--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:02:32 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/12res/xseA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1738.63 -1741.53 2 -1738.62 -1741.84 -------------------------------------- TOTAL -1738.63 -1741.70 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.906550 0.088602 0.374909 1.517689 0.871388 1501.00 1501.00 1.000 r(A<->C){all} 0.172047 0.020060 0.000101 0.456166 0.137177 67.89 133.67 1.000 r(A<->G){all} 0.161762 0.018599 0.000062 0.434777 0.125510 194.88 218.69 1.000 r(A<->T){all} 0.178484 0.021721 0.000001 0.469709 0.140752 138.18 141.72 1.000 r(C<->G){all} 0.154543 0.017550 0.000026 0.421624 0.119994 167.56 238.83 1.002 r(C<->T){all} 0.162891 0.019412 0.000006 0.442942 0.122593 181.72 203.50 1.000 r(G<->T){all} 0.170274 0.022148 0.000022 0.467199 0.127538 95.99 171.54 1.000 pi(A){all} 0.190208 0.000117 0.169766 0.211406 0.189694 1188.85 1300.16 1.000 pi(C){all} 0.308455 0.000169 0.283411 0.334726 0.308283 960.38 1055.93 1.000 pi(G){all} 0.319867 0.000170 0.294378 0.345498 0.319818 1293.23 1296.36 1.000 pi(T){all} 0.181471 0.000117 0.160645 0.201836 0.181413 1283.97 1296.31 1.000 alpha{1,2} 0.426969 0.241986 0.000423 1.448375 0.244413 1303.48 1343.00 1.000 alpha{3} 0.464689 0.242504 0.000270 1.438834 0.303745 1282.64 1350.46 1.000 pinvar{all} 0.998834 0.000002 0.996257 1.000000 0.999267 958.72 960.86 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1688.994286 Model 2: PositiveSelection -1688.994318 Model 0: one-ratio -1688.994084 Model 7: beta -1688.99423 Model 8: beta&w>1 -1688.994084 Model 0 vs 1 4.040000003442401E-4 Model 2 vs 1 6.399999983841553E-5 Model 8 vs 7 2.9200000017226557E-4
>C1 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C2 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C3 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C4 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C5 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C6 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=428 C1 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C2 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C3 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C4 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C5 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C6 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL ************************************************** C1 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C2 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C3 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C4 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C5 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C6 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC ************************************************** C1 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C2 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C3 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C4 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C5 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C6 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR ************************************************** C1 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C2 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C3 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C4 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C5 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C6 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS ************************************************** C1 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C2 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C3 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C4 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C5 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C6 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI ************************************************** C1 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C2 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C3 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C4 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C5 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C6 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ************************************************** C1 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C2 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C3 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C4 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C5 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C6 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL ************************************************** C1 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C2 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C3 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C4 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C5 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C6 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD ************************************************** C1 DAPTGTRLRVRVSDGAIVAVSEGRADGP C2 DAPTGTRLRVRVSDGAIVAVSEGRADGP C3 DAPTGTRLRVRVSDGAIVAVSEGRADGP C4 DAPTGTRLRVRVSDGAIVAVSEGRADGP C5 DAPTGTRLRVRVSDGAIVAVSEGRADGP C6 DAPTGTRLRVRVSDGAIVAVSEGRADGP **************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 428 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 428 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12840] Library Relaxation: Multi_proc [96] Relaxation Summary: [12840]--->[12840] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.541 Mb, Max= 31.014 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C2 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C3 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C4 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C5 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL C6 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL ************************************************** C1 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C2 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C3 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C4 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C5 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC C6 AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC ************************************************** C1 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C2 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C3 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C4 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C5 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR C6 GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR ************************************************** C1 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C2 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C3 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C4 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C5 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS C6 PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS ************************************************** C1 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C2 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C3 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C4 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C5 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI C6 QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI ************************************************** C1 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C2 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C3 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C4 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C5 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ C6 SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ************************************************** C1 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C2 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C3 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C4 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C5 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL C6 ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL ************************************************** C1 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C2 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C3 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C4 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C5 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD C6 VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD ************************************************** C1 DAPTGTRLRVRVSDGAIVAVSEGRADGP C2 DAPTGTRLRVRVSDGAIVAVSEGRADGP C3 DAPTGTRLRVRVSDGAIVAVSEGRADGP C4 DAPTGTRLRVRVSDGAIVAVSEGRADGP C5 DAPTGTRLRVRVSDGAIVAVSEGRADGP C6 DAPTGTRLRVRVSDGAIVAVSEGRADGP **************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA C2 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA C3 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA C4 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA C5 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA C6 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA ************************************************** C1 GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA C2 GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA C3 GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA C4 GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA C5 GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA C6 GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA ************************************************** C1 TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG C2 TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG C3 TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG C4 TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG C5 TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG C6 TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG ************************************************** C1 GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG C2 GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG C3 GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG C4 GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG C5 GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG C6 GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG ************************************************** C1 TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG C2 TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG C3 TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG C4 TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG C5 TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG C6 TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG ************************************************** C1 TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC C2 TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC C3 TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC C4 TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC C5 TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC C6 TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC ************************************************** C1 GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG C2 GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG C3 GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG C4 GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG C5 GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG C6 GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG ************************************************** C1 CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC C2 CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC C3 CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC C4 CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC C5 CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC C6 CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC ************************************************** C1 TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG C2 TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG C3 TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG C4 TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG C5 TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG C6 TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG ************************************************** C1 CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG C2 CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG C3 CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG C4 CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG C5 CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG C6 CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG ************************************************** C1 CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG C2 CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG C3 CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG C4 CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG C5 CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG C6 CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG ************************************************** C1 CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC C2 CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC C3 CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC C4 CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC C5 CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC C6 CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC ************************************************** C1 CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT C2 CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT C3 CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT C4 CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT C5 CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT C6 CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT ************************************************** C1 GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT C2 GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT C3 GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT C4 GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT C5 GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT C6 GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT ************************************************** C1 CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC C2 CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC C3 CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC C4 CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC C5 CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC C6 CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC ************************************************** C1 AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA C2 AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA C3 AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA C4 AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA C5 AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA C6 AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA ************************************************** C1 TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG C2 TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG C3 TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG C4 TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG C5 TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG C6 TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG ************************************************** C1 CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG C2 CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG C3 CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG C4 CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG C5 CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG C6 CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG ************************************************** C1 GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG C2 GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG C3 GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG C4 GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG C5 GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG C6 GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG ************************************************** C1 CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG C2 CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG C3 CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG C4 CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG C5 CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG C6 CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG ************************************************** C1 AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG C2 AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG C3 AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG C4 AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG C5 AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG C6 AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG ************************************************** C1 GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC C2 GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC C3 GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC C4 GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC C5 GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC C6 GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ************************************************** C1 ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT C2 ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT C3 ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT C4 ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT C5 ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT C6 ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT ************************************************** C1 TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT C2 TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT C3 TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT C4 TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT C5 TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT C6 TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT ************************************************** C1 GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT C2 GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT C3 GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT C4 GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT C5 GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT C6 GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT ************************************************** C1 AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC C2 AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC C3 AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC C4 AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC C5 AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC C6 AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC ********************************** >C1 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC >C2 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC >C3 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC >C4 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC >C5 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC >C6 GTGACGGAAGCGGTGCCGACTGACTCAGTCGACTCGAAAGCCAGTTCACA GGTAAATTCGGCCGAGAACCCGTTCCCAGTTCGCGCGGTGGCGCTCCGGA TCGCGGGATGGATCGACAAGCTGGGCACTGTTTGGGTAGAGGGACAATTG GCGCAAATCACCATGCGGCCCAACGCTAAGACCGTGTTCATGGTCTTACG TGACCCGGCTGCCGACATATCGCTGATTGTGACTTGCTCGCGCGACTTTG TGCTACGCGCGCCGGTGAAACTAGCCGAAGGCATTCAGGTAGTGGTATGC GGCAAACCCTCATTCTACATCGGGCGCGGAACATTTTCTTTGCGCCTCAG CGATATTCGCGCAGTCGGCATCGGAGAGCTGCTAGTACGCATCGATCGGC TACGCCGACTGTTGGACTCTGAGGGGCTCTTTGACCCACGGCTTAAACGG CCGATACCCTTCCTGCCCAACATGATCGGGATCATCACTGGCCGGGCCAG CGCTGCCGAACGCGATGTAACAACCGTGGCTAGCGCGCGCTGGCCTGCGG CGCGTTTCGCTATCCGCAACACCGCTGTCCAGGGGCCCAACGCGGTGAGC CAGATTGTCGAGGCGTTGCGGGAACTTGATCGCAACGTTGATGTCGAGGT GATCGTGGTTGCCCGAGGTGGTGGCAGCGTCGAGGACCTGCTGACGTTTT CCGATGAAACGCTGTGCCGCGCGATCGCAGCGTGCCGCACGCCGGTGATC AGCGCAGTCGGTCACGAACCCGACAACCCGCTATGCGATCTGGTCGCCGA TCTGCGCGCCGCCACGCCCACCGACGCCGCCAAGAAAGTGGTCCCGGATG CCGCTGTCGAGCAGCGACTGATCGAGGACTTGCAGCGGCGCAGCGCGCAG GCACTCCGCAATTGGGTATCCCGCGAGCAGCGGACGCTAGTCCAACTACG CAGTCGCCCAGTGCTGGCTGAACCGCTGCGGACGCTGACGACGCGCTCCG AAGAAATTCACCGCGCCCAGTCGGCGATTCGCCGCGAGATCATTCGGCTG GTCACCACCGAGACCGAGCGGGTCGGTCATCTGGCCACGCAGCTAGCCAC ATTGGGCCCGGCAGCCACGTTGGCGCGCGGCTATGCCATAGTGCAAGCCT TGGAAGACGGGACGCAAACCGTTACTGCGGCAGTGCTGCGGTCAGTCGAT GATGCACCCACAGGCACCAGACTGCGGGTGCGGGTCTCTGACGGCGCCAT AGTGGCAGTTAGTGAAGGACGGGCCGATGGTCCC >C1 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C2 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C3 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C4 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C5 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP >C6 VTEAVPTDSVDSKASSQVNSAENPFPVRAVALRIAGWIDKLGTVWVEGQL AQITMRPNAKTVFMVLRDPAADISLIVTCSRDFVLRAPVKLAEGIQVVVC GKPSFYIGRGTFSLRLSDIRAVGIGELLVRIDRLRRLLDSEGLFDPRLKR PIPFLPNMIGIITGRASAAERDVTTVASARWPAARFAIRNTAVQGPNAVS QIVEALRELDRNVDVEVIVVARGGGSVEDLLTFSDETLCRAIAACRTPVI SAVGHEPDNPLCDLVADLRAATPTDAAKKVVPDAAVEQRLIEDLQRRSAQ ALRNWVSREQRTLVQLRSRPVLAEPLRTLTTRSEEIHRAQSAIRREIIRL VTTETERVGHLATQLATLGPAATLARGYAIVQALEDGTQTVTAAVLRSVD DAPTGTRLRVRVSDGAIVAVSEGRADGP MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1284 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791666 Setting output file names to "/data/12res/xseA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 243238022 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0470576062 Seed = 540357110 Swapseed = 1579791666 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2873.653557 -- -24.965149 Chain 2 -- -2873.653392 -- -24.965149 Chain 3 -- -2873.653557 -- -24.965149 Chain 4 -- -2873.653557 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2873.653557 -- -24.965149 Chain 2 -- -2873.653557 -- -24.965149 Chain 3 -- -2873.653119 -- -24.965149 Chain 4 -- -2873.653392 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2873.654] (-2873.653) (-2873.654) (-2873.654) * [-2873.654] (-2873.654) (-2873.653) (-2873.653) 500 -- (-1758.260) [-1749.377] (-1748.566) (-1794.582) * (-1757.952) (-1793.368) [-1752.743] (-1756.406) -- 0:00:00 1000 -- [-1747.202] (-1743.625) (-1746.068) (-1781.354) * (-1754.677) (-1770.893) (-1749.319) [-1749.081] -- 0:00:00 1500 -- (-1748.799) [-1746.547] (-1749.069) (-1767.520) * (-1750.781) (-1749.555) [-1747.692] (-1745.633) -- 0:00:00 2000 -- (-1748.666) [-1744.105] (-1746.133) (-1757.401) * (-1750.854) (-1745.063) [-1747.629] (-1750.255) -- 0:00:00 2500 -- (-1749.550) [-1748.983] (-1743.124) (-1749.443) * (-1742.561) [-1746.745] (-1746.136) (-1753.669) -- 0:00:00 3000 -- (-1750.522) (-1748.404) (-1753.331) [-1745.040] * (-1743.806) (-1746.042) (-1744.820) [-1746.654] -- 0:00:00 3500 -- [-1749.154] (-1753.624) (-1752.515) (-1752.724) * [-1745.926] (-1750.898) (-1749.392) (-1752.018) -- 0:00:00 4000 -- (-1755.165) (-1746.855) (-1752.665) [-1751.325] * (-1757.688) (-1744.772) (-1754.617) [-1748.386] -- 0:00:00 4500 -- (-1744.029) (-1740.682) [-1750.560] (-1754.917) * (-1752.341) [-1750.833] (-1746.461) (-1748.385) -- 0:00:00 5000 -- (-1752.912) [-1749.720] (-1750.824) (-1752.105) * (-1748.607) (-1744.195) [-1749.342] (-1756.866) -- 