-1309.784) (-1312.502) [-1308.026] -- 0:00:17 762500 -- (-1308.619) (-1307.110) [-1307.728] (-1306.449) * (-1313.348) [-1304.190] (-1309.636) (-1311.472) -- 0:00:17 763000 -- (-1307.729) (-1304.152) (-1311.055) [-1305.450] * [-1314.557] (-1306.718) (-1308.483) (-1311.818) -- 0:00:17 763500 -- (-1308.085) [-1302.098] (-1309.612) (-1302.785) * (-1314.207) [-1305.638] (-1309.617) (-1308.359) -- 0:00:17 764000 -- [-1303.072] (-1304.742) (-1308.554) (-1304.252) * (-1308.307) (-1308.666) (-1311.850) [-1303.710] -- 0:00:17 764500 -- [-1304.312] (-1303.606) (-1306.386) (-1304.218) * [-1304.258] (-1303.926) (-1311.849) (-1304.259) -- 0:00:17 765000 -- [-1303.397] (-1304.702) (-1306.518) (-1306.267) * [-1308.049] (-1305.501) (-1305.043) (-1309.224) -- 0:00:17 Average standard deviation of split frequencies: 0.008577 765500 -- (-1303.567) (-1305.014) (-1305.748) [-1308.421] * [-1312.943] (-1306.864) (-1306.726) (-1306.490) -- 0:00:17 766000 -- (-1306.530) (-1307.914) (-1313.627) [-1304.933] * (-1309.744) (-1307.975) (-1307.159) [-1301.568] -- 0:00:17 766500 -- (-1308.123) (-1306.860) (-1308.081) [-1307.653] * (-1307.919) [-1305.879] (-1305.291) (-1305.888) -- 0:00:17 767000 -- (-1307.538) (-1305.341) (-1306.920) [-1306.893] * (-1309.404) (-1309.227) [-1307.366] (-1306.218) -- 0:00:17 767500 -- (-1310.382) (-1307.358) [-1305.876] (-1303.811) * (-1306.154) (-1310.494) (-1306.886) [-1303.421] -- 0:00:17 768000 -- [-1308.800] (-1304.428) (-1305.474) (-1309.068) * (-1305.571) [-1310.169] (-1307.457) (-1306.173) -- 0:00:17 768500 -- (-1308.706) (-1311.999) [-1308.222] (-1309.406) * [-1305.155] (-1305.408) (-1309.137) (-1307.029) -- 0:00:17 769000 -- (-1303.903) (-1313.034) (-1310.818) [-1303.149] * (-1307.011) (-1302.427) (-1308.975) [-1307.842] -- 0:00:17 769500 -- (-1306.429) (-1311.963) (-1305.725) [-1310.134] * (-1308.350) [-1303.167] (-1306.725) (-1304.199) -- 0:00:17 770000 -- [-1302.950] (-1309.060) (-1307.858) (-1306.878) * [-1304.450] (-1304.629) (-1307.020) (-1304.133) -- 0:00:17 Average standard deviation of split frequencies: 0.009061 770500 -- (-1305.273) [-1307.798] (-1304.680) (-1305.900) * (-1305.615) (-1304.621) [-1304.226] (-1304.152) -- 0:00:16 771000 -- [-1309.228] (-1304.410) (-1306.263) (-1303.338) * [-1307.598] (-1307.338) (-1303.719) (-1303.292) -- 0:00:16 771500 -- (-1308.156) [-1305.943] (-1303.020) (-1307.202) * [-1305.093] (-1308.158) (-1303.529) (-1304.093) -- 0:00:16 772000 -- [-1306.144] (-1308.567) (-1309.921) (-1306.473) * [-1306.167] (-1307.323) (-1307.718) (-1305.036) -- 0:00:16 772500 -- (-1313.492) (-1310.178) (-1305.032) [-1305.665] * (-1308.130) (-1306.900) [-1305.881] (-1302.734) -- 0:00:16 773000 -- [-1304.749] (-1307.873) (-1304.378) (-1306.830) * (-1310.772) (-1304.976) [-1308.182] (-1304.399) -- 0:00:16 773500 -- (-1305.074) [-1306.939] (-1307.479) (-1309.703) * (-1310.602) [-1308.520] (-1308.078) (-1306.006) -- 0:00:16 774000 -- (-1309.642) (-1307.716) (-1305.766) [-1308.546] * [-1308.270] (-1304.182) (-1305.980) (-1307.554) -- 0:00:16 774500 -- (-1306.613) (-1305.545) (-1308.816) [-1308.445] * (-1307.792) (-1303.425) (-1306.018) [-1306.548] -- 0:00:16 775000 -- (-1314.778) (-1307.152) (-1307.652) [-1307.392] * (-1303.541) (-1304.393) (-1306.524) [-1303.802] -- 0:00:16 Average standard deviation of split frequencies: 0.009606 775500 -- (-1307.050) (-1303.860) [-1307.811] (-1309.413) * (-1308.568) (-1303.295) (-1310.656) [-1304.312] -- 0:00:16 776000 -- (-1306.963) (-1307.066) [-1305.405] (-1308.383) * [-1303.636] (-1306.878) (-1306.397) (-1302.911) -- 0:00:16 776500 -- (-1307.738) [-1303.329] (-1309.064) (-1312.498) * (-1304.082) [-1306.334] (-1306.490) (-1308.053) -- 0:00:16 777000 -- (-1308.309) (-1305.842) (-1303.363) [-1308.557] * (-1309.566) (-1305.895) (-1309.073) [-1301.324] -- 0:00:16 777500 -- (-1302.737) (-1304.443) [-1306.879] (-1309.882) * (-1309.305) (-1305.292) (-1307.158) [-1311.680] -- 0:00:16 778000 -- (-1306.396) (-1307.009) (-1307.522) [-1310.484] * (-1310.333) (-1304.430) (-1303.764) [-1304.874] -- 0:00:16 778500 -- (-1312.923) (-1304.632) (-1307.371) [-1307.674] * (-1309.568) (-1307.251) [-1304.313] (-1307.467) -- 0:00:16 779000 -- (-1306.689) (-1306.434) [-1305.285] (-1305.177) * (-1306.308) (-1304.343) (-1304.403) [-1304.573] -- 0:00:16 779500 -- (-1311.672) [-1306.794] (-1302.300) (-1308.340) * [-1305.676] (-1302.361) (-1305.968) (-1303.434) -- 0:00:16 780000 -- [-1304.972] (-1305.485) (-1310.373) (-1309.510) * (-1308.598) [-1303.136] (-1302.903) (-1305.516) -- 0:00:16 Average standard deviation of split frequencies: 0.009624 780500 -- (-1303.922) [-1303.241] (-1307.110) (-1311.510) * (-1314.143) (-1306.611) (-1303.709) [-1306.195] -- 0:00:16 781000 -- (-1309.492) (-1304.829) [-1304.445] (-1311.407) * (-1309.053) [-1306.538] (-1306.478) (-1306.965) -- 0:00:16 781500 -- [-1302.826] (-1311.655) (-1304.447) (-1308.138) * (-1307.541) (-1303.522) (-1306.454) [-1306.947] -- 0:00:16 782000 -- (-1303.030) (-1308.898) [-1304.283] (-1305.503) * (-1307.800) (-1307.374) (-1306.812) [-1300.979] -- 0:00:16 782500 -- [-1308.621] (-1303.470) (-1305.145) (-1313.503) * (-1310.618) [-1305.856] (-1306.248) (-1310.542) -- 0:00:16 783000 -- (-1303.619) [-1304.777] (-1303.913) (-1307.915) * [-1310.475] (-1306.814) (-1309.814) (-1310.642) -- 0:00:16 783500 -- [-1308.416] (-1304.472) (-1302.686) (-1312.471) * (-1311.289) (-1306.690) [-1309.690] (-1307.636) -- 0:00:16 784000 -- (-1304.034) [-1303.615] (-1305.493) (-1305.472) * (-1310.762) [-1306.289] (-1307.109) (-1308.349) -- 0:00:15 784500 -- (-1306.053) (-1305.319) [-1304.888] (-1307.619) * [-1309.558] (-1305.145) (-1305.264) (-1311.728) -- 0:00:15 785000 -- (-1306.362) (-1310.137) [-1304.414] (-1304.182) * (-1306.926) (-1305.145) [-1306.673] (-1305.657) -- 0:00:15 Average standard deviation of split frequencies: 0.009746 785500 -- [-1303.458] (-1307.672) (-1311.621) (-1307.368) * (-1306.921) (-1306.904) [-1307.816] (-1307.081) -- 0:00:15 786000 -- (-1304.441) [-1309.809] (-1307.613) (-1305.153) * (-1304.689) (-1309.349) (-1306.467) [-1309.517] -- 0:00:15 786500 -- (-1307.253) (-1304.801) [-1308.546] (-1313.184) * (-1305.154) (-1308.328) (-1309.668) [-1306.133] -- 0:00:15 787000 -- (-1307.805) (-1303.562) (-1311.067) [-1315.688] * (-1304.473) [-1309.717] (-1308.210) (-1308.340) -- 0:00:15 787500 -- (-1307.389) (-1303.705) (-1306.818) [-1307.639] * (-1304.255) [-1308.116] (-1308.382) (-1304.499) -- 0:00:15 788000 -- [-1305.668] (-1308.626) (-1310.268) (-1308.959) * [-1305.457] (-1311.483) (-1308.315) (-1310.858) -- 0:00:15 788500 -- (-1308.420) (-1310.535) [-1308.996] (-1308.069) * (-1304.354) [-1304.364] (-1309.817) (-1313.672) -- 0:00:15 789000 -- (-1309.348) (-1304.552) (-1304.168) [-1306.627] * [-1305.902] (-1304.985) (-1306.791) (-1310.575) -- 0:00:15 789500 -- (-1305.249) [-1309.109] (-1307.610) (-1306.824) * (-1307.868) (-1302.410) [-1311.032] (-1304.513) -- 0:00:15 790000 -- (-1306.407) [-1305.796] (-1307.772) (-1304.992) * (-1305.216) (-1305.820) [-1307.421] (-1307.412) -- 0:00:15 Average standard deviation of split frequencies: 0.010024 790500 -- (-1308.574) [-1306.306] (-1305.939) (-1304.813) * (-1312.684) (-1306.944) [-1305.624] (-1308.571) -- 0:00:15 791000 -- (-1310.226) (-1307.163) (-1304.136) [-1311.941] * [-1308.933] (-1306.010) (-1306.519) (-1305.774) -- 0:00:15 791500 -- (-1309.524) (-1308.167) [-1304.678] (-1308.305) * (-1312.034) (-1309.531) (-1306.404) [-1304.005] -- 0:00:15 792000 -- (-1306.866) (-1307.996) [-1305.634] (-1311.603) * (-1306.743) (-1307.881) (-1306.954) [-1307.901] -- 0:00:15 792500 -- (-1310.198) (-1308.090) [-1309.347] (-1314.276) * [-1308.424] (-1307.466) (-1305.167) (-1313.564) -- 0:00:15 793000 -- (-1303.101) (-1309.444) [-1307.651] (-1308.734) * [-1304.890] (-1308.759) (-1306.597) (-1306.670) -- 0:00:15 793500 -- (-1303.815) (-1305.806) (-1309.041) [-1306.306] * (-1307.995) (-1306.333) [-1306.920] (-1310.119) -- 0:00:15 794000 -- (-1306.795) (-1306.832) (-1311.003) [-1311.323] * (-1307.720) [-1305.158] (-1306.511) (-1314.033) -- 0:00:15 794500 -- (-1306.024) [-1304.447] (-1308.927) (-1309.056) * (-1307.433) [-1307.881] (-1307.950) (-1310.115) -- 0:00:15 795000 -- (-1311.712) [-1305.801] (-1308.594) (-1308.746) * (-1308.733) [-1308.661] (-1307.706) (-1307.724) -- 0:00:15 Average standard deviation of split frequencies: 0.010142 795500 -- [-1304.758] (-1305.081) (-1305.769) (-1307.991) * (-1308.140) (-1306.033) (-1304.131) [-1311.894] -- 0:00:15 796000 -- (-1306.357) (-1307.599) (-1309.623) [-1307.161] * (-1306.398) (-1309.622) [-1306.594] (-1309.242) -- 0:00:15 796500 -- [-1306.832] (-1303.996) (-1307.300) (-1307.202) * [-1303.817] (-1305.501) (-1305.127) (-1309.195) -- 0:00:15 797000 -- (-1307.385) [-1306.288] (-1305.504) (-1308.545) * (-1309.326) (-1306.792) (-1305.597) [-1308.690] -- 0:00:15 797500 -- [-1307.911] (-1305.264) (-1306.565) (-1307.844) * [-1303.759] (-1304.798) (-1304.434) (-1305.087) -- 0:00:14 798000 -- [-1304.854] (-1306.344) (-1312.407) (-1309.094) * [-1306.526] (-1312.722) (-1302.821) (-1308.599) -- 0:00:14 798500 -- (-1308.972) [-1303.440] (-1304.429) (-1308.878) * (-1305.201) [-1306.533] (-1306.415) (-1308.119) -- 0:00:14 799000 -- (-1312.676) (-1311.291) (-1305.290) [-1304.751] * (-1310.053) [-1305.221] (-1303.581) (-1309.890) -- 0:00:14 799500 -- (-1306.774) (-1304.565) (-1308.264) [-1304.690] * (-1306.961) (-1305.482) [-1304.907] (-1311.745) -- 0:00:14 800000 -- (-1309.265) [-1304.133] (-1312.132) (-1304.537) * (-1307.267) [-1304.645] (-1303.023) (-1311.123) -- 0:00:14 Average standard deviation of split frequencies: 0.010559 800500 -- (-1308.741) (-1311.390) (-1309.970) [-1306.132] * [-1306.722] (-1305.550) (-1306.026) (-1309.455) -- 0:00:14 801000 -- [-1305.674] (-1310.329) (-1312.132) (-1311.588) * (-1305.314) [-1310.870] (-1303.377) (-1308.268) -- 0:00:14 801500 -- (-1311.475) (-1303.274) (-1308.248) [-1304.593] * (-1305.664) (-1306.767) (-1307.193) [-1307.916] -- 0:00:14 802000 -- [-1309.943] (-1305.164) (-1304.806) (-1310.118) * (-1304.324) (-1312.228) [-1305.180] (-1308.523) -- 0:00:14 802500 -- (-1309.831) [-1310.273] (-1307.642) (-1311.387) * (-1306.471) (-1305.227) [-1304.968] (-1310.300) -- 0:00:14 803000 -- (-1315.485) (-1306.909) (-1310.735) [-1305.329] * (-1314.645) [-1305.613] (-1303.458) (-1312.249) -- 0:00:14 803500 -- (-1312.479) (-1306.729) (-1310.168) [-1306.228] * (-1306.841) (-1306.121) (-1306.050) [-1306.846] -- 0:00:14 804000 -- (-1310.461) (-1305.118) [-1307.920] (-1306.863) * (-1306.198) [-1306.715] (-1305.833) (-1304.075) -- 0:00:14 804500 -- [-1306.562] (-1305.363) (-1306.772) (-1303.903) * (-1305.762) [-1306.394] (-1308.533) (-1307.452) -- 0:00:14 805000 -- (-1311.028) (-1304.174) (-1306.459) [-1306.991] * (-1303.583) (-1306.477) (-1309.617) [-1306.622] -- 0:00:14 Average standard deviation of split frequencies: 0.010606 805500 -- (-1305.979) [-1305.217] (-1306.585) (-1306.857) * (-1308.127) [-1312.145] (-1306.644) (-1307.644) -- 0:00:14 806000 -- [-1308.453] (-1303.800) (-1306.944) (-1303.066) * (-1308.024) [-1305.154] (-1304.780) (-1305.942) -- 0:00:14 806500 -- (-1313.465) (-1302.384) (-1306.410) [-1305.226] * (-1307.042) (-1306.534) (-1307.542) [-1306.720] -- 0:00:14 807000 -- (-1309.664) [-1306.257] (-1310.282) (-1308.517) * (-1302.932) (-1308.250) (-1304.129) [-1307.744] -- 0:00:14 807500 -- (-1306.839) (-1307.179) (-1310.299) [-1304.019] * [-1305.952] (-1311.682) (-1303.237) (-1305.582) -- 0:00:14 808000 -- (-1308.850) [-1300.064] (-1304.819) (-1302.714) * (-1308.914) [-1304.188] (-1309.271) (-1304.970) -- 0:00:14 808500 -- (-1311.820) (-1305.550) (-1304.178) [-1303.335] * [-1307.281] (-1304.129) (-1304.144) (-1304.973) -- 0:00:14 809000 -- [-1310.098] (-1310.902) (-1307.719) (-1304.410) * (-1309.639) (-1305.568) [-1303.452] (-1303.101) -- 0:00:14 809500 -- [-1306.382] (-1305.613) (-1307.438) (-1306.156) * (-1310.254) (-1304.706) (-1307.965) [-1305.905] -- 0:00:14 810000 -- (-1305.571) (-1303.680) [-1307.783] (-1303.694) * [-1308.916] (-1306.494) (-1301.591) (-1308.747) -- 0:00:14 Average standard deviation of split frequencies: 0.010506 810500 -- (-1307.708) (-1304.011) (-1304.670) [-1308.146] * (-1307.923) (-1304.555) [-1305.064] (-1306.796) -- 0:00:14 811000 -- (-1308.416) [-1306.340] (-1307.028) (-1304.612) * (-1310.011) (-1303.515) [-1305.652] (-1302.401) -- 0:00:13 811500 -- [-1304.753] (-1308.120) (-1306.361) (-1309.518) * (-1307.795) (-1303.630) [-1303.167] (-1308.300) -- 0:00:13 812000 -- (-1310.055) (-1306.533) [-1305.818] (-1307.419) * [-1306.905] (-1307.662) (-1301.027) (-1304.790) -- 0:00:13 812500 -- (-1309.658) (-1306.952) [-1307.454] (-1304.716) * (-1308.608) [-1304.115] (-1308.324) (-1314.702) -- 0:00:13 813000 -- (-1313.579) (-1309.340) (-1307.049) [-1308.310] * (-1306.947) (-1306.270) (-1304.537) [-1306.517] -- 0:00:13 813500 -- (-1308.467) [-1305.160] (-1305.733) (-1309.512) * (-1305.903) (-1306.532) (-1306.398) [-1304.391] -- 0:00:13 814000 -- [-1305.935] (-1310.616) (-1310.316) (-1310.505) * [-1309.912] (-1309.614) (-1308.854) (-1307.809) -- 0:00:13 814500 -- (-1306.279) (-1307.920) [-1307.313] (-1308.948) * (-1305.917) [-1306.992] (-1308.140) (-1307.716) -- 0:00:13 815000 -- (-1306.925) (-1308.800) (-1311.784) [-1306.050] * (-1308.708) [-1307.797] (-1305.975) (-1304.677) -- 0:00:13 Average standard deviation of split frequencies: 0.010168 815500 -- (-1308.831) [-1304.662] (-1314.938) (-1309.200) * (-1304.758) (-1308.760) (-1306.142) [-1304.372] -- 0:00:13 816000 -- (-1306.888) [-1305.590] (-1307.979) (-1306.707) * (-1305.063) (-1305.441) [-1306.667] (-1304.374) -- 0:00:13 816500 -- (-1306.705) [-1308.275] (-1307.651) (-1306.371) * (-1306.257) (-1305.884) [-1304.027] (-1306.564) -- 0:00:13 817000 -- (-1309.063) (-1310.558) (-1307.239) [-1311.085] * [-1309.117] (-1314.942) (-1305.459) (-1308.221) -- 0:00:13 817500 -- (-1308.852) (-1305.626) (-1308.650) [-1304.934] * (-1308.994) [-1306.501] (-1309.032) (-1306.157) -- 0:00:13 818000 -- (-1307.284) (-1308.716) [-1305.674] (-1306.265) * (-1305.201) [-1304.896] (-1307.765) (-1309.504) -- 0:00:13 818500 -- (-1305.377) (-1305.479) (-1305.624) [-1303.805] * (-1306.321) (-1311.048) [-1303.709] (-1310.716) -- 0:00:13 819000 -- [-1303.020] (-1307.705) (-1310.107) (-1311.915) * [-1304.207] (-1312.533) (-1308.483) (-1307.502) -- 0:00:13 819500 -- (-1305.918) (-1311.057) [-1307.414] (-1304.354) * (-1304.921) (-1310.503) [-1306.446] (-1306.035) -- 0:00:13 820000 -- (-1309.699) [-1307.231] (-1302.944) (-1304.570) * (-1303.787) (-1305.924) (-1306.480) [-1307.843] -- 0:00:13 Average standard deviation of split frequencies: 0.009918 820500 -- (-1307.698) (-1308.357) (-1304.351) [-1303.975] * [-1307.096] (-1304.793) (-1307.701) (-1305.452) -- 0:00:13 821000 -- [-1306.313] (-1306.268) (-1306.397) (-1312.026) * (-1306.849) (-1305.614) [-1308.091] (-1302.316) -- 0:00:13 821500 -- [-1309.909] (-1308.467) (-1305.152) (-1305.153) * (-1302.817) [-1301.942] (-1308.015) (-1304.206) -- 0:00:13 822000 -- (-1306.739) (-1308.891) (-1306.064) [-1304.544] * [-1303.167] (-1305.104) (-1308.770) (-1305.847) -- 0:00:13 822500 -- (-1309.038) (-1306.592) (-1308.868) [-1306.978] * (-1305.861) [-1305.478] (-1308.180) (-1305.334) -- 0:00:13 823000 -- (-1310.282) [-1305.784] (-1306.194) (-1304.255) * [-1303.818] (-1307.371) (-1306.345) (-1306.228) -- 0:00:13 823500 -- [-1315.379] (-1311.542) (-1307.457) (-1307.294) * (-1306.675) (-1303.860) [-1305.103] (-1307.451) -- 0:00:13 824000 -- (-1312.923) (-1306.942) (-1304.062) [-1307.415] * (-1303.513) (-1303.332) [-1308.682] (-1307.988) -- 0:00:13 824500 -- (-1308.060) (-1306.791) [-1304.722] (-1306.030) * (-1305.337) [-1301.654] (-1301.566) (-1310.390) -- 0:00:12 825000 -- (-1308.440) [-1306.527] (-1308.572) (-1303.730) * (-1308.111) (-1308.710) [-1310.020] (-1304.880) -- 0:00:12 Average standard deviation of split frequencies: 0.010159 825500 -- (-1309.268) [-1309.913] (-1310.510) (-1306.558) * (-1304.714) (-1305.230) [-1304.720] (-1308.103) -- 0:00:12 826000 -- (-1315.241) [-1302.755] (-1307.969) (-1305.288) * (-1305.702) (-1308.060) [-1308.958] (-1304.136) -- 0:00:12 826500 -- (-1306.818) [-1305.811] (-1311.873) (-1305.866) * (-1306.973) [-1305.371] (-1308.608) (-1307.812) -- 0:00:12 827000 -- (-1307.623) [-1303.071] (-1310.530) (-1304.315) * (-1309.924) (-1309.839) (-1309.264) [-1305.237] -- 0:00:12 827500 -- [-1306.334] (-1307.754) (-1308.578) (-1308.523) * [-1310.215] (-1304.818) (-1307.316) (-1306.439) -- 0:00:12 828000 -- (-1303.560) (-1306.185) (-1311.628) [-1304.646] * (-1311.432) [-1304.992] (-1305.490) (-1309.991) -- 0:00:12 828500 -- [-1306.968] (-1308.833) (-1309.770) (-1311.591) * (-1306.871) (-1306.378) [-1304.438] (-1314.684) -- 0:00:12 829000 -- [-1307.606] (-1304.693) (-1310.865) (-1310.078) * (-1311.031) (-1315.335) (-1310.890) [-1305.853] -- 0:00:12 829500 -- (-1308.333) [-1304.925] (-1310.144) (-1303.763) * (-1308.331) [-1306.472] (-1308.316) (-1310.117) -- 0:00:12 830000 -- [-1312.301] (-1305.627) (-1306.060) (-1306.755) * [-1305.111] (-1308.140) (-1309.249) (-1304.233) -- 0:00:12 Average standard deviation of split frequencies: 0.010177 830500 -- (-1310.600) (-1308.664) (-1310.131) [-1311.048] * (-1305.299) [-1305.889] (-1305.731) (-1306.980) -- 0:00:12 831000 -- [-1303.485] (-1308.079) (-1301.992) (-1307.027) * (-1308.151) (-1307.884) [-1306.805] (-1304.316) -- 0:00:12 831500 -- (-1308.215) [-1304.763] (-1307.467) (-1304.454) * (-1304.939) [-1309.421] (-1307.027) (-1308.983) -- 0:00:12 832000 -- [-1308.626] (-1304.930) (-1307.823) (-1306.975) * (-1307.863) [-1304.526] (-1307.722) (-1304.753) -- 0:00:12 832500 -- (-1306.117) (-1308.059) (-1307.257) [-1306.468] * (-1312.077) [-1306.329] (-1311.139) (-1307.118) -- 0:00:12 833000 -- (-1305.345) (-1308.798) (-1304.738) [-1304.532] * (-1307.513) (-1306.137) [-1306.887] (-1304.264) -- 0:00:12 833500 -- [-1310.144] (-1308.097) (-1308.584) (-1307.296) * (-1307.848) [-1306.976] (-1305.243) (-1307.184) -- 0:00:12 834000 -- (-1313.950) (-1303.487) (-1309.268) [-1304.311] * [-1306.565] (-1305.859) (-1302.792) (-1303.630) -- 0:00:12 834500 -- (-1308.425) (-1306.368) (-1306.643) [-1306.126] * (-1307.468) (-1305.232) [-1307.809] (-1305.898) -- 0:00:12 835000 -- [-1310.758] (-1307.511) (-1307.901) (-1305.441) * [-1304.783] (-1307.145) (-1302.897) (-1307.721) -- 0:00:12 Average standard deviation of split frequencies: 0.010451 835500 -- (-1304.385) (-1309.766) (-1307.569) [-1304.932] * [-1303.301] (-1306.521) (-1307.787) (-1310.520) -- 0:00:12 836000 -- [-1306.104] (-1305.924) (-1307.810) (-1306.747) * (-1308.057) (-1307.222) (-1310.170) [-1305.692] -- 0:00:12 836500 -- (-1309.072) (-1307.108) (-1309.922) [-1309.552] * (-1310.153) [-1306.541] (-1304.665) (-1308.291) -- 0:00:12 837000 -- [-1306.473] (-1304.876) (-1308.563) (-1310.478) * (-1307.826) [-1304.061] (-1307.711) (-1306.626) -- 0:00:12 837500 -- [-1304.248] (-1304.053) (-1307.130) (-1309.426) * (-1309.660) [-1308.215] (-1307.312) (-1306.408) -- 0:00:12 838000 -- (-1308.204) (-1309.045) (-1307.601) [-1309.202] * (-1310.434) [-1303.769] (-1303.528) (-1306.286) -- 0:00:11 838500 -- [-1306.263] (-1308.760) (-1308.425) (-1310.491) * (-1310.556) (-1304.543) (-1307.456) [-1310.198] -- 0:00:11 839000 -- (-1307.602) [-1306.812] (-1310.674) (-1305.692) * (-1308.909) (-1306.488) (-1312.123) [-1306.767] -- 0:00:11 839500 -- [-1304.897] (-1307.875) (-1310.641) (-1307.644) * (-1307.657) [-1308.024] (-1305.222) (-1304.542) -- 0:00:11 840000 -- [-1305.339] (-1308.372) (-1304.315) (-1306.307) * (-1304.843) [-1307.299] (-1309.815) (-1304.361) -- 0:00:11 Average standard deviation of split frequencies: 0.010692 840500 -- (-1303.979) (-1305.417) (-1307.973) [-1304.208] * (-1311.646) (-1305.144) (-1310.419) [-1303.584] -- 0:00:11 841000 -- (-1307.965) (-1306.813) (-1311.042) [-1309.464] * (-1310.903) [-1301.882] (-1309.813) (-1306.711) -- 0:00:11 841500 -- [-1305.016] (-1304.273) (-1307.951) (-1305.420) * (-1306.718) (-1302.497) [-1303.498] (-1311.064) -- 0:00:11 842000 -- (-1310.935) (-1305.962) (-1313.383) [-1308.352] * (-1309.594) (-1304.751) (-1304.056) [-1304.968] -- 0:00:11 842500 -- (-1305.720) (-1304.348) (-1306.093) [-1306.571] * (-1308.887) (-1304.439) [-1303.615] (-1305.369) -- 0:00:11 843000 -- (-1304.231) (-1305.540) [-1306.395] (-1303.608) * (-1305.033) [-1306.801] (-1304.848) (-1309.393) -- 0:00:11 843500 -- (-1303.393) (-1302.870) [-1309.743] (-1307.966) * (-1310.225) (-1304.175) [-1305.542] (-1310.978) -- 0:00:11 844000 -- (-1305.817) (-1303.231) [-1309.557] (-1307.760) * (-1308.614) [-1301.920] (-1303.201) (-1306.922) -- 0:00:11 844500 -- (-1309.615) [-1308.968] (-1307.970) (-1307.903) * (-1309.325) (-1306.243) (-1303.791) [-1308.100] -- 0:00:11 845000 -- (-1305.909) (-1306.153) [-1309.473] (-1305.221) * (-1311.150) (-1304.736) [-1308.161] (-1309.274) -- 0:00:11 Average standard deviation of split frequencies: 0.010699 845500 -- [-1301.892] (-1306.908) (-1309.652) (-1305.426) * [-1308.201] (-1307.769) (-1303.836) (-1311.785) -- 0:00:11 846000 -- (-1307.446) [-1305.431] (-1314.638) (-1307.648) * (-1310.274) (-1305.381) (-1309.166) [-1307.184] -- 0:00:11 846500 -- (-1307.132) [-1305.099] (-1311.073) (-1304.918) * (-1311.054) [-1305.046] (-1306.520) (-1307.555) -- 0:00:11 847000 -- [-1304.217] (-1308.051) (-1310.900) (-1307.304) * (-1308.417) (-1303.869) (-1306.684) [-1305.574] -- 0:00:11 847500 -- (-1308.713) [-1304.982] (-1312.961) (-1303.355) * (-1307.714) [-1302.804] (-1305.908) (-1309.380) -- 0:00:11 848000 -- [-1304.449] (-1303.510) (-1309.188) (-1304.831) * (-1310.798) (-1305.903) (-1308.007) [-1305.711] -- 0:00:11 848500 -- (-1303.698) (-1305.859) (-1310.332) [-1307.043] * (-1309.827) (-1308.471) [-1312.307] (-1305.759) -- 0:00:11 849000 -- (-1305.296) [-1304.972] (-1308.963) (-1304.236) * (-1314.013) [-1306.878] (-1306.991) (-1304.324) -- 0:00:11 849500 -- [-1309.670] (-1306.527) (-1309.219) (-1308.561) * (-1307.041) [-1304.268] (-1303.349) (-1310.436) -- 0:00:11 850000 -- (-1308.993) [-1304.363] (-1312.348) (-1310.486) * (-1309.657) [-1303.825] (-1308.009) (-1313.451) -- 0:00:11 Average standard deviation of split frequencies: 0.010677 850500 -- (-1311.219) (-1303.662) (-1309.671) [-1307.947] * (-1308.717) (-1304.021) (-1301.700) [-1304.910] -- 0:00:11 851000 -- [-1308.873] (-1307.332) (-1305.286) (-1308.470) * [-1308.967] (-1305.022) (-1310.417) (-1304.851) -- 0:00:11 851500 -- (-1304.719) [-1305.923] (-1306.921) (-1308.846) * (-1308.578) (-1305.479) [-1305.699] (-1304.058) -- 0:00:10 852000 -- [-1305.421] (-1307.652) (-1301.665) (-1308.394) * (-1309.838) (-1308.485) (-1306.203) [-1303.018] -- 0:00:10 852500 -- (-1305.304) (-1306.143) (-1307.721) [-1305.258] * (-1312.093) (-1306.270) [-1308.676] (-1309.243) -- 0:00:10 853000 -- (-1306.876) [-1305.646] (-1306.200) (-1316.191) * (-1310.207) (-1308.371) (-1306.672) [-1305.932] -- 0:00:10 853500 -- (-1310.492) [-1307.511] (-1306.217) (-1305.245) * (-1309.541) (-1304.371) [-1308.268] (-1305.442) -- 0:00:10 854000 -- (-1305.576) [-1307.025] (-1307.492) (-1307.635) * [-1309.669] (-1308.174) (-1305.910) (-1305.771) -- 0:00:10 854500 -- (-1307.705) (-1307.694) [-1304.208] (-1312.250) * [-1309.295] (-1303.258) (-1305.503) (-1305.578) -- 0:00:10 855000 -- [-1305.670] (-1307.178) (-1304.936) (-1308.512) * (-1311.390) (-1305.023) (-1304.469) [-1306.873] -- 0:00:10 Average standard deviation of split frequencies: 0.010463 855500 -- (-1308.997) (-1308.297) (-1309.167) [-1305.833] * (-1303.530) (-1308.466) [-1305.420] (-1305.982) -- 0:00:10 856000 -- (-1307.960) (-1305.646) [-1309.054] (-1305.957) * [-1306.852] (-1307.910) (-1307.593) (-1304.951) -- 0:00:10 856500 -- (-1310.684) (-1307.343) (-1304.504) [-1303.291] * (-1305.443) (-1307.691) [-1309.304] (-1306.774) -- 0:00:10 857000 -- (-1308.387) [-1303.983] (-1311.032) (-1304.753) * [-1304.215] (-1306.940) (-1304.306) (-1304.785) -- 0:00:10 857500 -- (-1315.409) (-1306.975) [-1305.833] (-1305.870) * (-1310.734) (-1305.814) (-1307.366) [-1302.971] -- 0:00:10 858000 -- (-1312.291) (-1306.325) (-1306.701) [-1305.897] * (-1309.808) (-1305.349) [-1306.558] (-1305.152) -- 0:00:10 858500 -- (-1308.405) (-1307.699) [-1307.158] (-1304.504) * (-1309.101) (-1308.421) (-1306.590) [-1303.676] -- 0:00:10 859000 -- [-1307.488] (-1305.693) (-1313.351) (-1309.927) * (-1309.291) (-1306.733) (-1306.014) [-1305.778] -- 0:00:10 859500 -- (-1306.998) [-1306.944] (-1305.789) (-1304.569) * (-1308.213) (-1306.754) [-1308.651] (-1309.118) -- 0:00:10 860000 -- (-1308.240) (-1305.859) (-1313.140) [-1305.205] * (-1310.932) (-1306.357) [-1302.936] (-1306.776) -- 0:00:10 Average standard deviation of split frequencies: 0.010407 860500 -- (-1306.555) [-1303.470] (-1307.827) (-1307.949) * (-1311.618) [-1305.187] (-1303.637) (-1313.042) -- 0:00:10 861000 -- (-1306.419) [-1304.585] (-1305.296) (-1305.013) * (-1318.302) [-1313.643] (-1309.500) (-1309.258) -- 0:00:10 861500 -- (-1303.960) (-1303.947) [-1305.404] (-1308.606) * (-1313.028) (-1309.186) (-1307.897) [-1308.630] -- 0:00:10 862000 -- (-1307.857) (-1309.476) [-1308.048] (-1305.917) * [-1311.332] (-1303.588) (-1303.234) (-1310.082) -- 0:00:10 862500 -- (-1306.405) (-1307.199) (-1304.869) [-1305.417] * (-1310.192) (-1303.513) (-1306.457) [-1305.619] -- 0:00:10 863000 -- (-1305.079) (-1308.294) (-1303.990) [-1305.864] * (-1310.514) (-1302.057) [-1303.791] (-1307.037) -- 0:00:10 863500 -- (-1307.956) (-1306.485) [-1307.390] (-1310.113) * (-1309.110) (-1306.159) (-1306.105) [-1305.632] -- 0:00:10 864000 -- [-1305.846] (-1307.256) (-1308.785) (-1313.187) * (-1304.572) (-1305.763) [-1304.378] (-1301.956) -- 0:00:10 864500 -- (-1307.375) [-1305.015] (-1306.557) (-1310.210) * (-1307.522) [-1306.711] (-1306.577) (-1312.355) -- 0:00:10 865000 -- (-1308.732) [-1311.281] (-1304.824) (-1312.449) * [-1303.852] (-1304.213) (-1305.838) (-1308.144) -- 0:00:09 Average standard deviation of split frequencies: 0.010052 865500 -- (-1306.420) [-1308.136] (-1302.260) (-1311.444) * (-1303.542) (-1308.292) [-1306.982] (-1305.872) -- 0:00:09 866000 -- [-1306.322] (-1304.710) (-1307.875) (-1306.155) * [-1302.874] (-1313.027) (-1308.875) (-1309.588) -- 0:00:09 866500 -- (-1303.071) (-1301.751) [-1304.747] (-1304.966) * (-1305.049) [-1311.026] (-1308.576) (-1305.769) -- 0:00:09 867000 -- [-1304.950] (-1310.582) (-1307.023) (-1305.067) * (-1304.077) (-1308.322) (-1307.330) [-1305.697] -- 0:00:09 867500 -- [-1305.662] (-1307.985) (-1306.631) (-1306.675) * (-1309.364) (-1311.917) (-1304.413) [-1305.086] -- 0:00:09 868000 -- (-1308.718) (-1304.556) [-1304.678] (-1312.178) * [-1305.610] (-1305.898) (-1310.232) (-1304.535) -- 0:00:09 868500 -- (-1309.855) (-1304.376) [-1310.035] (-1309.001) * (-1309.362) (-1302.479) (-1306.910) [-1305.123] -- 0:00:09 869000 -- (-1304.025) [-1304.732] (-1310.264) (-1309.584) * (-1308.875) (-1310.599) [-1305.149] (-1304.087) -- 0:00:09 869500 -- [-1305.296] (-1308.027) (-1308.945) (-1308.615) * (-1307.084) (-1308.490) [-1301.168] (-1306.957) -- 0:00:09 870000 -- [-1306.565] (-1306.537) (-1305.823) (-1302.685) * (-1308.985) (-1305.837) [-1305.013] (-1304.153) -- 0:00:09 Average standard deviation of split frequencies: 0.009890 870500 -- [-1304.661] (-1305.595) (-1305.610) (-1304.784) * (-1308.583) (-1306.548) [-1302.518] (-1308.794) -- 0:00:09 871000 -- (-1307.346) (-1304.809) [-1305.483] (-1306.074) * (-1309.106) [-1308.106] (-1306.489) (-1311.891) -- 0:00:09 871500 -- [-1307.631] (-1308.478) (-1303.557) (-1307.243) * [-1305.221] (-1306.360) (-1307.290) (-1306.065) -- 0:00:09 872000 -- (-1311.003) (-1305.135) (-1307.084) [-1304.414] * [-1304.823] (-1305.721) (-1307.110) (-1311.907) -- 0:00:09 872500 -- (-1305.467) (-1305.038) [-1306.493] (-1307.070) * (-1304.124) (-1310.751) (-1308.369) [-1306.256] -- 0:00:09 873000 -- (-1306.996) (-1311.552) (-1307.438) [-1304.870] * (-1307.864) [-1306.531] (-1307.171) (-1307.721) -- 0:00:09 873500 -- (-1305.139) (-1305.311) (-1303.146) [-1305.866] * (-1309.363) [-1303.951] (-1306.224) (-1303.881) -- 0:00:09 874000 -- (-1307.795) [-1306.126] (-1311.662) (-1309.571) * [-1304.349] (-1307.765) (-1307.075) (-1307.751) -- 0:00:09 874500 -- (-1306.974) (-1305.108) (-1309.135) [-1304.209] * (-1309.386) (-1303.686) (-1309.871) [-1303.512] -- 0:00:09 875000 -- (-1309.374) [-1310.329] (-1306.272) (-1307.512) * [-1304.050] (-1305.498) (-1313.479) (-1306.271) -- 0:00:09 Average standard deviation of split frequencies: 0.010081 875500 -- (-1303.976) (-1307.387) (-1306.502) [-1301.334] * (-1306.852) (-1306.289) (-1314.252) [-1306.551] -- 0:00:09 876000 -- (-1309.869) (-1307.982) (-1308.556) [-1302.770] * (-1307.301) [-1307.354] (-1311.292) (-1307.661) -- 0:00:09 876500 -- (-1304.138) (-1309.467) (-1308.270) [-1301.163] * (-1308.431) (-1307.940) [-1306.227] (-1305.650) -- 0:00:09 877000 -- [-1305.961] (-1305.140) (-1306.209) (-1310.110) * [-1304.858] (-1308.348) (-1304.447) (-1305.456) -- 0:00:09 877500 -- (-1305.184) (-1305.044) [-1302.364] (-1306.849) * (-1308.093) [-1310.179] (-1303.323) (-1310.007) -- 0:00:09 878000 -- (-1306.115) (-1303.081) [-1304.270] (-1305.806) * (-1313.779) (-1309.713) [-1310.345] (-1302.359) -- 0:00:09 878500 -- [-1307.103] (-1308.870) (-1309.914) (-1303.546) * (-1304.055) (-1310.183) [-1309.301] (-1307.933) -- 0:00:08 879000 -- (-1310.201) (-1306.072) [-1305.139] (-1307.333) * [-1305.230] (-1308.739) (-1307.231) (-1305.004) -- 0:00:08 879500 -- [-1304.352] (-1305.055) (-1306.747) (-1307.298) * [-1307.023] (-1307.651) (-1303.419) (-1304.434) -- 0:00:08 880000 -- (-1305.731) (-1310.861) (-1306.931) [-1308.532] * [-1305.849] (-1309.543) (-1307.236) (-1304.306) -- 0:00:08 Average standard deviation of split frequencies: 0.009706 880500 -- (-1307.032) [-1306.110] (-1311.034) (-1303.866) * [-1306.265] (-1309.378) (-1308.715) (-1306.494) -- 0:00:08 881000 -- (-1308.170) [-1304.824] (-1307.753) (-1302.583) * [-1305.330] (-1305.696) (-1305.862) (-1306.349) -- 0:00:08 881500 -- (-1310.826) [-1305.809] (-1305.894) (-1305.447) * (-1306.062) [-1306.981] (-1311.211) (-1306.489) -- 0:00:08 882000 -- (-1308.898) (-1304.176) [-1304.920] (-1302.760) * (-1306.825) (-1311.073) (-1306.717) [-1301.501] -- 0:00:08 882500 -- (-1309.917) (-1306.066) (-1305.921) [-1302.184] * [-1303.756] (-1307.699) (-1308.506) (-1305.980) -- 0:00:08 883000 -- (-1311.266) (-1310.641) [-1308.488] (-1304.471) * (-1307.246) (-1312.916) [-1311.068] (-1309.003) -- 0:00:08 883500 -- (-1308.518) (-1313.342) [-1307.232] (-1305.662) * (-1305.113) (-1306.079) (-1307.071) [-1301.765] -- 0:00:08 884000 -- (-1304.516) [-1307.162] (-1310.259) (-1303.947) * (-1306.570) (-1308.623) [-1303.957] (-1306.738) -- 0:00:08 884500 -- (-1313.195) [-1305.237] (-1306.519) (-1304.879) * (-1306.951) (-1306.506) (-1305.265) [-1303.104] -- 0:00:08 885000 -- (-1310.053) [-1307.079] (-1309.053) (-1306.653) * (-1305.949) (-1310.512) [-1306.438] (-1306.365) -- 0:00:08 Average standard deviation of split frequencies: 0.009861 885500 -- [-1308.846] (-1305.539) (-1308.963) (-1303.972) * (-1307.326) (-1305.670) (-1306.942) [-1302.315] -- 0:00:08 886000 -- (-1308.202) [-1303.422] (-1305.929) (-1303.765) * (-1305.874) [-1305.830] (-1306.974) (-1303.220) -- 0:00:08 886500 -- (-1312.926) [-1305.027] (-1305.329) (-1306.846) * (-1304.838) [-1303.635] (-1308.732) (-1302.582) -- 0:00:08 887000 -- (-1309.856) [-1302.605] (-1304.151) (-1305.750) * [-1306.050] (-1303.334) (-1306.845) (-1306.055) -- 0:00:08 887500 -- (-1311.748) [-1311.249] (-1306.912) (-1305.129) * (-1305.702) (-1305.229) (-1307.679) [-1302.802] -- 0:00:08 888000 -- (-1310.052) (-1307.200) [-1307.764] (-1308.840) * (-1310.984) (-1309.188) [-1308.470] (-1303.124) -- 0:00:08 888500 -- [-1313.192] (-1310.868) (-1309.010) (-1307.924) * [-1307.523] (-1305.927) (-1305.188) (-1304.709) -- 0:00:08 889000 -- (-1311.057) (-1306.869) [-1302.464] (-1307.551) * [-1310.738] (-1305.133) (-1313.246) (-1304.026) -- 0:00:08 889500 -- (-1308.630) (-1310.504) (-1305.621) [-1302.547] * (-1308.880) (-1305.233) [-1306.258] (-1302.516) -- 0:00:08 890000 -- (-1310.823) (-1306.091) (-1303.553) [-1305.991] * (-1308.153) (-1308.376) [-1308.022] (-1305.108) -- 0:00:08 Average standard deviation of split frequencies: 0.010056 890500 -- (-1309.295) (-1306.823) (-1307.652) [-1305.744] * (-1304.745) (-1307.341) (-1307.026) [-1302.652] -- 0:00:08 891000 -- [-1306.411] (-1305.929) (-1307.205) (-1313.153) * (-1302.986) (-1308.992) [-1304.864] (-1304.404) -- 0:00:08 891500 -- [-1304.077] (-1308.785) (-1303.655) (-1307.200) * (-1308.839) [-1305.934] (-1309.657) (-1313.602) -- 0:00:08 892000 -- (-1304.520) (-1302.266) [-1306.333] (-1303.368) * (-1306.129) (-1310.228) (-1309.308) [-1309.280] -- 0:00:07 892500 -- (-1305.080) [-1302.903] (-1308.265) (-1302.800) * (-1308.467) [-1306.025] (-1304.677) (-1307.980) -- 0:00:07 893000 -- (-1307.233) (-1308.988) (-1306.774) [-1307.607] * [-1309.069] (-1309.823) (-1307.434) (-1309.157) -- 0:00:07 893500 -- (-1310.059) (-1307.027) (-1308.529) [-1306.150] * (-1310.075) (-1305.620) (-1306.332) [-1306.037] -- 0:00:07 894000 -- (-1302.371) [-1308.232] (-1309.855) (-1309.525) * (-1307.890) [-1305.334] (-1304.616) (-1309.553) -- 0:00:07 894500 -- (-1306.605) (-1307.102) (-1307.675) [-1307.683] * [-1307.929] (-1306.414) (-1305.073) (-1305.051) -- 0:00:07 895000 -- (-1309.612) [-1302.987] (-1303.274) (-1305.889) * (-1308.335) (-1305.708) (-1307.536) [-1303.929] -- 0:00:07 Average standard deviation of split frequencies: 0.009856 895500 -- [-1308.127] (-1305.658) (-1305.989) (-1306.600) * (-1307.469) (-1305.710) (-1307.703) [-1305.485] -- 0:00:07 896000 -- (-1306.602) [-1305.991] (-1303.783) (-1309.634) * (-1307.869) (-1303.720) (-1304.240) [-1302.635] -- 0:00:07 896500 -- (-1305.422) [-1308.728] (-1307.026) (-1305.579) * (-1308.973) (-1305.279) [-1311.366] (-1306.806) -- 0:00:07 897000 -- [-1306.515] (-1308.842) (-1308.164) (-1303.671) * (-1309.135) (-1306.197) [-1304.308] (-1306.455) -- 0:00:07 897500 -- (-1304.872) (-1312.239) (-1310.598) [-1301.339] * (-1309.409) (-1309.815) (-1307.185) [-1305.278] -- 0:00:07 898000 -- [-1304.874] (-1313.484) (-1309.914) (-1304.360) * (-1308.550) (-1310.238) [-1303.301] (-1303.953) -- 0:00:07 898500 -- [-1307.877] (-1307.024) (-1309.996) (-1305.597) * (-1308.083) [-1303.062] (-1307.276) (-1306.107) -- 0:00:07 899000 -- (-1305.563) [-1309.214] (-1306.578) (-1305.972) * (-1305.683) [-1303.166] (-1307.385) (-1306.252) -- 0:00:07 899500 -- (-1307.492) [-1309.603] (-1307.505) (-1304.144) * (-1309.510) [-1305.520] (-1308.593) (-1306.281) -- 0:00:07 900000 -- [-1304.391] (-1310.119) (-1306.214) (-1306.003) * [-1306.025] (-1302.617) (-1306.128) (-1304.551) -- 0:00:07 Average standard deviation of split frequencies: 0.010014 900500 -- (-1307.764) (-1308.875) (-1302.867) [-1307.192] * (-1306.090) (-1308.145) [-1303.220] (-1305.184) -- 0:00:07 901000 -- [-1301.983] (-1310.931) (-1304.734) (-1305.572) * (-1307.257) [-1304.901] (-1309.043) (-1305.014) -- 0:00:07 901500 -- [-1304.184] (-1306.474) (-1307.857) (-1306.171) * (-1302.720) [-1304.365] (-1310.368) (-1308.719) -- 0:00:07 902000 -- (-1306.778) [-1309.912] (-1304.526) (-1309.156) * (-1306.169) (-1306.054) [-1306.006] (-1305.795) -- 0:00:07 902500 -- (-1309.570) (-1308.107) (-1301.554) [-1304.830] * (-1312.032) (-1305.319) (-1309.039) [-1302.847] -- 0:00:07 903000 -- (-1310.500) [-1308.465] (-1309.378) (-1305.027) * (-1303.668) (-1303.461) [-1309.893] (-1305.689) -- 0:00:07 903500 -- [-1304.698] (-1306.131) (-1310.388) (-1304.148) * (-1305.327) [-1306.620] (-1307.127) (-1309.182) -- 0:00:07 904000 -- (-1305.707) (-1309.476) (-1303.168) [-1304.774] * [-1308.369] (-1306.460) (-1305.969) (-1305.900) -- 0:00:07 904500 -- (-1307.055) [-1304.866] (-1305.763) (-1305.514) * (-1307.529) [-1304.180] (-1307.816) (-1306.768) -- 0:00:07 905000 -- [-1303.900] (-1308.430) (-1305.632) (-1306.527) * (-1306.198) (-1304.102) [-1305.810] (-1307.950) -- 0:00:07 Average standard deviation of split frequencies: 0.010129 905500 -- [-1305.296] (-1311.062) (-1307.105) (-1303.380) * (-1306.757) [-1303.881] (-1307.070) (-1302.204) -- 0:00:06 906000 -- (-1309.739) [-1308.913] (-1303.838) (-1304.345) * (-1310.371) (-1305.981) [-1307.977] (-1304.913) -- 0:00:06 906500 -- (-1307.523) (-1312.382) (-1302.630) [-1302.149] * (-1305.757) [-1304.764] (-1310.670) (-1303.026) -- 0:00:06 907000 -- (-1304.779) (-1311.638) (-1303.374) [-1303.533] * (-1307.502) (-1304.746) [-1311.092] (-1307.243) -- 0:00:06 907500 -- (-1307.428) (-1306.697) [-1304.962] (-1304.759) * [-1304.875] (-1305.463) (-1317.423) (-1303.669) -- 0:00:06 908000 -- [-1308.850] (-1310.991) (-1306.473) (-1305.332) * (-1305.033) [-1304.079] (-1310.435) (-1310.078) -- 0:00:06 908500 -- [-1304.963] (-1308.242) (-1302.975) (-1307.996) * (-1304.675) (-1307.346) [-1311.063] (-1309.904) -- 0:00:06 909000 -- (-1310.352) [-1304.778] (-1305.081) (-1307.959) * (-1305.460) [-1306.765] (-1309.228) (-1310.286) -- 0:00:06 909500 -- [-1308.941] (-1313.037) (-1305.634) (-1308.680) * (-1312.859) [-1303.908] (-1308.582) (-1305.236) -- 0:00:06 910000 -- (-1309.965) (-1310.178) [-1304.692] (-1305.003) * (-1304.652) [-1305.388] (-1310.435) (-1308.956) -- 0:00:06 Average standard deviation of split frequencies: 0.010284 910500 -- [-1305.353] (-1308.078) (-1305.716) (-1302.843) * [-1306.734] (-1307.112) (-1310.919) (-1307.137) -- 0:00:06 911000 -- (-1303.069) (-1304.398) (-1307.062) [-1304.405] * (-1312.503) (-1305.639) [-1307.899] (-1317.665) -- 0:00:06 911500 -- (-1309.592) (-1307.510) (-1302.817) [-1305.405] * (-1307.240) [-1305.176] (-1309.525) (-1308.289) -- 0:00:06 912000 -- (-1310.163) (-1306.678) (-1302.244) [-1306.273] * (-1309.201) (-1310.924) (-1310.550) [-1304.418] -- 0:00:06 912500 -- (-1307.022) (-1306.091) (-1307.426) [-1306.442] * (-1308.960) (-1308.158) (-1309.531) [-1302.261] -- 0:00:06 913000 -- [-1307.434] (-1306.190) (-1304.401) (-1305.355) * (-1313.868) (-1303.153) (-1308.884) [-1306.592] -- 0:00:06 913500 -- (-1305.815) (-1304.606) [-1308.638] (-1309.181) * (-1306.154) (-1305.976) (-1310.678) [-1307.441] -- 0:00:06 914000 -- (-1305.452) (-1305.081) [-1304.845] (-1315.905) * [-1305.461] (-1304.638) (-1311.511) (-1306.200) -- 0:00:06 914500 -- (-1305.831) [-1304.188] (-1309.852) (-1309.986) * (-1305.077) (-1306.876) [-1309.913] (-1305.888) -- 0:00:06 915000 -- (-1304.601) (-1306.780) [-1303.906] (-1310.356) * [-1304.703] (-1304.771) (-1304.573) (-1305.598) -- 0:00:06 Average standard deviation of split frequencies: 0.009881 915500 -- (-1310.593) [-1305.007] (-1308.119) (-1308.028) * (-1306.003) (-1309.067) (-1307.221) [-1302.933] -- 0:00:06 916000 -- (-1306.898) [-1305.497] (-1305.629) (-1308.245) * [-1306.839] (-1305.862) (-1305.220) (-1303.685) -- 0:00:06 916500 -- (-1309.512) (-1307.290) (-1304.400) [-1308.998] * (-1306.723) (-1310.116) [-1305.049] (-1312.101) -- 0:00:06 917000 -- [-1307.835] (-1302.364) (-1304.793) (-1308.385) * (-1306.381) [-1304.523] (-1306.887) (-1307.521) -- 0:00:06 917500 -- [-1308.680] (-1304.382) (-1308.277) (-1308.662) * (-1309.503) [-1306.408] (-1309.611) (-1308.704) -- 0:00:06 918000 -- (-1309.117) (-1303.360) (-1313.291) [-1306.638] * [-1304.348] (-1306.748) (-1304.251) (-1306.829) -- 0:00:05 918500 -- (-1310.068) (-1305.880) (-1306.490) [-1306.874] * (-1308.141) (-1308.755) (-1308.660) [-1307.496] -- 0:00:06 919000 -- (-1306.121) (-1301.991) [-1303.438] (-1309.427) * [-1304.995] (-1306.045) (-1308.719) (-1306.754) -- 0:00:05 919500 -- (-1311.387) (-1306.467) (-1303.645) [-1303.946] * [-1301.656] (-1302.869) (-1306.236) (-1306.766) -- 0:00:05 920000 -- [-1309.208] (-1305.624) (-1306.853) (-1308.123) * (-1308.848) [-1305.412] (-1308.523) (-1305.561) -- 0:00:05 Average standard deviation of split frequencies: 0.009933 920500 -- (-1308.141) (-1307.703) (-1304.762) [-1310.173] * [-1306.607] (-1306.664) (-1310.757) (-1303.814) -- 0:00:05 921000 -- (-1305.808) [-1305.894] (-1302.536) (-1303.688) * [-1305.504] (-1307.591) (-1308.346) (-1304.535) -- 0:00:05 921500 -- (-1304.591) [-1305.863] (-1303.298) (-1306.095) * [-1308.668] (-1306.238) (-1305.196) (-1313.568) -- 0:00:05 922000 -- [-1307.074] (-1309.431) (-1305.244) (-1311.138) * (-1309.454) (-1308.786) (-1306.332) [-1306.362] -- 0:00:05 922500 -- (-1309.309) [-1308.417] (-1305.321) (-1307.282) * (-1308.848) [-1309.720] (-1310.788) (-1305.452) -- 0:00:05 923000 -- (-1308.128) [-1304.390] (-1306.177) (-1305.503) * (-1312.976) [-1303.981] (-1306.838) (-1309.462) -- 0:00:05 923500 -- (-1309.198) (-1303.687) [-1305.843] (-1308.034) * (-1311.508) (-1302.554) (-1304.714) [-1308.564] -- 0:00:05 924000 -- (-1308.512) [-1304.778] (-1306.850) (-1307.724) * (-1310.632) [-1302.825] (-1307.048) (-1305.905) -- 0:00:05 924500 -- (-1307.032) (-1302.841) [-1308.072] (-1314.221) * (-1307.692) (-1303.828) [-1304.465] (-1308.530) -- 0:00:05 925000 -- (-1309.061) [-1305.118] (-1305.939) (-1307.677) * (-1305.138) (-1308.305) [-1304.868] (-1307.349) -- 0:00:05 Average standard deviation of split frequencies: 0.009435 925500 -- [-1313.444] (-1304.283) (-1303.602) (-1312.898) * (-1309.358) [-1305.868] (-1310.670) (-1303.753) -- 0:00:05 926000 -- (-1309.659) (-1302.424) (-1307.811) [-1310.757] * [-1305.094] (-1304.489) (-1302.651) (-1304.666) -- 0:00:05 926500 -- (-1304.192) (-1304.874) (-1304.141) [-1309.219] * (-1306.819) [-1303.767] (-1307.224) (-1305.880) -- 0:00:05 927000 -- (-1304.520) [-1304.585] (-1306.085) (-1307.373) * (-1311.437) [-1304.083] (-1309.367) (-1308.075) -- 0:00:05 927500 -- (-1312.126) [-1305.755] (-1306.595) (-1302.867) * [-1307.242] (-1306.841) (-1305.952) (-1308.533) -- 0:00:05 928000 -- (-1304.276) (-1307.288) [-1305.066] (-1306.267) * (-1308.438) (-1306.421) [-1307.573] (-1309.242) -- 0:00:05 928500 -- (-1306.868) (-1309.785) [-1303.916] (-1305.989) * (-1309.002) [-1303.485] (-1305.560) (-1312.858) -- 0:00:05 929000 -- (-1305.456) [-1304.748] (-1305.397) (-1307.050) * (-1303.938) [-1303.412] (-1306.022) (-1309.891) -- 0:00:05 929500 -- [-1303.638] (-1307.960) (-1309.914) (-1303.904) * [-1308.729] (-1308.024) (-1304.054) (-1309.496) -- 0:00:05 930000 -- (-1307.051) (-1307.095) (-1304.550) [-1306.004] * (-1305.008) [-1310.117] (-1304.175) (-1307.864) -- 0:00:05 Average standard deviation of split frequencies: 0.009556 930500 -- (-1304.917) (-1304.752) [-1302.446] (-1304.634) * [-1306.262] (-1304.167) (-1306.939) (-1308.889) -- 0:00:05 931000 -- (-1307.811) (-1306.555) [-1306.169] (-1311.343) * (-1306.019) (-1304.734) [-1307.283] (-1309.011) -- 0:00:05 931500 -- (-1306.506) [-1309.260] (-1306.802) (-1304.621) * (-1307.565) [-1304.004] (-1306.004) (-1311.017) -- 0:00:05 932000 -- (-1303.413) (-1308.997) (-1306.278) [-1302.274] * (-1307.137) [-1302.900] (-1311.794) (-1307.199) -- 0:00:04 932500 -- (-1303.611) (-1308.450) [-1308.609] (-1304.522) * (-1303.925) (-1306.508) [-1305.323] (-1307.077) -- 0:00:04 933000 -- [-1304.066] (-1308.126) (-1304.695) (-1305.021) * (-1304.733) (-1309.051) [-1307.915] (-1308.718) -- 0:00:04 933500 -- (-1310.142) (-1308.054) (-1305.875) [-1305.872] * [-1305.581] (-1305.357) (-1309.064) (-1309.868) -- 0:00:04 934000 -- (-1304.824) (-1308.508) [-1305.171] (-1308.778) * (-1308.219) (-1306.381) (-1306.629) [-1305.717] -- 0:00:04 934500 -- (-1308.687) (-1303.652) (-1304.027) [-1312.905] * [-1308.928] (-1309.103) (-1305.979) (-1311.632) -- 0:00:04 935000 -- (-1305.001) [-1306.823] (-1306.602) (-1307.660) * (-1306.721) (-1310.541) [-1304.555] (-1305.233) -- 0:00:04 Average standard deviation of split frequencies: 0.009636 935500 -- (-1309.630) [-1304.570] (-1305.433) (-1304.442) * (-1306.985) [-1312.095] (-1309.600) (-1308.890) -- 0:00:04 936000 -- (-1308.469) [-1303.847] (-1306.033) (-1310.580) * [-1303.635] (-1308.348) (-1312.396) (-1309.941) -- 0:00:04 936500 -- (-1308.368) (-1303.652) (-1304.703) [-1306.564] * (-1305.249) [-1306.323] (-1306.566) (-1303.897) -- 0:00:04 937000 -- (-1309.453) (-1305.333) (-1304.634) [-1303.773] * [-1305.470] (-1306.612) (-1309.318) (-1307.356) -- 0:00:04 937500 -- [-1310.101] (-1306.743) (-1304.243) (-1303.477) * [-1309.322] (-1304.757) (-1309.423) (-1305.924) -- 0:00:04 938000 -- (-1305.461) [-1306.496] (-1302.465) (-1309.544) * (-1308.598) [-1306.638] (-1306.801) (-1306.336) -- 0:00:04 938500 -- (-1309.841) [-1306.808] (-1306.864) (-1314.118) * [-1305.311] (-1307.557) (-1304.626) (-1307.929) -- 0:00:04 939000 -- (-1304.679) (-1304.174) [-1302.488] (-1307.132) * (-1308.480) (-1310.068) (-1305.985) [-1305.970] -- 0:00:04 939500 -- [-1302.073] (-1308.764) (-1303.642) (-1307.984) * (-1305.921) (-1309.611) [-1305.684] (-1304.753) -- 0:00:04 940000 -- [-1304.829] (-1308.213) (-1309.237) (-1308.836) * (-1303.899) (-1306.154) (-1306.192) [-1306.266] -- 0:00:04 Average standard deviation of split frequencies: 0.009254 940500 -- (-1304.587) (-1304.968) (-1302.673) [-1310.678] * (-1310.338) (-1308.441) [-1305.622] (-1305.901) -- 0:00:04 941000 -- (-1302.722) [-1308.926] (-1304.893) (-1308.455) * (-1306.872) (-1311.297) (-1304.905) [-1304.690] -- 0:00:04 941500 -- (-1303.933) (-1308.550) [-1303.986] (-1306.663) * (-1304.333) (-1307.285) (-1305.111) [-1305.700] -- 0:00:04 942000 -- (-1303.590) (-1305.020) [-1305.106] (-1309.300) * (-1307.249) (-1305.996) (-1309.402) [-1307.903] -- 0:00:04 942500 -- (-1308.948) (-1303.827) (-1306.626) [-1303.422] * [-1306.792] (-1307.856) (-1305.620) (-1307.578) -- 0:00:04 943000 -- [-1308.241] (-1306.836) (-1304.348) (-1305.824) * [-1308.941] (-1306.827) (-1307.563) (-1303.550) -- 0:00:04 943500 -- (-1307.001) (-1305.996) (-1309.859) [-1308.269] * [-1303.135] (-1306.573) (-1308.110) (-1310.271) -- 0:00:04 944000 -- (-1306.242) [-1305.969] (-1309.678) (-1310.795) * (-1303.618) (-1307.853) (-1309.686) [-1310.217] -- 0:00:04 944500 -- (-1304.346) [-1306.702] (-1305.314) (-1308.844) * [-1307.296] (-1311.461) (-1306.952) (-1306.535) -- 0:00:04 945000 -- (-1306.437) [-1305.097] (-1305.044) (-1310.975) * [-1308.149] (-1312.949) (-1307.071) (-1308.429) -- 0:00:04 Average standard deviation of split frequencies: 0.009368 945500 -- (-1306.107) (-1306.358) [-1309.537] (-1309.642) * (-1305.499) (-1314.411) [-1302.901] (-1307.918) -- 0:00:03 946000 -- (-1307.457) (-1306.342) (-1303.993) [-1310.109] * (-1306.982) (-1312.316) [-1305.099] (-1305.074) -- 0:00:03 946500 -- (-1304.544) (-1305.464) (-1305.746) [-1303.934] * (-1304.993) (-1307.344) [-1304.380] (-1310.582) -- 0:00:03 947000 -- [-1309.152] (-1306.415) (-1307.591) (-1303.209) * [-1304.884] (-1309.241) (-1304.612) (-1306.108) -- 0:00:03 947500 -- [-1305.114] (-1304.026) (-1307.296) (-1308.162) * (-1306.491) (-1304.559) [-1308.668] (-1314.986) -- 0:00:03 948000 -- (-1307.279) (-1307.744) (-1304.078) [-1308.986] * (-1307.794) [-1306.554] (-1304.327) (-1307.307) -- 0:00:03 948500 -- (-1309.638) (-1307.017) [-1303.430] (-1305.231) * [-1307.987] (-1308.506) (-1303.995) (-1303.929) -- 0:00:03 949000 -- [-1306.122] (-1303.869) (-1301.837) (-1305.923) * (-1309.489) [-1305.768] (-1307.489) (-1306.016) -- 0:00:03 949500 -- (-1309.396) [-1309.175] (-1306.783) (-1307.984) * [-1310.014] (-1310.900) (-1307.487) (-1307.280) -- 0:00:03 950000 -- (-1306.685) [-1305.719] (-1307.424) (-1308.154) * (-1308.571) [-1308.172] (-1309.233) (-1303.734) -- 0:00:03 Average standard deviation of split frequencies: 0.009223 950500 -- (-1307.218) (-1303.630) [-1301.255] (-1309.690) * (-1306.529) [-1306.029] (-1306.513) (-1312.124) -- 0:00:03 951000 -- (-1309.302) (-1305.853) [-1302.620] (-1306.082) * (-1309.085) (-1307.023) (-1304.828) [-1313.401] -- 0:00:03 951500 -- (-1308.192) [-1305.653] (-1304.734) (-1310.542) * (-1308.752) (-1306.820) [-1307.577] (-1307.837) -- 0:00:03 952000 -- (-1303.272) (-1305.896) (-1309.312) [-1308.861] * (-1308.319) (-1308.177) [-1302.396] (-1307.492) -- 0:00:03 952500 -- [-1301.391] (-1306.209) (-1305.039) (-1306.904) * (-1306.291) (-1309.712) [-1307.979] (-1304.900) -- 0:00:03 953000 -- (-1303.472) (-1305.262) [-1306.436] (-1311.461) * (-1304.065) [-1305.845] (-1310.202) (-1308.740) -- 0:00:03 953500 -- [-1306.492] (-1303.874) (-1306.114) (-1308.776) * (-1308.570) (-1308.136) [-1313.099] (-1306.355) -- 0:00:03 954000 -- (-1306.472) (-1303.949) [-1305.319] (-1310.631) * (-1308.748) [-1307.921] (-1307.532) (-1309.272) -- 0:00:03 954500 -- [-1304.594] (-1304.648) (-1308.853) (-1313.954) * [-1306.343] (-1304.333) (-1309.461) (-1308.687) -- 0:00:03 955000 -- (-1302.977) (-1307.879) [-1303.081] (-1309.755) * (-1308.092) [-1305.034] (-1308.570) (-1305.958) -- 0:00:03 Average standard deviation of split frequencies: 0.008810 955500 -- (-1302.278) [-1305.586] (-1306.117) (-1308.692) * [-1302.416] (-1305.842) (-1308.320) (-1303.159) -- 0:00:03 956000 -- (-1305.612) (-1305.407) [-1308.332] (-1309.335) * (-1308.072) (-1305.456) (-1306.261) [-1306.497] -- 0:00:03 956500 -- (-1305.527) (-1306.315) (-1308.445) [-1310.108] * (-1307.334) (-1302.110) [-1305.209] (-1307.825) -- 0:00:03 957000 -- (-1304.655) (-1312.269) (-1307.353) [-1308.720] * (-1307.223) [-1309.237] (-1308.911) (-1311.803) -- 0:00:03 957500 -- (-1309.576) (-1310.695) [-1305.459] (-1311.139) * (-1308.610) [-1309.062] (-1304.155) (-1306.274) -- 0:00:03 958000 -- (-1313.137) (-1310.890) [-1308.119] (-1314.135) * (-1305.368) (-1304.013) (-1304.858) [-1306.506] -- 0:00:03 958500 -- (-1304.660) (-1309.800) [-1308.382] (-1310.037) * (-1304.577) (-1305.543) [-1305.891] (-1304.408) -- 0:00:03 959000 -- (-1304.600) (-1307.928) [-1305.428] (-1307.940) * (-1307.846) (-1307.268) [-1305.062] (-1303.593) -- 0:00:02 959500 -- (-1307.573) (-1308.966) [-1306.777] (-1308.075) * (-1306.816) [-1309.236] (-1308.126) (-1309.099) -- 0:00:02 960000 -- (-1309.191) [-1305.322] (-1307.891) (-1305.197) * [-1304.918] (-1307.521) (-1304.361) (-1304.488) -- 0:00:02 Average standard deviation of split frequencies: 0.008735 960500 -- (-1306.256) (-1306.882) [-1305.355] (-1308.046) * [-1305.796] (-1305.387) (-1311.361) (-1306.149) -- 0:00:02 961000 -- [-1303.492] (-1308.098) (-1303.601) (-1306.121) * (-1311.330) (-1303.189) [-1304.418] (-1302.859) -- 0:00:02 961500 -- (-1306.065) (-1308.830) (-1306.843) [-1306.953] * (-1310.842) (-1305.016) [-1308.085] (-1303.686) -- 0:00:02 962000 -- (-1307.062) (-1308.273) [-1304.847] (-1308.030) * (-1308.380) [-1303.478] (-1309.134) (-1306.793) -- 0:00:02 962500 -- (-1308.287) (-1310.011) (-1303.239) [-1302.621] * (-1307.402) [-1306.066] (-1306.953) (-1304.983) -- 0:00:02 963000 -- [-1303.180] (-1308.359) (-1309.908) (-1304.490) * (-1308.836) [-1304.354] (-1308.169) (-1304.879) -- 0:00:02 963500 -- (-1306.201) (-1308.482) (-1310.192) [-1307.550] * [-1307.681] (-1305.854) (-1306.294) (-1315.421) -- 0:00:02 964000 -- [-1306.309] (-1311.521) (-1308.617) (-1307.018) * (-1303.601) (-1301.570) (-1311.914) [-1309.274] -- 0:00:02 964500 -- (-1311.122) [-1310.454] (-1307.412) (-1309.922) * (-1309.574) [-1305.480] (-1310.473) (-1306.137) -- 0:00:02 965000 -- (-1312.365) [-1309.917] (-1309.117) (-1308.872) * [-1303.471] (-1306.250) (-1309.533) (-1308.348) -- 0:00:02 Average standard deviation of split frequencies: 0.008914 965500 -- (-1308.412) (-1318.765) (-1307.468) [-1307.456] * [-1306.480] (-1307.550) (-1312.751) (-1302.354) -- 0:00:02 966000 -- (-1312.078) (-1306.700) (-1304.094) [-1307.120] * (-1309.089) (-1307.646) [-1308.151] (-1302.401) -- 0:00:02 966500 -- (-1309.924) [-1307.877] (-1304.727) (-1306.261) * (-1306.077) (-1303.334) (-1308.990) [-1304.167] -- 0:00:02 967000 -- (-1311.938) (-1305.217) (-1305.981) [-1305.097] * (-1304.255) (-1308.455) [-1305.301] (-1303.954) -- 0:00:02 967500 -- (-1309.586) (-1304.497) (-1303.356) [-1310.228] * (-1310.323) (-1305.477) (-1309.742) [-1303.898] -- 0:00:02 968000 -- (-1308.366) (-1307.925) (-1304.740) [-1307.224] * (-1309.430) (-1307.854) (-1308.911) [-1302.014] -- 0:00:02 968500 -- [-1308.218] (-1304.489) (-1309.038) (-1311.454) * (-1315.944) (-1305.223) (-1305.518) [-1303.092] -- 0:00:02 969000 -- [-1305.019] (-1303.013) (-1304.545) (-1310.083) * (-1306.046) (-1311.917) [-1306.286] (-1304.830) -- 0:00:02 969500 -- (-1303.144) [-1305.992] (-1308.697) (-1309.662) * [-1304.382] (-1308.156) (-1307.630) (-1307.717) -- 0:00:02 970000 -- [-1310.385] (-1304.684) (-1307.389) (-1312.007) * [-1304.704] (-1304.854) (-1304.364) (-1304.368) -- 0:00:02 Average standard deviation of split frequencies: 0.008709 970500 -- (-1309.006) (-1307.633) (-1309.228) [-1307.893] * (-1305.828) (-1306.131) [-1305.444] (-1307.265) -- 0:00:02 971000 -- (-1304.902) (-1308.311) [-1305.862] (-1311.799) * (-1305.844) (-1305.220) [-1302.435] (-1304.164) -- 0:00:02 971500 -- (-1305.040) (-1308.145) [-1310.402] (-1313.102) * (-1306.767) (-1305.546) [-1310.094] (-1305.583) -- 0:00:02 972000 -- (-1301.661) [-1307.962] (-1310.949) (-1313.751) * (-1307.985) (-1304.839) (-1305.292) [-1304.531] -- 0:00:02 972500 -- (-1307.241) [-1308.170] (-1306.817) (-1309.876) * (-1309.817) (-1306.179) [-1307.354] (-1309.658) -- 0:00:02 973000 -- [-1305.736] (-1307.420) (-1309.339) (-1309.569) * (-1310.778) (-1304.073) [-1303.430] (-1310.626) -- 0:00:01 973500 -- [-1306.140] (-1307.349) (-1312.634) (-1308.017) * [-1305.190] (-1306.384) (-1308.203) (-1309.077) -- 0:00:01 974000 -- [-1303.731] (-1306.762) (-1309.295) (-1307.727) * [-1306.903] (-1303.648) (-1307.686) (-1312.783) -- 0:00:01 974500 -- [-1307.904] (-1307.567) (-1311.912) (-1307.957) * (-1308.296) [-1305.129] (-1306.896) (-1306.928) -- 0:00:01 975000 -- (-1303.448) (-1314.701) (-1312.500) [-1304.539] * (-1305.487) (-1305.251) [-1302.730] (-1304.184) -- 0:00:01 Average standard deviation of split frequencies: 0.008855 975500 -- (-1303.870) (-1310.939) [-1309.418] (-1311.586) * (-1309.261) [-1310.650] (-1305.471) (-1304.694) -- 0:00:01 976000 -- (-1302.476) (-1306.368) [-1304.367] (-1308.857) * (-1310.119) (-1306.541) (-1306.637) [-1305.654] -- 0:00:01 976500 -- (-1303.049) (-1309.549) (-1304.232) [-1308.140] * (-1305.887) (-1310.493) (-1312.176) [-1306.538] -- 0:00:01 977000 -- (-1306.520) (-1309.511) (-1304.049) [-1308.051] * [-1306.651] (-1307.717) (-1306.689) (-1309.612) -- 0:00:01 977500 -- (-1308.607) (-1307.959) [-1304.317] (-1305.284) * (-1309.001) [-1303.685] (-1303.683) (-1308.232) -- 0:00:01 978000 -- (-1307.418) [-1306.237] (-1306.129) (-1308.913) * (-1304.291) (-1310.103) (-1302.925) [-1308.355] -- 0:00:01 978500 -- (-1303.351) (-1309.137) (-1310.667) [-1308.466] * (-1306.342) [-1305.014] (-1305.834) (-1312.429) -- 0:00:01 979000 -- (-1302.294) [-1303.942] (-1308.743) (-1309.687) * (-1306.883) (-1311.799) [-1307.070] (-1307.885) -- 0:00:01 979500 -- (-1304.830) (-1304.652) [-1305.962] (-1307.009) * [-1306.741] (-1305.834) (-1305.038) (-1305.315) -- 0:00:01 980000 -- (-1309.468) (-1306.335) (-1306.292) [-1308.342] * (-1306.985) [-1303.686] (-1309.057) (-1302.812) -- 0:00:01 Average standard deviation of split frequencies: 0.008492 980500 -- (-1303.357) (-1307.212) [-1307.790] (-1312.532) * (-1306.415) [-1304.600] (-1303.417) (-1305.518) -- 0:00:01 981000 -- [-1306.278] (-1308.101) (-1306.336) (-1309.754) * (-1309.263) (-1307.748) [-1304.764] (-1309.853) -- 0:00:01 981500 -- (-1308.137) (-1315.083) (-1308.948) [-1308.775] * (-1305.156) (-1307.818) [-1308.564] (-1305.553) -- 0:00:01 982000 -- (-1303.120) (-1307.066) [-1306.919] (-1306.392) * (-1308.177) (-1307.909) (-1313.356) [-1308.593] -- 0:00:01 982500 -- (-1302.532) (-1304.886) (-1310.634) [-1305.743] * (-1311.391) [-1305.103] (-1309.316) (-1305.430) -- 0:00:01 983000 -- (-1304.859) (-1307.385) (-1307.428) [-1303.775] * (-1306.515) (-1303.442) [-1306.311] (-1306.411) -- 0:00:01 983500 -- (-1305.881) (-1307.766) [-1304.427] (-1309.869) * (-1306.270) [-1303.438] (-1307.382) (-1308.012) -- 0:00:01 984000 -- [-1304.011] (-1312.079) (-1305.571) (-1306.110) * (-1303.703) [-1304.998] (-1308.738) (-1304.289) -- 0:00:01 984500 -- (-1307.032) [-1305.914] (-1306.882) (-1308.771) * [-1309.130] (-1305.003) (-1310.339) (-1312.166) -- 0:00:01 985000 -- (-1306.198) (-1308.824) (-1306.646) [-1304.687] * (-1306.666) [-1308.765] (-1306.856) (-1305.731) -- 0:00:01 Average standard deviation of split frequencies: 0.008956 985500 -- [-1305.460] (-1308.946) (-1303.012) (-1307.587) * [-1303.367] (-1305.851) (-1310.695) (-1304.836) -- 0:00:01 986000 -- [-1305.781] (-1310.898) (-1306.969) (-1305.926) * [-1309.194] (-1307.349) (-1313.166) (-1308.100) -- 0:00:01 986500 -- [-1304.927] (-1308.154) (-1307.972) (-1305.413) * [-1305.939] (-1310.053) (-1309.477) (-1307.282) -- 0:00:00 987000 -- (-1307.979) (-1308.252) (-1307.879) [-1303.517] * (-1306.324) [-1305.083] (-1308.144) (-1306.259) -- 0:00:00 987500 -- [-1307.156] (-1311.258) (-1306.608) (-1301.825) * (-1308.110) (-1307.293) (-1306.297) [-1308.226] -- 0:00:00 988000 -- (-1308.654) (-1307.735) (-1308.122) [-1306.533] * (-1304.528) (-1308.870) (-1305.832) [-1305.269] -- 0:00:00 988500 -- [-1307.927] (-1307.298) (-1307.493) (-1310.461) * [-1306.422] (-1307.814) (-1304.471) (-1308.855) -- 0:00:00 989000 -- (-1311.140) (-1308.369) (-1305.203) [-1305.544] * (-1310.375) [-1304.699] (-1308.677) (-1302.816) -- 0:00:00 989500 -- [-1304.023] (-1309.293) (-1306.814) (-1306.549) * [-1304.229] (-1310.813) (-1308.260) (-1306.735) -- 0:00:00 990000 -- (-1307.753) [-1307.187] (-1308.060) (-1305.415) * (-1304.426) [-1308.373] (-1304.794) (-1307.799) -- 0:00:00 Average standard deviation of split frequencies: 0.009009 990500 -- (-1304.356) (-1304.399) [-1306.358] (-1308.764) * (-1308.047) (-1308.034) [-1306.156] (-1311.515) -- 0:00:00 991000 -- (-1309.082) (-1308.500) (-1307.833) [-1308.792] * (-1307.884) (-1308.840) [-1307.721] (-1303.424) -- 0:00:00 991500 -- (-1302.600) [-1305.591] (-1308.451) (-1310.114) * (-1309.455) (-1307.353) [-1304.733] (-1305.261) -- 0:00:00 992000 -- [-1304.429] (-1306.711) (-1309.563) (-1304.527) * (-1307.432) [-1304.511] (-1306.540) (-1306.043) -- 0:00:00 992500 -- (-1305.513) (-1306.859) [-1307.971] (-1309.327) * (-1305.183) (-1306.042) (-1306.204) [-1306.279] -- 0:00:00 993000 -- (-1304.070) (-1304.235) (-1307.023) [-1307.952] * [-1303.532] (-1305.057) (-1304.987) (-1309.651) -- 0:00:00 993500 -- [-1303.363] (-1303.273) (-1307.596) (-1310.141) * [-1305.844] (-1306.102) (-1303.540) (-1312.091) -- 0:00:00 994000 -- (-1309.407) (-1309.635) (-1308.452) [-1302.256] * (-1305.575) (-1305.374) [-1304.258] (-1307.435) -- 0:00:00 994500 -- (-1310.295) (-1307.575) [-1304.476] (-1304.979) * (-1305.030) (-1306.701) [-1303.160] (-1311.839) -- 0:00:00 995000 -- (-1307.399) (-1306.089) (-1305.768) [-1306.415] * (-1308.094) [-1304.242] (-1303.675) (-1309.394) -- 0:00:00 Average standard deviation of split frequencies: 0.008709 995500 -- (-1307.846) [-1306.137] (-1311.279) (-1307.510) * [-1303.818] (-1301.868) (-1305.326) (-1309.618) -- 0:00:00 996000 -- (-1307.123) (-1307.313) [-1306.205] (-1304.580) * (-1313.026) (-1310.715) (-1306.474) [-1304.107] -- 0:00:00 996500 -- (-1309.368) [-1305.040] (-1308.616) (-1313.398) * [-1306.932] (-1308.446) (-1304.919) (-1308.704) -- 0:00:00 997000 -- [-1308.473] (-1310.238) (-1308.138) (-1308.096) * (-1309.029) (-1306.229) (-1305.798) [-1310.227] -- 0:00:00 997500 -- (-1308.851) (-1311.520) [-1307.601] (-1303.895) * (-1311.152) (-1308.322) (-1308.829) [-1308.649] -- 0:00:00 998000 -- (-1308.644) (-1304.848) [-1308.689] (-1307.749) * [-1308.174] (-1304.884) (-1308.575) (-1306.113) -- 0:00:00 998500 -- [-1307.682] (-1307.599) (-1307.582) (-1313.710) * [-1309.289] (-1304.105) (-1303.039) (-1309.325) -- 0:00:00 999000 -- [-1307.020] (-1302.853) (-1306.181) (-1306.561) * [-1305.882] (-1306.706) (-1303.124) (-1304.742) -- 0:00:00 999500 -- (-1306.505) (-1305.368) [-1304.214] (-1309.084) * [-1304.437] (-1304.123) (-1303.255) (-1304.928) -- 0:00:00 1000000 -- [-1306.726] (-1307.160) (-1307.079) (-1306.982) * [-1305.582] (-1304.689) (-1305.104) (-1306.138) -- 0:00:00 Average standard deviation of split frequencies: 0.008260 Analysis completed in 1 mins 13 seconds Analysis used 72.36 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1297.19 Likelihood of best state for "cold" chain of run 2 was -1297.81 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 73.6 % ( 66 %) Dirichlet(Revmat{all}) 96.2 % ( 95 %) Slider(Revmat{all}) 25.9 % ( 31 %) Dirichlet(Pi{all}) 27.3 % ( 19 %) Slider(Pi{all}) 62.7 % ( 45 %) Multiplier(Alpha{1,2}) 64.6 % ( 45 %) Multiplier(Alpha{3}) 26.8 % ( 23 %) Slider(Pinvar{all}) 96.4 % ( 97 %) ExtSPR(Tau{all},V{all}) 68.2 % ( 74 %) ExtTBR(Tau{all},V{all}) 97.1 % ( 93 %) NNI(Tau{all},V{all}) 86.8 % ( 81 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 25 %) Multiplier(V{all}) 92.0 % ( 86 %) Nodeslider(V{all}) 30.5 % ( 19 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 73.1 % ( 68 %) Dirichlet(Revmat{all}) 96.3 % ( 94 %) Slider(Revmat{all}) 25.4 % ( 25 %) Dirichlet(Pi{all}) 27.8 % ( 26 %) Slider(Pi{all}) 63.3 % ( 29 %) Multiplier(Alpha{1,2}) 65.3 % ( 36 %) Multiplier(Alpha{3}) 27.7 % ( 28 %) Slider(Pinvar{all}) 96.3 % ( 96 %) ExtSPR(Tau{all},V{all}) 68.5 % ( 66 %) ExtTBR(Tau{all},V{all}) 97.2 % ( 97 %) NNI(Tau{all},V{all}) 86.7 % ( 84 %) ParsSPR(Tau{all},V{all}) 28.0 % ( 19 %) Multiplier(V{all}) 92.2 % ( 94 %) Nodeslider(V{all}) 30.3 % ( 38 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.45 2 | 166224 0.80 0.63 3 | 166512 166910 0.82 4 | 166488 167142 166724 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.78 0.60 0.45 2 | 166721 0.80 0.63 3 | 166102 166929 0.82 4 | 166369 167325 166554 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1304.98 |1 1 1 2 2 | | 1 1 2 1 | | 1 22 2 1 2 | | 1 2 * 2 21 2 2 | | 2 2 2 2 12 2 2 1 2 1 | | 1 1 2 11 1 2 2 211 22 2 12| | 1 2 2 2 2 1 21 1 212 1 2 1 21| | 2 1 1 1 1 1 1 2 1 1 | | 1 2 2 1 2 * 2 1 2 2 1 1 * | | 2 2 1 1 11 1 1 1 * 1 2 2 | | 1 1 | | * * 2 22 1 | | 2 1 | | | |2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1307.82 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1304.25 -1310.04 2 -1304.26 -1309.51 -------------------------------------- TOTAL -1304.26 -1309.81 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.844430 0.088693 0.335826 1.460997 0.811372 1501.00 1501.00 1.000 r(A<->C){all} 0.129529 0.013670 0.000019 0.361616 0.094198 257.17 328.32 1.002 r(A<->G){all} 0.166072 0.020798 0.000098 0.452663 0.128246 239.12 263.82 1.000 r(A<->T){all} 0.164653 0.020544 0.000041 0.465120 0.125544 226.14 245.91 1.003 r(C<->G){all} 0.105245 0.013581 0.000063 0.359783 0.063281 216.36 229.27 1.000 r(C<->T){all} 0.269536 0.029189 0.000604 0.582305 0.243650 152.64 170.88 1.000 r(G<->T){all} 0.164964 0.021162 0.000233 0.453155 0.123880 186.13 221.67 1.000 pi(A){all} 0.164330 0.000151 0.141212 0.188894 0.164124 1190.63 1209.04 1.000 pi(C){all} 0.268535 0.000201 0.242438 0.296880 0.268244 1133.34 1262.93 1.000 pi(G){all} 0.344925 0.000251 0.317013 0.377899 0.344770 1127.30 1189.88 1.000 pi(T){all} 0.222210 0.000188 0.195029 0.249049 0.222264 1154.28 1236.99 1.000 alpha{1,2} 0.216967 0.077565 0.000418 0.690369 0.128165 1250.09 1287.23 1.000 alpha{3} 0.272986 0.085186 0.003073 0.790876 0.184897 1167.91 1212.56 1.000 pinvar{all} 0.993728 0.000018 0.985493 0.999392 0.994748 1501.00 1501.