0:00:00 Average standard deviation of split frequencies: 0.099995 5500 -- [-1741.988] (-1753.851) (-1749.960) (-1752.429) * [-1746.884] (-1747.451) (-1745.416) (-1755.901) -- 0:00:00 6000 -- (-1750.271) [-1753.125] (-1749.319) (-1745.768) * (-1744.521) [-1746.533] (-1747.174) (-1743.176) -- 0:00:00 6500 -- (-1744.537) [-1752.601] (-1755.177) (-1752.389) * [-1743.631] (-1756.328) (-1747.155) (-1745.880) -- 0:00:00 7000 -- (-1748.077) [-1754.476] (-1743.189) (-1742.418) * (-1747.711) (-1755.569) (-1754.563) [-1750.446] -- 0:00:00 7500 -- (-1755.268) (-1746.983) [-1745.215] (-1753.275) * [-1746.442] (-1752.037) (-1748.709) (-1756.370) -- 0:00:00 8000 -- (-1757.431) (-1747.565) [-1742.790] (-1751.741) * (-1751.342) (-1749.244) [-1753.501] (-1743.485) -- 0:00:00 8500 -- [-1745.852] (-1755.437) (-1749.762) (-1745.481) * (-1747.941) (-1750.736) [-1750.413] (-1750.751) -- 0:00:00 9000 -- [-1747.399] (-1750.158) (-1761.206) (-1748.393) * (-1745.744) (-1751.145) (-1755.031) [-1744.595] -- 0:00:00 9500 -- [-1747.136] (-1748.084) (-1753.981) (-1744.866) * (-1750.371) (-1746.429) (-1750.153) [-1745.395] -- 0:00:00 10000 -- (-1750.568) (-1748.527) (-1749.777) [-1742.836] * (-1750.828) (-1747.274) [-1746.564] (-1765.172) -- 0:00:00 Average standard deviation of split frequencies: 0.069780 10500 -- (-1745.712) (-1744.278) (-1755.160) [-1749.389] * (-1751.386) (-1743.495) [-1748.785] (-1744.123) -- 0:00:00 11000 -- (-1746.722) [-1750.415] (-1749.127) (-1748.474) * (-1756.181) (-1746.164) (-1750.979) [-1744.258] -- 0:00:00 11500 -- (-1747.860) (-1748.239) (-1746.290) [-1746.906] * (-1745.348) (-1747.321) [-1753.279] (-1747.131) -- 0:00:00 12000 -- [-1752.555] (-1748.940) (-1752.992) (-1750.331) * (-1748.815) [-1742.157] (-1752.796) (-1749.543) -- 0:00:00 12500 -- [-1744.653] (-1751.772) (-1752.925) (-1745.578) * [-1743.129] (-1747.498) (-1748.299) (-1762.466) -- 0:01:19 13000 -- (-1751.536) (-1754.277) (-1744.251) [-1759.243] * (-1751.044) (-1749.300) [-1744.202] (-1743.579) -- 0:01:15 13500 -- (-1748.997) [-1746.684] (-1742.682) (-1756.007) * (-1746.030) (-1749.315) [-1751.247] (-1749.480) -- 0:01:13 14000 -- [-1748.799] (-1747.485) (-1746.103) (-1743.682) * (-1755.709) (-1753.491) [-1745.171] (-1746.053) -- 0:01:10 14500 -- (-1744.157) [-1753.201] (-1748.285) (-1747.703) * [-1747.201] (-1748.899) (-1745.611) (-1752.583) -- 0:01:07 15000 -- (-1744.684) (-1748.533) (-1751.380) [-1744.689] * (-1749.012) (-1749.950) [-1755.859] (-1747.127) -- 0:01:05 Average standard deviation of split frequencies: 0.060659 15500 -- (-1752.908) (-1747.302) [-1746.203] (-1750.401) * [-1758.010] (-1751.932) (-1744.363) (-1750.901) -- 0:01:03 16000 -- [-1745.287] (-1748.168) (-1745.673) (-1746.850) * [-1738.735] (-1747.414) (-1745.827) (-1748.978) -- 0:01:01 16500 -- [-1747.746] (-1754.193) (-1746.162) (-1749.494) * (-1738.230) [-1751.721] (-1749.645) (-1746.317) -- 0:00:59 17000 -- (-1748.868) (-1747.306) (-1752.621) [-1745.725] * [-1739.552] (-1742.753) (-1748.621) (-1743.443) -- 0:00:57 17500 -- (-1758.309) [-1748.373] (-1748.735) (-1750.332) * [-1738.374] (-1750.380) (-1746.024) (-1747.600) -- 0:00:56 18000 -- (-1750.798) [-1745.501] (-1752.641) (-1746.062) * (-1738.179) (-1749.329) (-1745.193) [-1751.964] -- 0:00:54 18500 -- (-1746.544) (-1745.040) (-1749.003) [-1753.251] * (-1738.035) (-1760.916) [-1755.926] (-1749.821) -- 0:00:53 19000 -- [-1747.581] (-1752.915) (-1761.263) (-1752.799) * (-1741.047) (-1752.169) [-1742.380] (-1748.146) -- 0:00:51 19500 -- (-1749.811) (-1750.738) (-1747.529) [-1747.747] * (-1739.464) (-1748.227) [-1749.415] (-1754.166) -- 0:00:50 20000 -- (-1746.904) (-1749.786) [-1741.339] (-1743.141) * [-1739.313] (-1750.690) (-1750.799) (-1746.474) -- 0:00:49 Average standard deviation of split frequencies: 0.033455 20500 -- [-1747.192] (-1756.579) (-1750.391) (-1751.888) * [-1738.270] (-1743.056) (-1744.171) (-1750.877) -- 0:00:47 21000 -- (-1749.916) [-1750.907] (-1748.175) (-1756.340) * (-1740.564) (-1747.046) (-1743.796) [-1745.837] -- 0:00:46 21500 -- [-1746.983] (-1748.259) (-1750.383) (-1747.401) * [-1738.984] (-1753.565) (-1744.853) (-1748.482) -- 0:00:45 22000 -- (-1745.494) (-1754.176) [-1746.895] (-1745.052) * [-1738.935] (-1746.057) (-1752.936) (-1745.959) -- 0:00:44 22500 -- [-1744.126] (-1749.176) (-1747.949) (-1755.691) * [-1739.236] (-1745.885) (-1747.353) (-1755.898) -- 0:00:43 23000 -- (-1758.557) (-1753.222) [-1749.177] (-1747.371) * (-1742.588) (-1748.361) [-1744.489] (-1750.210) -- 0:00:42 23500 -- (-1740.111) (-1750.534) (-1749.620) [-1743.266] * (-1740.915) (-1760.812) [-1745.901] (-1752.134) -- 0:00:41 24000 -- (-1738.459) (-1749.665) (-1762.001) [-1760.887] * (-1738.810) (-1754.797) [-1744.490] (-1740.162) -- 0:00:40 24500 -- (-1742.687) (-1756.957) [-1752.110] (-1745.739) * (-1740.138) (-1748.571) (-1750.908) [-1740.108] -- 0:00:39 25000 -- (-1740.495) (-1744.362) (-1757.665) [-1739.165] * (-1746.739) (-1745.412) [-1745.996] (-1740.832) -- 0:00:39 Average standard deviation of split frequencies: 0.027628 25500 -- [-1742.121] (-1750.207) (-1760.401) (-1738.805) * (-1740.225) (-1745.432) (-1754.290) [-1740.010] -- 0:00:38 26000 -- (-1742.120) [-1751.098] (-1745.940) (-1740.008) * [-1744.638] (-1750.730) (-1753.397) (-1739.081) -- 0:00:37 26500 -- [-1739.060] (-1751.488) (-1746.937) (-1742.307) * (-1740.757) (-1748.018) (-1752.812) [-1738.312] -- 0:00:36 27000 -- (-1738.411) (-1747.421) (-1750.205) [-1741.898] * [-1738.262] (-1752.702) (-1744.646) (-1742.309) -- 0:01:12 27500 -- [-1739.379] (-1749.654) (-1750.374) (-1739.793) * (-1739.221) (-1754.630) [-1746.792] (-1739.181) -- 0:01:10 28000 -- [-1741.379] (-1755.253) (-1753.326) (-1739.548) * (-1739.493) [-1758.794] (-1766.599) (-1739.723) -- 0:01:09 28500 -- [-1737.233] (-1753.045) (-1748.367) (-1741.945) * (-1741.465) (-1741.633) (-1752.420) [-1739.709] -- 0:01:08 29000 -- [-1742.091] (-1754.337) (-1751.214) (-1740.741) * (-1742.753) (-1743.819) (-1747.632) [-1738.788] -- 0:01:06 29500 -- (-1739.765) [-1749.307] (-1756.553) (-1738.942) * (-1738.421) (-1741.545) (-1749.840) [-1739.210] -- 0:01:05 30000 -- [-1738.822] (-1755.258) (-1752.812) (-1738.913) * (-1738.826) (-1741.938) [-1744.841] (-1741.246) -- 0:01:04 Average standard deviation of split frequencies: 0.031512 30500 -- (-1739.214) (-1744.790) [-1744.574] (-1738.922) * (-1738.655) (-1743.565) [-1749.336] (-1740.520) -- 0:01:03 31000 -- (-1743.099) (-1750.942) (-1756.718) [-1737.901] * (-1739.835) [-1742.128] (-1751.048) (-1738.176) -- 0:01:02 31500 -- (-1743.303) (-1747.211) (-1746.153) [-1737.414] * (-1739.257) [-1742.422] (-1752.533) (-1738.848) -- 0:01:01 32000 -- (-1741.180) (-1750.904) [-1749.990] (-1740.996) * (-1738.891) (-1741.226) (-1753.620) [-1738.303] -- 0:01:00 32500 -- (-1737.517) [-1744.020] (-1745.885) (-1740.619) * (-1740.292) (-1742.080) [-1746.634] (-1743.701) -- 0:00:59 33000 -- (-1738.194) (-1746.259) (-1751.805) [-1739.770] * (-1738.998) [-1743.225] (-1750.369) (-1745.306) -- 0:00:58 33500 -- (-1738.623) [-1747.944] (-1747.251) (-1745.036) * [-1738.697] (-1742.780) (-1749.534) (-1744.206) -- 0:00:57 34000 -- (-1739.074) (-1743.274) [-1749.703] (-1738.233) * (-1740.358) (-1742.063) [-1744.435] (-1743.619) -- 0:00:56 34500 -- (-1739.014) (-1754.695) [-1745.697] (-1737.855) * (-1741.810) [-1737.746] (-1749.872) (-1740.163) -- 0:00:55 35000 -- (-1740.128) (-1751.653) [-1750.504] (-1738.307) * (-1737.926) [-1738.828] (-1754.737) (-1741.753) -- 0:00:55 Average standard deviation of split frequencies: 0.032736 35500 -- (-1738.809) [-1744.478] (-1751.327) (-1738.533) * (-1739.393) [-1737.185] (-1757.951) (-1738.235) -- 0:00:54 36000 -- (-1737.991) [-1749.506] (-1749.498) (-1738.724) * [-1738.846] (-1737.145) (-1754.972) (-1738.828) -- 0:00:53 36500 -- (-1738.283) [-1744.036] (-1746.930) (-1739.605) * (-1741.927) [-1741.442] (-1749.336) (-1738.455) -- 0:00:52 37000 -- (-1738.525) (-1758.280) (-1746.878) [-1738.992] * (-1740.496) (-1737.924) (-1754.762) [-1738.772] -- 0:00:52 37500 -- [-1742.479] (-1750.344) (-1756.206) (-1739.519) * [-1740.342] (-1740.322) (-1744.146) (-1742.498) -- 0:00:51 38000 -- (-1742.804) [-1746.009] (-1751.913) (-1739.472) * [-1738.950] (-1745.008) (-1741.689) (-1742.289) -- 0:00:50 38500 -- (-1739.628) [-1749.883] (-1744.372) (-1738.487) * (-1739.436) (-1738.231) [-1741.645] (-1742.882) -- 0:00:49 39000 -- [-1739.096] (-1751.665) (-1754.008) (-1739.118) * (-1741.035) (-1739.011) (-1741.555) [-1743.248] -- 0:00:49 39500 -- (-1740.881) (-1745.971) (-1743.068) [-1738.068] * (-1744.142) [-1738.010] (-1739.982) (-1743.803) -- 0:00:48 40000 -- (-1737.710) [-1745.440] (-1743.402) (-1737.379) * (-1738.606) [-1741.744] (-1743.591) (-1740.365) -- 0:00:48 Average standard deviation of split frequencies: 0.033488 40500 -- (-1737.355) (-1766.716) (-1740.558) [-1739.698] * (-1738.805) (-1740.792) (-1740.854) [-1739.001] -- 0:00:47 41000 -- (-1737.355) (-1746.214) (-1741.762) [-1739.508] * (-1738.811) [-1737.292] (-1740.915) (-1738.958) -- 0:00:46 41500 -- (-1738.787) (-1742.666) (-1740.556) [-1739.405] * [-1737.120] (-1739.179) (-1740.922) (-1738.254) -- 0:01:09 42000 -- [-1736.960] (-1746.603) (-1740.538) (-1740.461) * (-1740.540) (-1740.357) [-1739.763] (-1739.359) -- 0:01:08 42500 -- (-1738.247) [-1741.719] (-1738.357) (-1741.272) * (-1739.522) [-1740.297] (-1738.420) (-1741.044) -- 0:01:07 43000 -- (-1737.234) [-1738.421] (-1738.520) (-1739.974) * (-1742.574) (-1737.299) [-1740.196] (-1738.871) -- 0:01:06 43500 -- (-1737.919) [-1737.251] (-1739.045) (-1741.339) * (-1739.826) (-1738.731) (-1739.511) [-1738.366] -- 0:01:05 44000 -- [-1738.621] (-1738.542) (-1743.920) (-1740.460) * [-1737.604] (-1737.882) (-1741.090) (-1738.834) -- 0:01:05 44500 -- (-1737.770) (-1740.141) (-1741.834) [-1740.663] * [-1737.547] (-1737.865) (-1739.042) (-1738.099) -- 0:01:04 45000 -- (-1738.696) (-1739.034) [-1737.667] (-1740.397) * [-1737.910] (-1738.907) (-1740.368) (-1738.508) -- 0:01:03 Average standard deviation of split frequencies: 0.033672 45500 -- (-1740.571) (-1738.354) (-1738.895) [-1738.400] * (-1738.506) [-1738.747] (-1738.530) (-1739.778) -- 0:01:02 46000 -- [-1738.742] (-1741.219) (-1738.804) (-1738.397) * (-1737.664) (-1738.587) [-1737.357] (-1739.975) -- 0:01:02 46500 -- (-1738.437) [-1737.500] (-1741.093) (-1741.873) * (-1738.533) [-1740.566] (-1737.845) (-1738.718) -- 0:01:01 47000 -- (-1739.128) [-1737.558] (-1739.526) (-1739.915) * [-1738.371] (-1740.104) (-1738.803) (-1738.444) -- 0:01:00 47500 -- [-1740.358] (-1742.288) (-1737.879) (-1739.916) * [-1739.379] (-1739.850) (-1738.122) (-1738.691) -- 0:01:00 48000 -- (-1739.260) [-1739.066] (-1737.464) (-1740.782) * (-1739.968) (-1740.097) (-1738.242) [-1738.295] -- 0:00:59 48500 -- (-1737.823) [-1738.865] (-1738.813) (-1740.115) * [-1740.424] (-1741.250) (-1745.394) (-1738.965) -- 0:00:58 49000 -- (-1738.698) (-1738.516) (-1745.614) [-1741.670] * (-1738.164) (-1739.479) [-1740.665] (-1740.021) -- 0:00:58 49500 -- (-1738.615) [-1737.782] (-1747.178) (-1739.316) * (-1737.584) [-1740.423] (-1737.382) (-1739.954) -- 0:00:57 50000 -- [-1740.049] (-1737.782) (-1739.709) (-1739.420) * (-1739.366) (-1740.722) (-1737.398) [-1739.506] -- 0:00:57 Average standard deviation of split frequencies: 0.032343 50500 -- (-1739.037) (-1738.683) [-1738.996] (-1739.337) * (-1740.802) (-1741.632) [-1737.294] (-1739.403) -- 0:00:56 51000 -- (-1740.026) (-1738.176) (-1738.858) [-1738.865] * [-1738.922] (-1741.000) (-1737.508) (-1743.881) -- 0:00:55 51500 -- (-1739.222) (-1739.528) (-1738.295) [-1738.334] * (-1738.904) (-1738.992) (-1740.053) [-1737.612] -- 0:00:55 52000 -- (-1741.101) (-1740.829) [-1738.860] (-1739.267) * (-1743.420) [-1738.995] (-1740.178) (-1739.438) -- 0:00:54 52500 -- (-1741.526) [-1742.048] (-1738.578) (-1739.332) * (-1739.818) (-1738.278) [-1740.200] (-1738.348) -- 0:00:54 53000 -- (-1743.578) [-1739.236] (-1742.324) (-1738.686) * (-1738.303) (-1739.305) [-1738.944] (-1739.000) -- 0:00:53 53500 -- [-1739.558] (-1739.757) (-1738.944) (-1737.836) * (-1737.445) (-1739.264) (-1741.000) [-1738.958] -- 0:00:53 54000 -- (-1737.442) (-1741.607) [-1739.684] (-1738.062) * [-1739.167] (-1742.279) (-1738.315) (-1742.416) -- 0:00:52 54500 -- [-1737.463] (-1743.023) (-1739.019) (-1740.828) * (-1739.340) [-1740.430] (-1737.360) (-1738.824) -- 0:00:52 55000 -- (-1738.440) (-1739.516) [-1739.147] (-1740.151) * (-1739.433) (-1740.284) (-1737.184) [-1741.304] -- 0:00:51 Average standard deviation of split frequencies: 0.035887 55500 -- (-1738.675) (-1739.143) [-1737.623] (-1740.564) * (-1740.710) (-1740.920) (-1738.059) [-1742.372] -- 0:01:08 56000 -- [-1740.399] (-1739.014) (-1739.373) (-1738.881) * [-1738.593] (-1741.007) (-1738.006) (-1739.742) -- 0:01:07 56500 -- [-1739.561] (-1741.571) (-1737.384) (-1737.720) * [-1738.611] (-1743.052) (-1738.596) (-1740.120) -- 0:01:06 57000 -- (-1740.072) (-1739.191) (-1738.061) [-1737.599] * (-1739.183) [-1738.715] (-1742.870) (-1738.552) -- 0:01:06 57500 -- [-1738.736] (-1737.881) (-1743.405) (-1741.994) * (-1739.745) [-1739.075] (-1738.487) (-1738.348) -- 0:01:05 58000 -- (-1739.141) (-1740.900) [-1740.487] (-1739.602) * [-1738.756] (-1739.854) (-1737.347) (-1741.694) -- 0:01:04 58500 -- (-1739.306) (-1742.967) [-1739.226] (-1738.427) * [-1738.190] (-1740.560) (-1739.341) (-1743.274) -- 0:01:04 59000 -- (-1742.364) [-1738.173] (-1739.273) (-1737.738) * (-1738.822) (-1740.490) (-1738.118) [-1739.118] -- 0:01:03 59500 -- [-1741.249] (-1738.326) (-1738.281) (-1738.530) * (-1738.718) [-1739.847] (-1738.227) (-1740.626) -- 0:01:03 60000 -- [-1738.536] (-1741.498) (-1737.799) (-1738.000) * (-1738.678) (-1738.590) [-1737.946] (-1739.289) -- 0:01:02 Average standard deviation of split frequencies: 0.031082 60500 -- [-1738.922] (-1742.111) (-1737.798) (-1738.354) * [-1740.655] (-1740.558) (-1743.548) (-1738.001) -- 0:01:02 61000 -- (-1739.802) (-1739.812) (-1740.851) [-1738.448] * [-1738.964] (-1740.159) (-1738.896) (-1737.715) -- 0:01:01 61500 -- (-1740.029) (-1738.734) [-1738.981] (-1740.047) * (-1738.573) (-1739.566) (-1741.408) [-1739.201] -- 0:01:01 62000 -- (-1740.983) [-1739.536] (-1738.422) (-1739.553) * (-1739.826) (-1740.678) [-1738.240] (-1737.858) -- 0:01:00 62500 -- [-1738.704] (-1739.209) (-1738.467) (-1744.455) * (-1737.552) (-1741.474) [-1738.240] (-1738.745) -- 0:01:00 63000 -- (-1737.829) (-1739.578) [-1737.871] (-1740.944) * [-1737.303] (-1739.133) (-1737.965) (-1741.996) -- 0:00:59 63500 -- (-1739.529) (-1741.425) [-1738.902] (-1739.859) * (-1737.312) [-1740.229] (-1737.900) (-1739.587) -- 0:00:58 64000 -- (-1738.843) [-1739.626] (-1738.901) (-1740.181) * [-1736.992] (-1740.167) (-1739.199) (-1739.425) -- 0:00:58 64500 -- (-1738.532) [-1739.858] (-1738.289) (-1740.304) * (-1737.266) [-1738.803] (-1741.188) (-1737.116) -- 0:00:58 65000 -- (-1740.100) [-1741.041] (-1737.787) (-1741.938) * (-1737.508) (-1738.124) (-1738.515) [-1739.846] -- 0:00:57 Average standard deviation of split frequencies: 0.026784 65500 -- (-1738.395) (-1740.821) [-1738.184] (-1738.976) * (-1739.640) (-1738.327) (-1739.246) [-1740.211] -- 0:00:57 66000 -- (-1740.210) (-1742.535) [-1740.298] (-1739.583) * (-1739.310) [-1738.406] (-1742.784) (-1739.374) -- 0:00:56 66500 -- [-1738.329] (-1740.734) (-1737.353) (-1739.154) * [-1738.536] (-1737.618) (-1742.582) (-1739.072) -- 0:00:56 67000 -- (-1738.329) (-1739.216) (-1739.945) [-1740.283] * [-1738.536] (-1740.067) (-1741.424) (-1739.048) -- 0:00:55 67500 -- (-1741.321) (-1738.086) [-1737.676] (-1737.353) * (-1739.174) (-1738.938) [-1739.179] (-1740.432) -- 0:00:55 68000 -- (-1741.618) (-1738.755) [-1739.093] (-1738.294) * (-1744.243) (-1741.090) (-1738.170) [-1740.598] -- 0:00:54 68500 -- (-1737.732) (-1739.210) [-1740.621] (-1738.307) * (-1738.212) (-1740.688) (-1741.350) [-1740.039] -- 0:00:54 69000 -- [-1737.606] (-1738.934) (-1741.501) (-1737.272) * (-1739.944) (-1739.496) [-1739.165] (-1740.004) -- 