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**.** 8 -- .****. 9 -- ..**.. 10 -- .*...* 11 -- .*.*.. 12 -- ..*..* 13 -- ....** 14 -- .**... 15 -- ..*.*. 16 -- .***.* 17 -- .*..*. 18 -- ...**. 19 -- .*.*** 20 -- ...*.* 21 -- ..**** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 483 0.160893 0.003298 0.158561 0.163225 2 8 451 0.150233 0.004240 0.147235 0.153231 2 9 441 0.146902 0.015546 0.135909 0.157895 2 10 441 0.146902 0.009893 0.139907 0.153897 2 11 436 0.145237 0.019786 0.131246 0.159227 2 12 435 0.144903 0.002355 0.143238 0.146569 2 13 432 0.143904 0.002827 0.141905 0.145903 2 14 432 0.143904 0.009422 0.137242 0.150566 2 15 429 0.142905 0.008009 0.137242 0.148568 2 16 419 0.139574 0.010835 0.131912 0.147235 2 17 413 0.137575 0.006124 0.133245 0.141905 2 18 411 0.136909 0.008951 0.130580 0.143238 2 19 411 0.136909 0.007066 0.131912 0.141905 2 20 410 0.136576 0.003769 0.133911 0.139241 2 21 409 0.136243 0.011777 0.127915 0.144570 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.080760 0.008102 0.000021 0.252527 0.052126 1.000 2 length{all}[2] 0.081113 0.007152 0.000022 0.244294 0.055851 1.000 2 length{all}[3] 0.079840 0.007662 0.000056 0.246465 0.051723 1.000 2 length{all}[4] 0.078939 0.007426 0.000076 0.244978 0.052630 1.000 2 length{all}[5] 0.078754 0.007266 0.000004 0.237477 0.050927 1.000 2 length{all}[6] 0.196712 0.018905 0.000085 0.464872 0.170417 1.000 2 length{all}[7] 0.087240 0.009128 0.000024 0.290565 0.055033 0.998 2 length{all}[8] 0.085617 0.008738 0.000013 0.280913 0.052452 0.998 2 length{all}[9] 0.075398 0.005738 0.000750 0.228034 0.051469 0.998 2 length{all}[10] 0.079944 0.006129 0.000060 0.238321 0.060261 0.998 2 length{all}[11] 0.085434 0.009056 0.000168 0.289553 0.051143 1.001 2 length{all}[12] 0.089523 0.008651 0.000276 0.278627 0.056418 1.001 2 length{all}[13] 0.082615 0.007798 0.000067 0.246031 0.054518 0.999 2 length{all}[14] 0.082642 0.008262 0.000283 0.263991 0.050942 0.998 2 length{all}[15] 0.086783 0.008430 0.000386 0.296217 0.055542 0.998 2 length{all}[16] 0.078465 0.007582 0.000172 0.247358 0.047870 1.001 2 length{all}[17] 0.084592 0.009305 0.000074 0.265956 0.055035 0.999 2 length{all}[18] 0.078061 0.007606 0.000186 0.252861 0.051076 0.998 2 length{all}[19] 0.076105 0.005755 0.000096 0.227406 0.050134 1.003 2 length{all}[20] 0.079767 0.006768 0.000014 0.238322 0.054768 0.998 2 length{all}[21] 0.086195 0.008726 0.000066 0.302336 0.060105 1.008 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008260 Maximum standard deviation of split frequencies = 0.019786 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.008 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /---------------------- C1 (1) | |------------------------ C2 (2) | |---------------------- C3 (3) + |---------------------- C4 (4) | |---------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |-------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 103 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 948 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 60 patterns at 316 / 316 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 60 patterns at 316 / 316 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 58560 bytes for conP 5280 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 2 0.101847 0.071958 0.020799 0.052421 0.067910 0.081202 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1382.145852 Iterating by ming2 Initial: fx= 1382.145852 x= 0.10185 0.07196 0.02080 0.05242 0.06791 0.08120 0.30000 1.30000 1 h-m-p 0.0000 0.0001 746.2540 ++ 1344.948722 m 0.0001 13 | 1/8 2 h-m-p 0.0000 0.0000 114748.6502 ++ 1299.445997 m 0.0000 24 | 2/8 3 h-m-p 0.0000 0.0001 451.8135 ++ 1283.698263 m 0.0001 35 | 3/8 4 h-m-p 0.0000 0.0000 5290.1499 ++ 1280.899884 m 0.0000 46 | 4/8 5 h-m-p 0.0000 0.0000 746.6762 ++ 1270.477728 m 0.0000 57 | 5/8 6 h-m-p 0.0006 0.1324 8.5001 +++CYYCCC 1264.252854 5 0.1068 80 | 5/8 7 h-m-p 0.4647 2.3236 0.9392 YCCC 1264.107867 3 0.2138 96 | 5/8 8 h-m-p 0.2494 1.8988 0.8050 +YYCYYYYC 1263.316422 7 1.4095 119 | 5/8 9 h-m-p 1.1479 5.7396 0.3308 CCCC 1263.159178 3 1.3558 139 | 5/8 10 h-m-p 0.6059 3.2109 0.7404 YCYCCC 1262.934617 5 1.4077 161 | 5/8 11 h-m-p 1.0233 8.0000 1.0185 YCYC 1262.608752 3 1.8382 179 | 5/8 12 h-m-p 1.6000 8.0000 0.8333 YCCC 1262.367211 3 4.0343 195 | 5/8 13 h-m-p 1.6000 8.0000 1.3337 YCCC 1262.238523 3 2.8127 214 | 5/8 14 h-m-p 1.6000 8.0000 2.1606 YC 1262.124235 1 3.6301 226 | 5/8 15 h-m-p 1.6000 8.0000 3.0215 YCCC 1262.062643 3 2.8986 242 | 5/8 16 h-m-p 1.6000 8.0000 4.4917 YC 1262.011639 1 3.8677 254 | 5/8 17 h-m-p 1.6000 8.0000 6.7280 YCCC 1261.983972 3 2.8680 270 | 5/8 18 h-m-p 1.6000 8.0000 10.0885 YC 1261.961191 1 3.9002 282 | 5/8 19 h-m-p 1.6000 8.0000 14.9718 YCC 1261.948731 2 2.7775 296 | 5/8 20 h-m-p 1.6000 8.0000 22.0001 +YC 1261.938396 1 4.1250 309 | 5/8 21 h-m-p 1.6000 8.0000 33.5988 YCC 1261.932859 2 2.6302 323 | 5/8 22 h-m-p 1.6000 8.0000 48.1780 +YC 1261.928137 1 4.4260 336 | 5/8 23 h-m-p 1.2191 6.0954 75.4752 YC 1261.925692 1 2.5182 348 | 5/8 24 h-m-p 0.5220 2.6099 103.4485 ++ 1261.923937 m 2.6099 359 | 6/8 25 h-m-p 1.6000 8.0000 0.0015 Y 1261.923923 0 0.9977 370 | 6/8 26 h-m-p 1.6000 8.0000 0.0001 C 1261.923923 0 1.6245 383 | 6/8 27 h-m-p 1.6000 8.0000 0.0000 Y 1261.923923 0 2.6071 396 | 6/8 28 h-m-p 1.6000 8.0000 0.0000 --Y 1261.923923 0 0.0250 411 Out.. lnL = -1261.923923 412 lfun, 412 eigenQcodon, 2472 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 2 0.088413 0.109196 0.084973 0.101456 0.052309 0.044227 999.000000 0.692494 0.302705 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 0.028725 np = 9 lnL0 = -1402.524839 Iterating by ming2 Initial: fx= 1402.524839 x= 0.08841 0.10920 0.08497 0.10146 0.05231 0.04423 951.42857 0.69249 0.30270 1 h-m-p 0.0000 0.0002 697.0896 ++CYCCCCC 1322.490271 6 0.0002 28 | 0/9 2 h-m-p 0.0000 0.0000 5514.2995 ++ 1320.375446 m 0.0000 40 | 1/9 3 h-m-p 0.0000 0.0002 497.7573 ++ 1279.796070 m 0.0002 52 | 2/9 4 h-m-p 0.0000 0.0000 10663.0791 ++ 1276.626728 m 0.0000 64 | 3/9 5 h-m-p 0.0000 0.0001 319.9947 ++ 1268.301757 m 0.0001 76 | 4/9 6 h-m-p 0.0000 0.0000 5158.9100 ++ 1265.955528 m 0.0000 88 | 5/9 7 h-m-p 0.0044 0.7716 1.1799 ++++ 1264.463592 m 0.7716 102 | 5/9 8 h-m-p -0.0000 -0.0000 0.5482 h-m-p: -2.47868876e-17 -1.23934438e-16 5.48198265e-01 1264.463592 .. | 5/9 9 h-m-p 0.0000 0.0223 2237.4913 -YYCCCCC 1262.028936 6 0.0000 138 | 5/9 10 h-m-p 0.1378 8.0000 0.0406 +++ 1262.015860 m 8.0000 151 | 5/9 11 h-m-p 0.0002 0.0011 600.7024 ++ 1261.988214 m 0.0011 167 | 6/9 12 h-m-p 0.6507 8.0000 0.0085 ----------------.. | 6/9 13 h-m-p 0.0000 0.0067 0.9939 Y 1261.988203 0 0.0000 208 | 6/9 14 h-m-p 0.0055 2.7596 0.3137 ++++YYCCC 1261.924134 4 1.1013 233 | 6/9 15 h-m-p 1.6000 8.0000 0.0004 Y 1261.924124 0 0.9731 248 | 6/9 16 h-m-p 1.0587 8.0000 0.0004 Y 1261.924124 0 0.4558 263 | 6/9 17 h-m-p 1.6000 8.0000 0.0000 -----Y 1261.924124 0 0.0001 283 Out.. lnL = -1261.924124 284 lfun, 852 eigenQcodon, 3408 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 2 initial w for M2:NSpselection reset. 0.029600 0.048084 0.056593 0.038466 0.098707 0.087173 951.428703 1.224941 0.211780 0.123132 2.373537 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 0.023915 np = 11 lnL0 = -1356.401290 Iterating by ming2 Initial: fx= 1356.401290 x= 0.02960 0.04808 0.05659 0.03847 0.09871 0.08717 951.42870 1.22494 0.21178 0.12313 2.37354 1 h-m-p 0.0000 0.0001 620.8614 ++ 1310.972851 m 0.0001 16 | 1/11 2 h-m-p 0.0001 0.0006 192.4653 +YYCYYYYCYC 1294.942616 10 0.0006 43 | 1/11 3 h-m-p 0.0000 0.0001 514.8928 ++ 1289.850396 m 0.0001 57 | 2/11 4 h-m-p 0.0007 0.0395 19.9271 -----------.. | 2/11 5 h-m-p 0.0000 0.0000 590.4121 ++ 1285.246024 m 0.0000 94 | 3/11 6 h-m-p 0.0000 0.0000 144019.4468 ++ 1277.868745 m 0.0000 108 | 4/11 7 h-m-p 0.0000 0.0000 2175.1998 ++ 1273.529681 m 0.0000 122 | 5/11 8 h-m-p 0.0000 0.0001 496.7302 ++ 1262.609375 m 0.0001 136 | 6/11 9 h-m-p 0.0072 1.2313 0.5144 +++YYCYCCCC 1261.952237 7 0.6282 164 | 6/11 10 h-m-p 1.6000 8.0000 0.1008 +YCC 1261.923790 2 4.6573 187 | 6/11 11 h-m-p 1.6000 8.0000 0.0190 C 1261.923513 0 0.4716 206 | 6/11 12 h-m-p 1.6000 8.0000 0.0022 Y 1261.923513 0 0.8569 225 | 6/11 13 h-m-p 1.6000 8.0000 0.0003 ++ 1261.923512 m 8.0000 244 | 6/11 14 h-m-p 0.1900 8.0000 0.0137 ++C 1261.923506 0 3.0666 265 | 6/11 15 h-m-p 1.6000 8.0000 0.0241 ++ 1261.923442 m 8.0000 284 | 6/11 16 h-m-p 0.0239 0.2510 8.0887 -------------.. | 6/11 17 h-m-p 0.0160 8.0000 0.8346 ----C 1261.923435 0 0.0000 332 | 6/11 18 h-m-p 0.0407 8.0000 0.0004 ++++ 1261.923434 m 8.0000 353 | 6/11 19 h-m-p 1.6000 8.0000 0.0011 ++ 1261.923433 m 8.0000 372 | 6/11 20 h-m-p 0.9214 8.0000 0.0098 ++ 1261.923412 m 8.0000 391 | 6/11 21 h-m-p 0.0863 8.0000 0.9037 ++YYC 1261.923123 2 1.3810 414 | 6/11 22 h-m-p 0.6332 8.0000 1.9708 C 1261.923053 0 0.2054 433 | 6/11 23 h-m-p 0.5021 8.0000 0.8064 YC 1261.922768 1 1.1013 448 | 6/11 24 h-m-p 1.6000 8.0000 0.2217 YC 1261.922508 1 0.9109 468 | 6/11 25 h-m-p 0.3943 8.0000 0.5122 +Y 1261.922407 0 1.1141 488 | 6/11 26 h-m-p 0.9096 8.0000 0.6274 CY 1261.922213 1 1.5538 509 | 6/11 27 h-m-p 1.6000 8.0000 0.5545 YC 1261.921647 1 3.0969 529 | 6/11 28 h-m-p 0.9817 8.0000 1.7492 YC 1261.921477 1 0.4591 549 | 6/11 29 h-m-p 0.9206 8.0000 0.8724 CC 1261.921090 1 1.2470 565 | 6/11 30 h-m-p 1.6000 8.0000 0.4149 ++ 1261.920184 m 8.0000 584 | 6/11 31 h-m-p 0.2268 8.0000 14.6336 CC 1261.919940 1 0.0937 605 | 6/11 32 h-m-p 0.7933 8.0000 1.7279 CCC 1261.919676 2 1.2128 623 | 6/11 33 h-m-p 1.6000 8.0000 0.9466 C 1261.919256 0 1.6000 637 | 6/11 34 h-m-p 0.5158 8.0000 2.9362 YCC 1261.918913 2 1.0335 659 | 6/11 35 h-m-p 1.4582 8.0000 2.0811 CC 1261.918332 1 1.9428 675 | 6/11 36 h-m-p 1.6000 8.0000 0.0820 YC 1261.918178 1 0.6856 690 | 6/11 37 h-m-p 0.0193 8.0000 2.9074 +++CYC 1261.917713 2 1.7271 715 | 6/11 38 h-m-p 1.6000 8.0000 1.8629 YC 1261.917404 1 3.2110 730 | 6/11 39 h-m-p 1.6000 8.0000 0.0406 C 1261.917352 0 0.4293 744 | 6/11 40 h-m-p 0.0160 8.0000 1.9164 +++C 1261.917299 0 1.1517 766 | 6/11 41 h-m-p 1.6000 8.0000 0.7819 C 1261.917292 0 1.7326 780 | 6/11 42 h-m-p 1.6000 8.0000 0.0438 Y 1261.917291 0 0.8722 799 | 6/11 43 h-m-p 0.9704 8.0000 0.0394 C 1261.917291 0 0.7887 818 | 6/11 44 h-m-p 1.6000 8.0000 0.0056 -C 1261.917291 0 0.1177 838 | 6/11 45 h-m-p 0.1398 8.0000 0.0048 Y 1261.917291 0 0.0350 857 | 6/11 46 h-m-p 0.0436 8.0000 0.0038 C 1261.917291 0 0.0503 876 | 6/11 47 h-m-p 0.0365 8.0000 0.0052 --------Y 1261.917291 0 0.0000 903 | 6/11 48 h-m-p 0.0160 8.0000 0.0006 Y 1261.917291 0 0.0344 922 | 6/11 49 h-m-p 0.2551 8.0000 0.0001 Y 1261.917291 0 0.0384 941 Out.. lnL = -1261.917291 942 lfun, 3768 eigenQcodon, 16956 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1263.000643 S = -1258.067772 -4.112828 Calculating f(w|X), posterior probabilities of site classes. did 10 / 60 patterns 0:07 did 20 / 60 patterns 0:07 did 30 / 60 patterns 0:07 did 40 / 60 patterns 0:07 did 50 / 60 patterns 0:07 did 60 / 60 patterns 0:07 Time used: 0:07 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 2 0.093952 0.080651 0.108582 0.078625 0.088096 0.031938 951.934662 0.250944 1.633689 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 0.047484 np = 9 lnL0 = -1407.480671 Iterating by ming2 Initial: fx= 1407.480671 x= 0.09395 0.08065 0.10858 0.07863 0.08810 0.03194 951.93466 0.25094 1.63369 1 h-m-p 0.0000 0.0001 699.6341 ++ 1357.958270 m 0.0001 14 | 0/9 2 h-m-p -0.0000 -0.0000 5281.1322 h-m-p: -2.12378206e-18 -1.06189103e-17 5.28113219e+03 1357.958270 .. | 0/9 3 h-m-p 0.0000 0.0001 412111.9053 ---YYCYCCCC 1345.569938 7 0.0000 50 | 0/9 4 h-m-p 0.0000 0.0001 690.5745 ++ 1282.346593 m 0.0001 62 | 1/9 5 h-m-p 0.0001 0.0005 89.9752 ++ 1279.205305 m 0.0005 74 | 2/9 6 h-m-p 0.0000 0.0001 175.6106 ++ 1270.360098 m 0.0001 86 | 3/9 7 h-m-p 0.0001 0.0003 27.8080 ++ 1270.250166 m 0.0003 98 | 4/9 8 h-m-p 0.0045 0.7156 1.2419 ------------.. | 4/9 9 h-m-p 0.0000 0.0001 323.2284 ++ 1262.283030 m 0.0001 132 | 5/9 10 h-m-p 0.0083 4.1484 2.1030 +YCCC 1262.178262 3 0.0567 150 | 5/9 11 h-m-p 1.6000 8.0000 0.0730 +YCC 1261.991207 2 5.5349 166 | 5/9 12 h-m-p 1.4429 7.2145 0.1848 CYC 1261.932504 2 1.9838 185 | 5/9 13 h-m-p 1.4411 7.2056 0.1301 CYC 1261.924052 2 1.3607 204 | 5/9 14 h-m-p 1.6000 8.0000 0.0031 Y 1261.924047 0 1.1097 220 | 5/9 15 h-m-p 1.6000 8.0000 0.0001 Y 1261.924047 0 0.6448 236 | 5/9 16 h-m-p 1.2991 8.0000 0.0000 Y 1261.924047 0 0.6962 252 | 5/9 17 h-m-p 0.3717 8.0000 0.0001 +Y 1261.924047 0 1.1801 269 | 5/9 18 h-m-p 0.5211 8.0000 0.0001 +C 1261.924047 0 2.5746 286 | 5/9 19 h-m-p 0.8319 8.0000 0.0004 ++ 1261.924047 m 8.0000 302 | 5/9 20 h-m-p 0.8759 8.0000 0.0032 ++ 1261.924047 m 8.0000 318 | 5/9 21 h-m-p 0.2571 8.0000 0.0996 ++Y 1261.924041 0 2.7098 336 | 5/9 22 h-m-p 0.3998 1.9990 0.4143 +YY 1261.924002 1 1.5992 354 | 5/9 23 h-m-p 0.0317 0.1583 1.0366 -----------N 1261.924002 0 0.0000 381 | 5/9 24 h-m-p 0.0021 1.0496 0.1474 +++Y 1261.923995 0 0.0857 396 | 5/9 25 h-m-p 0.3362 8.0000 0.0376 +Y 1261.923991 0 2.6808 413 | 5/9 26 h-m-p 1.6000 8.0000 0.0053 Y 1261.923990 0 2.5842 429 | 5/9 27 h-m-p 1.6000 8.0000 0.0064 Y 1261.923990 0 0.7434 445 | 5/9 28 h-m-p 1.6000 8.0000 0.0012 C 1261.923990 0 0.5340 461 | 5/9 29 h-m-p 1.1098 8.0000 0.0006 ---Y 1261.923990 0 0.0043 480 Out.. lnL = -1261.923990 481 lfun, 5291 eigenQcodon, 28860 P(t) Time used: 0:15 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 2 initial w for M8:NSbetaw>1 reset. 0.035659 0.026095 0.104427 0.091288 0.059331 0.030001 952.178118 0.900000 0.388603 1.643058 2.357284 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 0.032396 np = 11 lnL0 = -1356.414635 Iterating by ming2 Initial: fx= 1356.414635 x= 0.03566 0.02610 0.10443 0.09129 0.05933 0.03000 952.17812 0.90000 0.38860 1.64306 2.35728 1 h-m-p 0.0000 0.0001 621.8239 ++ 1318.555106 m 0.0001 16 | 1/11 2 h-m-p 0.0000 0.0000 223832.9991 ++ 1307.823160 m 0.0000 30 | 2/11 3 h-m-p 0.0000 0.0001 616.2846 ++ 1286.691276 m 0.0001 44 | 3/11 4 h-m-p 0.0000 0.0000 5217.1805 ++ 1267.532595 m 0.0000 58 | 4/11 5 h-m-p 0.0000 0.0000 1034.6611 ++ 1263.659571 m 0.0000 72 | 5/11 6 h-m-p 0.0095 0.4698 1.6797 +++ 1262.966146 m 0.4698 87 | 5/11 7 h-m-p 1.3414 6.7070 0.2564 ++ 1262.050777 m 6.7070 101 | 6/11 8 h-m-p 0.4924 2.4619 0.2029 ++ 1261.927216 m 2.4619 121 | 6/11 9 h-m-p 1.6000 8.0000 0.0492 C 1261.924099 0 1.6000 140 | 6/11 10 h-m-p 1.6000 8.0000 0.0083 Y 1261.924064 0 1.2284 159 | 6/11 11 h-m-p 1.6000 8.0000 0.0009 C 1261.924064 0 1.5197 178 | 6/11 12 h-m-p 1.6000 8.0000 0.0001 C 1261.924064 0 1.5541 197 | 6/11 13 h-m-p 0.8291 8.0000 0.0002 ++ 1261.924064 m 8.0000 216 | 6/11 14 h-m-p 0.3710 8.0000 0.0036 ++Y 1261.924063 0 4.4442 237 | 6/11 15 h-m-p 1.4277 8.0000 0.0111 ++ 1261.924058 m 8.0000 256 | 6/11 16 h-m-p 0.3943 6.8787 0.2243 Y 1261.924054 0 0.3943 275 | 6/11 17 h-m-p 0.7618 8.0000 0.1161 C 1261.924046 0 1.0577 294 | 6/11 18 h-m-p 1.1737 8.0000 0.1046 +Y 1261.924014 0 4.6949 314 | 6/11 19 h-m-p 0.9429 4.7143 0.1714 C 1261.924010 0 0.2904 333 | 6/11 20 h-m-p 0.0822 1.2414 0.6052 +Y 1261.923992 0 0.2128 353 | 6/11 21 h-m-p 0.9698 4.8489 0.1279 Y 1261.923987 0 0.9698 372 | 6/11 22 h-m-p 0.7767 3.8834 0.1266 Y 1261.923966 0 1.7806 391 | 6/11 23 h-m-p 1.6000 8.0000 0.0302 C 1261.923959 0 0.5037 410 | 6/11 24 h-m-p 0.0524 0.8654 0.2903 ++Y 1261.923941 0 0.8378 431 | 6/11 25 h-m-p 1.1189 8.0000 0.2174 C 1261.923939 0 0.2797 450 | 6/11 26 h-m-p 1.1358 5.6790 0.0120 C 1261.923936 0 1.1358 469 | 6/11 27 h-m-p 0.8591 4.2954 0.0128 +Y 1261.923931 0 3.4364 489 | 6/11 28 h-m-p 0.0148 0.0741 0.1477 C 1261.923931 0 0.0152 508 | 6/11 29 h-m-p 0.8825 4.4126 0.0019 C 1261.923931 0 1.3122 527 | 6/11 30 h-m-p 1.6000 8.0000 0.0003 C 1261.923931 0 2.0293 546 | 6/11 31 h-m-p 0.2615 2.5633 0.0022 QuantileBeta(0.05, 0.00788, 2.11088) = 3.318725e-161 2000 rounds +Y 1261.923931 0 1.3895 566 | 6/11 32 h-m-p 0.6893 3.4466 0.0007 +C 1261.923931 0 2.7573 586 | 6/11 33 h-m-p 0.2096 1.0480 0.0005 +Y 1261.923931 0 0.9396 606 QuantileBeta(0.15, 0.00499, 2.11244) = 5.838362e-161 2000 rounds | 6/11 34 h-m-p 0.0261 0.1307 0.0004 ++ 1261.923931 m 0.1307 625 | 7/11 35 h-m-p 0.0502 8.0000 0.0005 -------N 1261.923931 0 0.0000 651 Out.. lnL = -1261.923931 652 lfun, 7824 eigenQcodon, 43032 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1263.210904 S = -1258.067811 -4.622260 Calculating f(w|X), posterior probabilities of site classes. did 10 / 60 patterns 0:27 did 20 / 60 patterns 0:28 did 30 / 60 patterns 0:28 did 40 / 60 patterns 0:28 did 50 / 60 patterns 0:28 did 60 / 60 patterns 0:28 Time used: 0:28 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=316 NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL NC_002677_1_NP_301974_1_846_xerD VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL NZ_CP029543_1_WP_010908295_1_1458_xerD VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL NZ_AP014567_1_WP_119607951_1_1491_xerD VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL ************************************************** NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG NC_002677_1_NP_301974_1_846_xerD AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG NZ_CP029543_1_WP_010908295_1_1458_xerD AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG NZ_AP014567_1_WP_119607951_1_1491_xerD AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHWFAVAEG ******************************************* ****** NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR NC_002677_1_NP_301974_1_846_xerD LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR NZ_CP029543_1_WP_010908295_1_1458_xerD LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR NZ_AP014567_1_WP_119607951_1_1491_xerD LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ************************************************** NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV NC_002677_1_NP_301974_1_846_xerD ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV NZ_CP029543_1_WP_010908295_1_1458_xerD ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV NZ_AP014567_1_WP_119607951_1_1491_xerD ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV ************************************************** NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE NC_002677_1_NP_301974_1_846_xerD QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE NZ_CP029543_1_WP_010908295_1_1458_xerD QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE NZ_AP014567_1_WP_119607951_1_1491_xerD QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE ************************************************** NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT NC_002677_1_NP_301974_1_846_xerD HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT NZ_CP029543_1_WP_010908295_1_1458_xerD HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT NZ_AP014567_1_WP_119607951_1_1491_xerD HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT ************************************************** NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 VQALREVWAGAHPRAK NC_002677_1_NP_301974_1_846_xerD VQALREVWAGAHPRAK NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 VQALREVWAGAHPRAK NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 VQALREVWAGAHPRAK NZ_CP029543_1_WP_010908295_1_1458_xerD VQALREVWAGAHPRAK NZ_AP014567_1_WP_119607951_1_1491_xerD VQALREVWAGAHPRAK ****************
>NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >NC_002677_1_NP_301974_1_846_xerD GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >NZ_CP029543_1_WP_010908295_1_1458_xerD GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATCGGTTCGCTGTCGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA >NZ_AP014567_1_WP_119607951_1_1491_xerD GTGACGACGGCCGCGCTTCAGACACAGCTGCAGGGCTACCTCGACTATCT GATCATCGAGCGCAGTATAGCGGCAAACACGCTGAGCTCCTATCGCCGTG ACCTGATCCGCTACTCCAAGCACTTGTCAGATCGGGGAATTGAGGATCTG GCCAAGGTCGGTGAGCACGATGTTAGCGAGTTCTTGGTGGCGCTGCGCCG TGGGGATCCCGATTCCGGGGTGGCGGCGCTGTCTGCGGTGTCGGCGGCGC GAGCGTTGATCGCAGTGCGCGGTTTGCATTGGTTCGCTGTTGCCGAAGGG TTGGTCGACCTGGATGTTGCGCGAGCTGTCCGTCCGCCTACGCCAGGACG TCGGTTGCCCAAGAGCTTGACAGTTGACGAGGTGCTGGCTTTGCTGGAGA GTGTGGGCGGCGAAAGTCGGGCCGACGGACCGCTGGTACTACGCAATCGG GCGTTGCTGGAGTTGTTGTACTCTACCGGATCCCGGATTTCTGAAGCTGT TGGGCTTGATGTCGACGATGTCGACACCCAGGCCAGGACGGTGTTGTTGC AGGGGAAGGGCGGCAAGCAGCGGCTAGTACCGGTGGGGCGTCCCGCCGTG CAAGCGCTGGATGCCTATCTGGTGCGTGGACGCTCCGATCTGGCTCGTCG GGGTCCTGGAATGCTTGCGACGCCAGCCATTTTTCTCAATGCGCGCGGAG GTCGGTTGTCGCGTCAAAGTGCGTGGCAAGTTCTGCAAGATGCTGCTGAA CATGCCGGTATCACTTCGGGTGTGTCGCCGCACATGTTGCGGCATTCCTT TGCCACCCACTTACTCGAAGGTGGCGCCGACATCCGGGTTGTGCAGGAGT TAATGGGTCATGCCTCGGTCACGACAACGCAGATCTACACGTTGGTTACT GTCCAGGCGTTACGTGAAGTGTGGGCCGGGGCGCACCCTAGGGCCAAA
>NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >NC_002677_1_NP_301974_1_846_xerD VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >NZ_CP029543_1_WP_010908295_1_1458_xerD VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHRFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK >NZ_AP014567_1_WP_119607951_1_1491_xerD VTTAALQTQLQGYLDYLIIERSIAANTLSSYRRDLIRYSKHLSDRGIEDL AKVGEHDVSEFLVALRRGDPDSGVAALSAVSAARALIAVRGLHWFAVAEG LVDLDVARAVRPPTPGRRLPKSLTVDEVLALLESVGGESRADGPLVLRNR ALLELLYSTGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLVPVGRPAV QALDAYLVRGRSDLARRGPGMLATPAIFLNARGGRLSRQSAWQVLQDAAE HAGITSGVSPHMLRHSFATHLLEGGADIRVVQELMGHASVTTTQIYTLVT VQALREVWAGAHPRAK
#NEXUS [ID: 0852416505] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 NC_002677_1_NP_301974_1_846_xerD NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 NZ_CP029543_1_WP_010908295_1_1458_xerD NZ_AP014567_1_WP_119607951_1_1491_xerD ; end; begin trees; translate 1 NC_011896_1_WP_010908295_1_1437_MLBR_RS06785, 2 NC_002677_1_NP_301974_1_846_xerD, 3 NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395, 4 NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435, 5 NZ_CP029543_1_WP_010908295_1_1458_xerD, 6 NZ_AP014567_1_WP_119607951_1_1491_xerD ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.05212595,2:0.05585085,3:0.05172341,4:0.05262989,5:0.05092676,6:0.1704167); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.05212595,2:0.05585085,3:0.05172341,4:0.05262989,5:0.05092676,6:0.1704167); end;
Estimated marginal likelihoods for runs sampled in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1304.25 -1310.04 2 -1304.26 -1309.51 -------------------------------------- TOTAL -1304.26 -1309.81 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/xerD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.844430 0.088693 0.335826 1.460997 0.811372 1501.00 1501.00 1.000 r(A<->C){all} 0.129529 0.013670 0.000019 0.361616 0.094198 257.17 328.32 1.002 r(A<->G){all} 0.166072 0.020798 0.000098 0.452663 0.128246 239.12 263.82 1.000 r(A<->T){all} 0.164653 0.020544 0.000041 0.465120 0.125544 226.14 245.91 1.003 r(C<->G){all} 0.105245 0.013581 0.000063 0.359783 0.063281 216.36 229.27 1.000 r(C<->T){all} 0.269536 0.029189 0.000604 0.582305 0.243650 152.64 170.88 1.000 r(G<->T){all} 0.164964 0.021162 0.000233 0.453155 0.123880 186.13 221.67 1.000 pi(A){all} 0.164330 0.000151 0.141212 0.188894 0.164124 1190.63 1209.04 1.000 pi(C){all} 0.268535 0.000201 0.242438 0.296880 0.268244 1133.34 1262.93 1.000 pi(G){all} 0.344925 0.000251 0.317013 0.377899 0.344770 1127.30 1189.88 1.000 pi(T){all} 0.222210 0.000188 0.195029 0.249049 0.222264 1154.28 1236.99 1.000 alpha{1,2} 0.216967 0.077565 0.000418 0.690369 0.128165 1250.09 1287.23 1.000 alpha{3} 0.272986 0.085186 0.003073 0.790876 0.184897 1167.91 1212.56 1.000 pinvar{all} 0.993728 0.000018 0.985493 0.999392 0.994748 1501.00 1501.00 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/xerD/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 316 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0 TTC 2 2 2 2 2 2 | TCC 6 6 6 6 6 6 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0 Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 16 16 16 16 16 16 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 3 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 3 3 3 3 3 3 | Pro CCT 3 3 3 3 3 3 | His CAT 4 4 4 4 4 4 | Arg CGT 9 9 9 9 9 9 CTC 3 3 3 3 3 3 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 8 8 8 8 8 8 CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 4 4 4 4 4 4 | CGA 2 2 2 2 2 2 CTG 16 16 16 16 16 16 | CCG 4 4 4 4 4 4 | CAG 9 9 9 9 9 9 | CGG 11 11 11 11 11 10 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 4 4 4 4 4 4 ATC 7 7 7 7 7 7 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 3 3 3 3 3 3 ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0 Met ATG 3 3 3 3 3 3 | ACG 9 9 9 9 9 9 | AAG 5 5 5 5 5 5 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 7 7 7 7 7 8 | Ala GCT 7 7 7 7 7 7 | Asp GAT 11 11 11 11 11 11 | Gly GGT 8 8 8 8 8 8 GTC 8 8 8 8 8 7 | GCC 14 14 14 14 14 14 | GAC 8 8 8 8 8 8 | GGC 6 6 6 6 6 6 GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 6 6 6 6 6 6 | GGA 7 7 7 7 7 7 GTG 14 14 14 14 14 14 | GCG 17 17 17 17 17 17 | GAG 8 8 8 8 8 8 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908295_1_1437_MLBR_RS06785 position 1: T:0.14873 C:0.27848 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22468 C:0.25633 A:0.11392 G:0.40506 Average T:0.22152 C:0.26688 A:0.16456 G:0.34705 #2: NC_002677_1_NP_301974_1_846_xerD position 1: T:0.14873 C:0.27848 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22468 C:0.25633 A:0.11392 G:0.40506 Average T:0.22152 C:0.26688 A:0.16456 G:0.34705 #3: NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395 position 1: T:0.14873 C:0.27848 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22468 C:0.25633 A:0.11392 G:0.40506 Average T:0.22152 C:0.26688 A:0.16456 G:0.34705 #4: NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435 position 1: T:0.14873 C:0.27848 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22468 C:0.25633 A:0.11392 G:0.40506 Average T:0.22152 C:0.26688 A:0.16456 G:0.34705 #5: NZ_CP029543_1_WP_010908295_1_1458_xerD position 1: T:0.14873 C:0.27848 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22468 C:0.25633 A:0.11392 G:0.40506 Average T:0.22152 C:0.26688 A:0.16456 G:0.34705 #6: NZ_AP014567_1_WP_119607951_1_1491_xerD position 1: T:0.15190 C:0.27532 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22785 C:0.25316 A:0.11392 G:0.40506 Average T:0.22363 C:0.26477 A:0.16456 G:0.34705 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 18 | Tyr Y TAT 18 | Cys C TGT 0 TTC 12 | TCC 36 | TAC 24 | TGC 0 Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 96 | TCG 30 | TAG 0 | Trp W TGG 13 ------------------------------------------------------------------------------ Leu L CTT 18 | Pro P CCT 18 | His H CAT 24 | Arg R CGT 54 CTC 18 | CCC 18 | CAC 30 | CGC 48 CTA 12 | CCA 12 | Gln Q CAA 24 | CGA 12 CTG 96 | CCG 24 | CAG 54 | CGG 65 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 24 ATC 42 | ACC 18 | AAC 6 | AGC 18 ATA 6 | ACA 18 | Lys K AAA 6 | Arg R AGA 0 Met M ATG 18 | ACG 54 | AAG 30 | AGG 12 ------------------------------------------------------------------------------ Val V GTT 43 | Ala A GCT 42 | Asp D GAT 66 | Gly G GGT 48 GTC 47 | GCC 84 | GAC 48 | GGC 36 GTA 12 | GCA 12 | Glu E GAA 36 | GGA 42 GTG 84 | GCG 102 | GAG 48 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14926 C:0.27795 A:0.15506 G:0.41772 position 2: T:0.29114 C:0.26582 A:0.22468 G:0.21835 position 3: T:0.22521 C:0.25580 A:0.11392 G:0.40506 Average T:0.22187 C:0.26653 A:0.16456 G:0.34705 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2 lnL(ntime: 6 np: 8): -1261.923923 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.006268 999.000000 0.519939 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.006288 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.006268); (NC_011896_1_WP_010908295_1_1437_MLBR_RS06785: 0.000004, NC_002677_1_NP_301974_1_846_xerD: 0.000004, NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395: 0.000004, NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435: 0.000004, NZ_CP029543_1_WP_010908295_1_1458_xerD: 0.000004, NZ_AP014567_1_WP_119607951_1_1491_xerD: 0.006268); Detailed output identifying parameters kappa (ts/tv) = 999.00000 omega (dN/dS) = 0.51994 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..2 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..3 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..4 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..5 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..6 0.006 647.8 300.2 0.5199 0.0016 0.0031 1.0 0.9 tree length for dN: 0.0016 tree length for dS: 0.0031 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2 lnL(ntime: 6 np: 9): -1261.924124 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.006268 951.428703 0.999990 0.519895 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.006288 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.006268); (NC_011896_1_WP_010908295_1_1437_MLBR_RS06785: 0.000004, NC_002677_1_NP_301974_1_846_xerD: 0.000004, NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395: 0.000004, NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435: 0.000004, NZ_CP029543_1_WP_010908295_1_1458_xerD: 0.000004, NZ_AP014567_1_WP_119607951_1_1491_xerD: 0.006268); Detailed output identifying parameters kappa (ts/tv) = 951.42870 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.51990 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..2 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..3 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..4 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..5 0.000 647.8 300.2 0.5199 0.0000 0.0000 0.0 0.0 7..6 0.006 647.8 300.2 0.5199 0.0016 0.0031 1.0 0.9 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2 lnL(ntime: 6 np: 11): -1261.917291 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.007017 951.934662 0.982924 0.000000 0.000001 37.319109 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.007037 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.007017); (NC_011896_1_WP_010908295_1_1437_MLBR_RS06785: 0.000004, NC_002677_1_NP_301974_1_846_xerD: 0.000004, NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395: 0.000004, NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435: 0.000004, NZ_CP029543_1_WP_010908295_1_1458_xerD: 0.000004, NZ_AP014567_1_WP_119607951_1_1491_xerD: 0.007017); Detailed output identifying parameters kappa (ts/tv) = 951.93466 MLEs of dN/dS (w) for site classes (K=3) p: 0.98292 0.00000 0.01708 w: 0.00000 1.00000 37.31911 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 647.8 300.2 0.6373 0.0000 0.0000 0.0 0.0 7..2 0.000 647.8 300.2 0.6373 0.0000 0.0000 0.0 0.0 7..3 0.000 647.8 300.2 0.6373 0.0000 0.0000 0.0 0.0 7..4 0.000 647.8 300.2 0.6373 0.0000 0.0000 0.0 0.0 7..5 0.000 647.8 300.2 0.6373 0.0000 0.0000 0.0 0.0 7..6 0.007 647.8 300.2 0.6373 0.0020 0.0031 1.3 0.9 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908295_1_1437_MLBR_RS06785) Pr(w>1) post mean +- SE for w 94 R 1.000** 37.319 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908295_1_1437_MLBR_RS06785) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.116 0.113 0.110 0.106 0.103 0.098 0.094 0.090 0.086 0.082 w2: 0.220 0.166 0.128 0.104 0.087 0.074 0.065 0.058 0.052 0.047 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.019 0.012 0.017 0.020 0.008 0.010 0.013 0.018 0.021 0.005 0.007 0.008 0.011 0.013 0.019 0.022 0.004 0.005 0.006 0.007 0.009 0.012 0.014 0.020 0.023 0.003 0.004 0.004 0.005 0.006 0.008 0.009 0.012 0.015 0.021 0.024 0.003 0.003 0.004 0.004 0.005 0.006 0.007 0.008 0.010 0.013 0.016 0.022 0.025 0.002 0.003 0.003 0.003 0.004 0.005 0.005 0.006 0.007 0.009 0.010 0.014 0.017 0.022 0.026 0.002 0.002 0.003 0.003 0.003 0.004 0.004 0.005 0.005 0.007 0.007 0.009 0.011 0.015 0.017 0.023 0.026 0.002 0.002 0.002 0.003 0.003 0.003 0.003 0.004 0.004 0.005 0.006 0.007 0.008 0.010 0.012 0.015 0.018 0.024 0.026 sum of density on p0-p1 = 1.000000 Time used: 0:07 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2 lnL(ntime: 6 np: 9): -1261.923990 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.006294 952.178118 0.190277 0.174977 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.006314 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.006294); (NC_011896_1_WP_010908295_1_1437_MLBR_RS06785: 0.000004, NC_002677_1_NP_301974_1_846_xerD: 0.000004, NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395: 0.000004, NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435: 0.000004, NZ_CP029543_1_WP_010908295_1_1458_xerD: 0.000004, NZ_AP014567_1_WP_119607951_1_1491_xerD: 0.006294); Detailed output identifying parameters kappa (ts/tv) = 952.17812 Parameters in M7 (beta): p = 0.19028 q = 0.17498 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00001 0.00178 0.02563 0.13812 0.40512 0.72722 0.92386 0.98834 0.99937 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 647.8 300.2 0.5209 0.0000 0.0000 0.0 0.0 7..2 0.000 647.8 300.2 0.5209 0.0000 0.0000 0.0 0.0 7..3 0.000 647.8 300.2 0.5209 0.0000 0.0000 0.0 0.0 7..4 0.000 647.8 300.2 0.5209 0.0000 0.0000 0.0 0.0 7..5 0.000 647.8 300.2 0.5209 0.0000 0.0000 0.0 0.0 7..6 0.006 647.8 300.2 0.5209 0.0016 0.0031 1.1 0.9 Time used: 0:15 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2 lnL(ntime: 6 np: 11): -1261.923931 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.006278 952.268329 0.478928 0.005000 2.112466 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.006298 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.006278); (NC_011896_1_WP_010908295_1_1437_MLBR_RS06785: 0.000004, NC_002677_1_NP_301974_1_846_xerD: 0.000004, NZ_LVXE01000016_1_WP_010908295_1_580_A3216_RS06395: 0.000004, NZ_LYPH01000019_1_WP_010908295_1_725_A8144_RS03435: 0.000004, NZ_CP029543_1_WP_010908295_1_1458_xerD: 0.000004, NZ_AP014567_1_WP_119607951_1_1491_xerD: 0.006278); Detailed output identifying parameters kappa (ts/tv) = 952.26833 Parameters in M8 (beta&w>1): p0 = 0.47893 p = 0.00500 q = 2.11247 (p1 = 0.52107) w = 1.00000 MLEs of dN/dS (w) for site classes (K=11) p: 0.04789 0.04789 0.04789 0.04789 0.04789 0.04789 0.04789 0.04789 0.04789 0.04789 0.52107 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 647.8 300.2 0.5211 0.0000 0.0000 0.0 0.0 7..2 0.000 647.8 300.2 0.5211 0.0000 0.0000 0.0 0.0 7..3 0.000 647.8 300.2 0.5211 0.0000 0.0000 0.0 0.0 7..4 0.000 647.8 300.2 0.5211 0.0000 0.0000 0.0 0.0 7..5 0.000 647.8 300.2 0.5211 0.0000 0.0000 0.0 0.0 7..6 0.006 647.8 300.2 0.5211 0.0016 0.0031 1.1 0.9 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908295_1_1437_MLBR_RS06785) Pr(w>1) post mean +- SE for w 94 R 0.634 2.930 +- 2.761 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.023 0.027 0.033 0.041 0.052 0.068 0.093 0.135 0.210 0.316 p : 0.116 0.110 0.106 0.102 0.099 0.097 0.095 0.093 0.091 0.090 q : 0.080 0.089 0.094 0.098 0.102 0.104 0.106 0.108 0.109 0.110 ws: 0.267 0.178 0.126 0.096 0.078 0.065 0.056 0.050 0.044 0.040 Time used: 0:28
Model 1: NearlyNeutral -1261.924124 Model 2: PositiveSelection -1261.917291 Model 0: one-ratio -1261.923923 Model 7: beta -1261.92399 Model 8: beta&w>1 -1261.923931 Model 0 vs 1 4.019999996671686E-4 Model 2 vs 1 0.013665999999830092 Model 8 vs 7 1.1799999992945231E-4