0:00:53 69500 -- (-1737.818) (-1740.857) (-1739.277) [-1737.985] * (-1739.726) [-1740.873] (-1738.820) (-1746.174) -- 0:00:53 70000 -- [-1737.648] (-1743.185) (-1739.907) (-1743.814) * (-1742.456) (-1741.815) (-1739.106) [-1740.409] -- 0:01:06 Average standard deviation of split frequencies: 0.024682 70500 -- (-1737.737) (-1744.114) [-1737.368] (-1742.650) * (-1740.112) [-1741.653] (-1738.806) (-1739.131) -- 0:01:05 71000 -- (-1742.611) (-1743.744) (-1738.983) [-1737.769] * (-1738.516) [-1740.837] (-1737.339) (-1744.998) -- 0:01:05 71500 -- (-1740.599) [-1743.843] (-1738.364) (-1738.828) * (-1739.884) (-1741.177) (-1738.060) [-1743.620] -- 0:01:04 72000 -- (-1739.657) (-1742.271) [-1738.438] (-1738.995) * [-1742.428] (-1738.451) (-1737.958) (-1740.306) -- 0:01:04 72500 -- (-1738.496) [-1737.491] (-1739.254) (-1739.118) * (-1739.719) [-1738.901] (-1738.228) (-1738.378) -- 0:01:03 73000 -- (-1739.906) (-1738.276) (-1740.033) [-1738.102] * (-1742.227) (-1741.101) (-1741.214) [-1738.352] -- 0:01:03 73500 -- (-1739.416) [-1737.834] (-1739.938) (-1738.474) * (-1742.977) (-1740.775) (-1742.342) [-1738.900] -- 0:01:03 74000 -- (-1738.462) [-1737.905] (-1740.196) (-1737.878) * (-1737.368) (-1739.740) [-1739.694] (-1738.995) -- 0:01:02 74500 -- (-1739.187) [-1739.157] (-1740.136) (-1737.275) * (-1739.756) (-1741.784) (-1742.638) [-1738.582] -- 0:01:02 75000 -- [-1739.819] (-1738.809) (-1737.760) (-1739.402) * (-1738.641) (-1741.948) [-1739.026] (-1743.881) -- 0:01:01 Average standard deviation of split frequencies: 0.021873 75500 -- [-1740.447] (-1738.943) (-1742.488) (-1737.554) * [-1739.596] (-1742.677) (-1739.336) (-1745.092) -- 0:01:01 76000 -- (-1740.967) (-1739.192) (-1740.064) [-1738.234] * [-1739.342] (-1741.244) (-1740.839) (-1744.578) -- 0:01:00 76500 -- [-1740.053] (-1738.616) (-1738.493) (-1737.775) * [-1737.986] (-1740.483) (-1739.955) (-1740.897) -- 0:01:00 77000 -- (-1737.964) (-1739.486) (-1740.054) [-1745.235] * (-1737.716) (-1738.932) [-1738.300] (-1741.387) -- 0:00:59 77500 -- [-1738.119] (-1739.697) (-1739.029) (-1739.008) * (-1742.605) (-1739.300) [-1738.286] (-1740.353) -- 0:00:59 78000 -- [-1738.145] (-1744.575) (-1738.698) (-1738.132) * (-1738.707) (-1739.619) (-1740.560) [-1739.881] -- 0:00:59 78500 -- (-1738.445) (-1742.814) [-1742.018] (-1742.871) * (-1740.783) [-1743.401] (-1740.533) (-1744.273) -- 0:00:58 79000 -- (-1741.010) (-1738.563) (-1742.551) [-1740.974] * (-1739.427) (-1740.981) [-1740.280] (-1746.565) -- 0:00:58 79500 -- [-1738.246] (-1742.197) (-1740.781) (-1740.229) * (-1738.323) [-1743.576] (-1741.907) (-1741.152) -- 0:00:57 80000 -- (-1742.238) (-1738.900) (-1738.824) [-1739.865] * (-1741.892) (-1739.414) [-1737.785] (-1740.025) -- 0:00:57 Average standard deviation of split frequencies: 0.019285 80500 -- (-1738.844) [-1738.935] (-1743.561) (-1739.810) * (-1739.626) (-1738.724) [-1737.668] (-1740.579) -- 0:00:57 81000 -- [-1738.263] (-1738.375) (-1743.206) (-1739.513) * (-1742.316) (-1737.132) [-1738.306] (-1738.846) -- 0:00:56 81500 -- [-1741.437] (-1738.707) (-1739.480) (-1741.421) * (-1742.469) [-1737.132] (-1741.685) (-1738.588) -- 0:00:56 82000 -- (-1741.026) (-1738.042) (-1741.450) [-1739.712] * (-1739.202) (-1737.731) [-1741.263] (-1738.844) -- 0:00:55 82500 -- (-1737.450) (-1738.042) [-1739.911] (-1740.314) * (-1742.998) [-1738.637] (-1739.687) (-1738.159) -- 0:00:55 83000 -- (-1737.198) (-1738.685) [-1741.473] (-1741.220) * (-1744.613) [-1739.281] (-1739.795) (-1743.716) -- 0:00:55 83500 -- (-1742.432) (-1738.667) [-1742.770] (-1738.790) * (-1738.024) (-1738.998) [-1739.067] (-1742.328) -- 0:00:54 84000 -- (-1741.081) (-1738.955) [-1743.899] (-1739.899) * (-1738.444) (-1739.576) [-1739.260] (-1737.802) -- 0:00:54 84500 -- (-1740.377) [-1737.884] (-1739.711) (-1738.742) * (-1737.642) [-1738.653] (-1739.662) (-1741.814) -- 0:00:54 85000 -- (-1741.860) [-1738.244] (-1738.849) (-1738.679) * [-1737.565] (-1738.704) (-1737.656) (-1738.141) -- 0:00:53 Average standard deviation of split frequencies: 0.016992 85500 -- (-1740.645) (-1738.544) (-1741.591) [-1738.616] * (-1737.943) [-1740.749] (-1739.113) (-1739.165) -- 0:01:04 86000 -- (-1738.578) [-1737.273] (-1741.203) (-1746.704) * (-1737.880) (-1742.507) (-1745.151) [-1739.286] -- 0:01:03 86500 -- (-1740.113) [-1737.270] (-1740.452) (-1738.268) * [-1737.880] (-1742.288) (-1741.400) (-1737.845) -- 0:01:03 87000 -- (-1738.776) (-1737.244) [-1740.917] (-1738.413) * [-1737.345] (-1739.833) (-1740.812) (-1737.869) -- 0:01:02 87500 -- [-1738.918] (-1736.995) (-1741.635) (-1740.308) * (-1738.202) (-1740.701) (-1739.986) [-1741.746] -- 0:01:02 88000 -- (-1740.390) (-1739.903) (-1743.022) [-1738.505] * (-1739.133) [-1739.157] (-1741.685) (-1746.138) -- 0:01:02 88500 -- [-1738.906] (-1737.884) (-1740.720) (-1738.804) * (-1737.867) [-1739.696] (-1740.048) (-1737.451) -- 0:01:01 89000 -- (-1740.183) [-1737.940] (-1739.391) (-1741.488) * (-1739.751) (-1739.921) [-1741.223] (-1739.463) -- 0:01:01 89500 -- [-1738.567] (-1738.951) (-1740.139) (-1739.817) * (-1737.179) [-1738.637] (-1743.662) (-1739.024) -- 0:01:01 90000 -- (-1739.229) (-1741.106) [-1738.240] (-1739.520) * (-1738.050) [-1743.392] (-1742.834) (-1739.482) -- 0:01:00 Average standard deviation of split frequencies: 0.016419 90500 -- [-1738.954] (-1741.339) (-1737.549) (-1739.500) * [-1739.367] (-1739.523) (-1739.093) (-1737.591) -- 0:01:00 91000 -- (-1738.266) (-1738.580) [-1737.602] (-1739.094) * (-1742.210) (-1739.536) [-1738.372] (-1737.780) -- 0:00:59 91500 -- (-1739.778) (-1737.229) [-1737.779] (-1742.127) * [-1738.992] (-1737.558) (-1738.486) (-1738.011) -- 0:00:59 92000 -- (-1739.200) [-1738.926] (-1739.548) (-1739.149) * (-1739.668) [-1738.525] (-1741.079) (-1738.119) -- 0:00:59 92500 -- (-1737.242) (-1739.855) [-1737.837] (-1740.496) * [-1739.327] (-1739.591) (-1739.362) (-1738.312) -- 0:00:58 93000 -- (-1737.734) [-1739.263] (-1738.729) (-1741.827) * (-1738.517) (-1738.843) (-1739.364) [-1740.217] -- 0:00:58 93500 -- (-1737.371) (-1738.525) [-1738.299] (-1739.610) * (-1741.244) (-1739.325) (-1740.795) [-1739.885] -- 0:00:58 94000 -- (-1738.638) (-1740.379) [-1740.745] (-1739.872) * (-1741.244) (-1738.381) [-1738.361] (-1740.775) -- 0:00:57 94500 -- (-1739.225) (-1741.803) (-1739.694) [-1740.312] * (-1744.857) [-1744.309] (-1741.268) (-1739.443) -- 0:00:57 95000 -- (-1742.870) (-1744.416) (-1740.801) [-1742.873] * (-1741.187) (-1746.645) (-1742.361) [-1740.728] -- 0:00:57 Average standard deviation of split frequencies: 0.013439 95500 -- (-1739.992) [-1739.142] (-1737.407) (-1738.521) * (-1741.335) (-1749.689) [-1744.194] (-1739.926) -- 0:00:56 96000 -- (-1738.727) (-1738.972) [-1738.096] (-1741.536) * (-1739.336) (-1745.640) [-1739.912] (-1740.262) -- 0:00:56 96500 -- (-1738.020) (-1739.365) [-1738.075] (-1738.688) * [-1738.935] (-1743.151) (-1739.774) (-1739.640) -- 0:00:56 97000 -- (-1740.810) (-1738.808) (-1738.567) [-1740.369] * (-1741.096) [-1739.942] (-1738.078) (-1740.191) -- 0:00:55 97500 -- (-1739.755) (-1739.011) [-1737.644] (-1740.162) * (-1739.949) (-1737.728) [-1737.746] (-1740.519) -- 0:00:55 98000 -- (-1740.286) (-1739.892) (-1741.115) [-1740.799] * (-1741.243) [-1738.120] (-1738.669) (-1743.101) -- 0:00:55 98500 -- (-1741.487) (-1739.374) (-1740.670) [-1739.547] * [-1739.036] (-1738.120) (-1737.240) (-1741.730) -- 0:00:54 99000 -- [-1742.153] (-1738.872) (-1740.068) (-1739.128) * [-1739.820] (-1739.865) (-1740.500) (-1737.997) -- 0:00:54 99500 -- (-1739.337) (-1738.063) (-1742.690) [-1740.251] * [-1739.505] (-1745.021) (-1743.517) (-1737.671) -- 0:00:54 100000 -- (-1738.892) (-1741.397) [-1743.066] (-1739.124) * (-1739.937) [-1737.657] (-1742.833) (-1737.519) -- 0:00:54 Average standard deviation of split frequencies: 0.012570 100500 -- (-1740.053) (-1738.544) (-1738.912) [-1739.361] * (-1739.982) (-1738.753) (-1741.774) [-1738.190] -- 0:01:02 101000 -- (-1740.097) (-1743.529) [-1737.963] (-1744.751) * (-1738.635) (-1739.039) (-1742.632) [-1742.149] -- 0:01:02 101500 -- (-1742.826) (-1739.320) (-1741.258) [-1742.715] * (-1740.075) (-1741.217) (-1740.742) [-1742.796] -- 0:01:01 102000 -- (-1740.358) [-1740.236] (-1740.216) (-1738.712) * (-1739.179) [-1738.821] (-1740.618) (-1739.408) -- 0:01:01 102500 -- (-1740.415) (-1739.694) (-1738.754) [-1737.436] * (-1738.584) (-1737.933) (-1739.133) [-1740.395] -- 0:01:01 103000 -- [-1739.859] (-1739.516) (-1737.904) (-1737.493) * [-1738.816] (-1739.590) (-1739.848) (-1744.178) -- 0:01:00 103500 -- [-1738.336] (-1739.518) (-1737.864) (-1738.033) * (-1740.158) (-1740.323) (-1738.422) [-1737.631] -- 0:01:00 104000 -- (-1740.391) [-1739.154] (-1740.771) (-1737.875) * (-1739.605) (-1739.559) [-1738.379] (-1739.521) -- 0:01:00 104500 -- (-1739.975) (-1739.267) [-1738.186] (-1737.615) * (-1739.686) (-1738.957) [-1738.411] (-1739.093) -- 0:00:59 105000 -- (-1742.991) (-1740.446) [-1740.216] (-1741.825) * (-1741.372) [-1739.386] (-1741.585) (-1741.029) -- 0:00:59 Average standard deviation of split frequencies: 0.013786 105500 -- (-1738.385) [-1737.826] (-1748.360) (-1739.045) * (-1743.502) [-1738.481] (-1742.409) (-1739.474) -- 0:00:59 106000 -- [-1740.379] (-1738.756) (-1745.603) (-1740.144) * (-1739.964) (-1739.449) [-1741.540] (-1740.640) -- 0:00:59 106500 -- [-1739.758] (-1737.903) (-1744.186) (-1739.914) * (-1738.231) (-1739.069) (-1743.869) [-1738.846] -- 0:00:58 107000 -- (-1738.872) (-1738.083) (-1741.448) [-1739.986] * [-1738.968] (-1739.979) (-1741.660) (-1738.813) -- 0:00:58 107500 -- (-1741.410) (-1739.961) (-1739.485) [-1739.158] * [-1737.986] (-1741.434) (-1743.671) (-1738.129) -- 0:00:58 108000 -- (-1746.011) [-1738.826] (-1740.040) (-1740.297) * (-1737.656) [-1743.662] (-1742.496) (-1739.458) -- 0:00:57 108500 -- (-1746.698) [-1738.946] (-1739.570) (-1740.125) * (-1737.331) [-1741.146] (-1740.551) (-1739.834) -- 0:00:57 109000 -- [-1739.489] (-1741.845) (-1738.790) (-1738.866) * [-1738.867] (-1738.655) (-1741.622) (-1738.900) -- 0:00:57 109500 -- (-1738.952) [-1739.520] (-1738.380) (-1740.185) * [-1739.266] (-1739.017) (-1739.352) (-1740.745) -- 0:00:56 110000 -- [-1738.634] (-1739.983) (-1737.712) (-1738.413) * (-1739.894) (-1741.634) (-1740.926) [-1738.297] -- 0:00:56 Average standard deviation of split frequencies: 0.018256 110500 -- (-1738.958) (-1740.605) (-1739.110) [-1738.810] * (-1743.669) (-1741.800) [-1740.317] (-1737.430) -- 0:00:56 111000 -- (-1739.848) (-1738.868) [-1740.177] (-1739.019) * [-1741.759] (-1741.400) (-1739.715) (-1737.699) -- 0:00:56 111500 -- (-1738.962) (-1738.169) [-1737.947] (-1739.128) * (-1741.697) (-1741.000) (-1739.830) [-1738.562] -- 0:00:55 112000 -- (-1739.095) [-1739.100] (-1737.647) (-1738.657) * (-1738.650) [-1740.307] (-1740.241) (-1737.839) -- 0:00:55 112500 -- [-1739.115] (-1738.285) (-1738.694) (-1738.513) * (-1737.496) (-1738.793) (-1739.816) [-1737.799] -- 0:00:55 113000 -- (-1738.670) [-1738.394] (-1737.204) (-1737.811) * (-1737.231) (-1739.577) [-1740.257] (-1738.222) -- 0:00:54 113500 -- [-1739.103] (-1738.539) (-1737.326) (-1738.800) * (-1738.914) (-1742.784) (-1742.621) [-1739.737] -- 0:00:54 114000 -- (-1741.017) (-1740.163) (-1738.561) [-1738.396] * [-1738.373] (-1743.650) (-1743.112) (-1740.237) -- 0:00:54 114500 -- (-1740.121) (-1740.369) [-1737.332] (-1738.119) * (-1738.650) (-1745.540) (-1741.898) [-1741.471] -- 0:00:54 115000 -- (-1739.001) [-1740.551] (-1737.360) (-1738.626) * (-1737.443) (-1740.176) [-1742.005] (-1739.011) -- 0:00:53 Average standard deviation of split frequencies: 0.017474 115500 -- (-1739.005) (-1739.829) [-1737.405] (-1741.105) * (-1738.614) (-1743.689) (-1742.569) [-1738.600] -- 0:00:53 116000 -- (-1738.649) (-1739.026) (-1738.793) [-1740.622] * (-1742.247) (-1741.379) [-1737.439] (-1740.702) -- 0:01:00 116500 -- [-1738.150] (-1742.461) (-1740.593) (-1738.839) * [-1739.929] (-1738.401) (-1741.972) (-1739.036) -- 0:01:00 117000 -- (-1739.353) (-1739.604) [-1739.888] (-1739.664) * [-1740.283] (-1739.090) (-1737.244) (-1741.249) -- 0:01:00 117500 -- (-1742.251) [-1742.512] (-1740.196) (-1744.772) * (-1738.030) (-1742.795) [-1739.437] (-1741.624) -- 0:01:00 118000 -- (-1741.190) (-1740.822) [-1742.302] (-1738.563) * (-1739.060) (-1739.141) [-1737.948] (-1741.764) -- 0:00:59 118500 -- (-1739.366) (-1741.820) (-1740.630) [-1737.858] * [-1738.918] (-1742.949) (-1737.948) (-1741.835) -- 0:00:59 119000 -- (-1740.733) [-1742.858] (-1739.110) (-1740.477) * (-1738.718) (-1740.244) (-1737.677) [-1742.326] -- 0:00:59 119500 -- (-1737.696) (-1739.926) (-1740.660) [-1737.688] * (-1742.054) (-1740.870) [-1739.244] (-1743.052) -- 0:00:58 120000 -- (-1737.442) [-1739.842] (-1739.321) (-1737.328) * (-1738.344) (-1741.060) [-1738.828] (-1740.084) -- 0:00:58 Average standard deviation of split frequencies: 0.018166 120500 -- [-1737.780] (-1740.025) (-1739.071) (-1745.752) * (-1738.638) [-1738.551] (-1738.919) (-1740.276) -- 0:00:58 121000 -- (-1738.995) (-1740.896) (-1739.230) [-1745.247] * [-1739.547] (-1743.297) (-1738.918) (-1737.400) -- 0:00:58 121500 -- (-1739.289) [-1738.717] (-1738.604) (-1742.456) * [-1738.972] (-1739.879) (-1738.928) (-1738.214) -- 0:00:57 122000 -- [-1739.487] (-1740.941) (-1742.621) (-1740.970) * [-1739.531] (-1738.177) (-1738.212) (-1739.193) -- 0:00:57 122500 -- [-1739.836] (-1739.535) (-1743.810) (-1739.180) * (-1738.106) (-1738.245) [-1737.983] (-1738.037) -- 0:00:57 123000 -- [-1738.111] (-1740.589) (-1738.826) (-1738.093) * (-1738.884) [-1742.580] (-1741.866) (-1738.037) -- 0:00:57 123500 -- (-1739.198) (-1741.925) (-1741.243) [-1740.031] * (-1738.351) (-1740.342) [-1740.134] (-1740.662) -- 0:00:56 124000 -- (-1737.777) [-1741.377] (-1738.971) (-1741.218) * (-1740.277) [-1739.550] (-1739.799) (-1737.837) -- 0:00:56 124500 -- (-1739.613) [-1738.461] (-1739.850) (-1741.178) * [-1739.923] (-1741.441) (-1741.900) (-1738.822) -- 0:00:56 125000 -- (-1740.485) (-1739.381) (-1739.977) [-1742.463] * (-1740.504) (-1740.085) [-1740.281] (-1738.855) -- 0:00:56 Average standard deviation of split frequencies: 0.017994 125500 -- (-1738.832) (-1739.204) [-1741.246] (-1745.482) * (-1738.421) (-1739.503) [-1740.709] (-1739.593) -- 0:00:55 126000 -- [-1743.370] (-1739.819) (-1743.875) (-1738.023) * (-1739.876) (-1740.254) (-1739.135) [-1738.714] -- 0:00:55 126500 -- (-1738.688) [-1740.519] (-1739.986) (-1740.210) * (-1740.255) [-1739.292] (-1739.766) (-1740.542) -- 0:00:55 127000 -- (-1738.370) (-1740.772) (-1739.281) [-1738.636] * [-1741.017] (-1740.015) (-1739.117) (-1742.438) -- 0:00:54 127500 -- (-1738.601) (-1740.198) (-1739.941) [-1743.163] * [-1739.751] (-1741.068) (-1737.895) (-1738.147) -- 0:00:54 128000 -- (-1739.757) (-1742.015) [-1738.998] (-1737.923) * (-1739.012) [-1738.758] (-1737.805) (-1738.493) -- 0:00:54 128500 -- (-1738.193) (-1740.302) [-1739.214] (-1740.666) * (-1737.524) [-1737.906] (-1739.304) (-1740.129) -- 0:00:54 129000 -- (-1739.083) (-1744.712) (-1740.021) [-1738.692] * (-1740.904) (-1737.431) (-1738.779) [-1740.077] -- 0:00:54 129500 -- (-1744.371) (-1742.449) [-1741.481] (-1738.056) * (-1742.974) [-1738.094] (-1739.964) (-1741.208) -- 0:00:53 130000 -- (-1744.419) (-1741.537) [-1739.451] (-1738.228) * [-1739.266] (-1737.516) (-1738.098) (-1740.568) -- 0:00:53 Average standard deviation of split frequencies: 0.017849 130500 -- (-1740.842) (-1739.857) [-1739.127] (-1737.929) * [-1739.009] (-1737.886) (-1741.282) (-1740.289) -- 0:00:53 131000 -- (-1739.329) (-1741.036) [-1739.267] (-1738.394) * [-1739.556] (-1737.140) (-1738.161) (-1743.425) -- 0:00:53 131500 -- [-1738.045] (-1740.836) (-1741.759) (-1742.071) * [-1737.554] (-1738.243) (-1740.205) (-1739.234) -- 0:00:52 132000 -- (-1739.355) (-1739.436) [-1743.398] (-1738.988) * (-1740.144) [-1738.306] (-1741.492) (-1739.869) -- 0:00:59 132500 -- (-1738.629) (-1738.850) [-1739.462] (-1738.116) * (-1741.507) (-1742.373) [-1737.891] (-1743.214) -- 0:00:58 133000 -- [-1737.611] (-1739.372) (-1737.909) (-1738.307) * (-1739.306) (-1743.991) (-1741.055) [-1738.471] -- 0:00:58 133500 -- (-1740.592) (-1739.517) [-1738.564] (-1737.397) * [-1739.418] (-1740.671) (-1739.749) (-1738.861) -- 0:00:58 134000 -- (-1738.580) (-1739.007) (-1739.987) [-1737.907] * (-1738.018) (-1739.834) (-1738.217) [-1739.714] -- 0:00:58 134500 -- (-1740.108) [-1742.833] (-1740.655) (-1738.704) * (-1738.157) (-1741.600) (-1738.537) [-1739.323] -- 0:00:57 135000 -- (-1741.780) (-1745.214) (-1740.795) [-1737.305] * (-1739.054) (-1740.884) [-1737.971] (-1739.075) -- 0:00:57 Average standard deviation of split frequencies: 0.017878 135500 -- [-1737.746] (-1741.081) (-1741.909) (-1737.303) * (-1737.990) [-1740.172] (-1737.782) (-1741.725) -- 0:00:57 136000 -- (-1737.204) (-1741.099) (-1738.755) [-1739.304] * (-1739.467) [-1739.475] (-1737.757) (-1742.253) -- 0:00:57 136500 -- [-1739.084] (-1741.313) (-1737.530) (-1739.199) * (-1738.843) [-1740.746] (-1739.436) (-1738.225) -- 0:00:56 137000 -- (-1738.282) [-1740.493] (-1740.021) (-1740.079) * (-1739.316) (-1739.027) (-1739.858) [-1739.119] -- 0:00:56 137500 -- (-1737.727) (-1739.534) (-1741.009) [-1739.727] * [-1738.771] (-1738.284) (-1741.724) (-1738.409) -- 0:00:56 138000 -- (-1738.391) (-1738.606) (-1738.272) [-1741.514] * [-1739.311] (-1737.379) (-1739.444) (-1737.019) -- 0:00:56 138500 -- (-1738.668) (-1739.269) [-1738.272] (-1739.088) * [-1740.684] (-1737.476) (-1738.506) (-1739.291) -- 0:00:55 139000 -- [-1739.010] (-1737.758) (-1739.390) (-1739.626) * (-1737.711) [-1737.789] (-1738.852) (-1737.816) -- 0:00:55 139500 -- (-1738.229) [-1738.420] (-1738.126) (-1741.280) * (-1737.711) (-1739.353) [-1738.842] (-1737.941) -- 0:00:55 140000 -- [-1739.591] (-1738.636) (-1738.087) (-1737.655) * (-1737.711) (-1739.423) [-1739.238] (-1737.762) -- 0:00:55 Average standard deviation of split frequencies: 0.016932 140500 -- (-1739.741) (-1740.231) (-1740.260) [-1738.980] * (-1738.154) (-1739.712) (-1737.792) [-1738.311] -- 0:00:55 141000 -- [-1738.933] (-1738.114) (-1740.210) (-1740.843) * [-1740.804] (-1738.122) (-1737.790) (-1742.139) -- 0:00:54 141500 -- [-1740.741] (-1740.707) (-1738.129) (-1743.242) * [-1738.581] (-1738.153) (-1741.039) (-1738.063) -- 0:00:54 142000 -- (-1743.424) [-1738.667] (-1738.529) (-1743.388) * [-1738.726] (-1738.893) (-1738.149) (-1737.367) -- 0:00:54 142500 -- (-1742.093) (-1740.875) (-1738.994) [-1744.607] * (-1739.550) [-1737.620] (-1737.908) (-1741.158) -- 0:00:54 143000 -- (-1739.738) (-1739.606) [-1736.951] (-1742.393) * (-1738.032) [-1737.383] (-1737.448) (-1742.656) -- 0:00:53 143500 -- (-1740.305) (-1739.943) [-1738.439] (-1740.283) * (-1739.597) [-1737.962] (-1737.423) (-1739.487) -- 0:00:53 144000 -- (-1739.298) [-1737.875] (-1739.463) (-1740.399) * [-1742.778] (-1738.282) (-1739.155) (-1739.327) -- 0:00:53 144500 -- (-1739.612) [-1738.209] (-1740.965) (-1739.282) * [-1739.328] (-1740.017) (-1738.047) (-1740.018) -- 0:00:53 145000 -- (-1740.435) (-1736.979) (-1743.668) [-1740.969] * (-1739.614) (-1738.462) [-1740.693] (-1742.619) -- 0:00:53 Average standard deviation of split frequencies: 0.015068 145500 -- [-1738.621] (-1739.503) (-1739.869) (-1740.105) * (-1737.836) [-1737.824] (-1739.728) (-1739.037) -- 0:00:52 146000 -- (-1739.459) (-1741.048) [-1739.026] (-1740.224) * (-1741.356) [-1738.219] (-1739.008) (-1739.517) -- 0:00:52 146500 -- (-1738.790) [-1740.927] (-1739.797) (-1740.120) * (-1739.979) (-1739.319) [-1740.405] (-1739.185) -- 0:00:52 147000 -- (-1739.414) (-1737.544) (-1738.160) [-1739.360] * (-1744.112) (-1738.562) (-1744.477) [-1740.661] -- 0:00:52 147500 -- [-1738.254] (-1738.828) (-1737.979) (-1742.708) * (-1746.114) [-1737.086] (-1741.895) (-1739.940) -- 0:00:57 148000 -- (-1738.551) (-1739.457) [-1737.883] (-1740.702) * [-1741.764] (-1737.416) (-1738.737) (-1739.085) -- 0:00:57 148500 -- (-1742.333) (-1740.934) [-1738.640] (-1739.687) * (-1742.597) (-1739.028) (-1738.061) [-1738.051] -- 0:00:57 149000 -- (-1741.753) (-1741.044) [-1738.259] (-1739.303) * (-1740.008) (-1741.529) (-1740.692) [-1739.027] -- 0:00:57 149500 -- [-1737.803] (-1739.945) (-1738.621) (-1738.366) * [-1738.738] (-1739.750) (-1742.426) (-1739.534) -- 0:00:56 150000 -- (-1737.654) [-1738.189] (-1739.442) (-1740.524) * (-1739.633) (-1738.350) [-1737.973] (-1738.776) -- 0:00:56 Average standard deviation of split frequencies: 0.014862 150500 -- (-1739.177) (-1737.722) (-1740.040) [-1737.936] * (-1746.273) (-1738.517) [-1738.313] (-1739.282) -- 0:00:56 151000 -- (-1739.749) [-1737.825] (-1741.003) (-1737.410) * (-1740.347) (-1737.893) [-1743.505] (-1741.892) -- 0:00:56 151500 -- [-1737.335] (-1741.397) (-1741.317) (-1737.624) * (-1738.003) (-1738.470) (-1740.423) [-1740.949] -- 0:00:56 152000 -- (-1737.891) (-1740.705) (-1740.934) [-1737.603] * [-1737.390] (-1738.244) (-1744.533) (-1740.044) -- 0:00:55 152500 -- (-1738.371) (-1740.267) [-1740.729] (-1737.888) * [-1739.339] (-1738.461) (-1741.557) (-1740.366) -- 0:00:55 153000 -- (-1739.445) (-1739.053) (-1740.240) [-1737.670] * [-1737.730] (-1738.334) (-1739.047) (-1742.635) -- 0:00:55 153500 -- [-1739.259] (-1738.508) (-1739.212) (-1738.259) * [-1739.463] (-1745.363) (-1740.867) (-1738.762) -- 0:00:55 154000 -- (-1739.397) (-1739.135) (-1739.482) [-1738.281] * (-1742.504) [-1741.032] (-1739.766) (-1740.494) -- 0:00:54 154500 -- (-1738.974) (-1742.442) [-1738.960] (-1738.174) * (-1743.007) (-1740.421) (-1738.620) [-1740.815] -- 0:00:54 155000 -- (-1743.071) [-1741.057] (-1738.567) (-1739.491) * (-1741.851) [-1740.303] (-1738.799) (-1739.567) -- 0:00:54 Average standard deviation of split frequencies: 0.013360 155500 -- (-1739.936) [-1738.589] (-1740.775) (-1739.374) * (-1741.265) (-1742.398) (-1739.552) [-1739.188] -- 0:00:54 156000 -- [-1739.948] (-1738.905) (-1739.863) (-1738.701) * (-1741.375) (-1739.502) (-1739.548) [-1738.457] -- 0:00:54 156500 -- [-1739.961] (-1737.438) (-1742.394) (-1738.516) * (-1739.604) (-1739.617) (-1738.992) [-1741.764] -- 0:00:53 157000 -- [-1740.946] (-1737.397) (-1740.621) (-1739.793) * [-1741.807] (-1740.310) (-1739.867) (-1743.142) -- 0:00:53 157500 -- (-1739.011) (-1738.046) (-1740.687) [-1737.687] * [-1741.990] (-1737.899) (-1741.242) (-1744.507) -- 0:00:53 158000 -- (-1737.432) (-1738.643) (-1740.554) [-1744.335] * (-1740.783) [-1738.443] (-1740.202) (-1740.539) -- 0:00:53 158500 -- (-1737.184) (-1740.270) (-1737.610) [-1744.238] * [-1739.856] (-1739.275) (-1740.367) (-1740.495) -- 0:00:53 159000 -- (-1737.173) [-1738.662] (-1738.211) (-1744.351) * (-1739.733) [-1737.854] (-1738.634) (-1741.885) -- 0:00:52 159500 -- (-1737.940) (-1742.238) [-1738.233] (-1739.198) * (-1738.531) [-1741.173] (-1739.757) (-1738.768) -- 0:00:52 160000 -- [-1737.937] (-1740.245) (-1739.529) (-1738.525) * (-1738.432) (-1740.871) (-1737.844) [-1739.445] -- 0:00:52 Average standard deviation of split frequencies: 0.014181 160500 -- (-1740.752) (-1737.820) (-1739.529) [-1737.290] * (-1738.575) (-1741.097) (-1739.603) [-1738.156] -- 0:00:52 161000 -- (-1739.606) [-1737.803] (-1737.986) (-1739.277) * (-1739.569) [-1740.779] (-1737.584) (-1739.711) -- 0:00:52 161500 -- (-1739.936) (-1741.039) (-1738.735) [-1739.797] * [-1739.096] (-1740.145) (-1738.360) (-1741.207) -- 0:00:51 162000 -- (-1739.976) [-1737.874] (-1741.170) (-1740.267) * (-1739.278) (-1739.439) [-1740.038] (-1738.808) -- 0:00:51 162500 -- (-1741.593) (-1738.095) [-1740.583] (-1743.501) * [-1739.419] (-1740.835) (-1737.648) (-1741.688) -- 0:00:51 163000 -- (-1743.206) [-1738.066] (-1740.789) (-1741.074) * (-1743.721) (-1740.658) [-1739.459] (-1738.028) -- 0:00:56 163500 -- (-1740.051) (-1738.811) [-1737.801] (-1738.831) * (-1740.251) (-1737.777) (-1737.321) [-1742.437] -- 0:00:56 164000 -- (-1741.109) (-1739.859) [-1738.617] (-1742.866) * (-1740.517) [-1738.223] (-1738.013) (-1741.865) -- 0:00:56 164500 -- [-1738.619] (-1744.418) (-1738.745) (-1737.319) * (-1738.770) (-1738.357) (-1737.981) [-1739.605] -- 0:00:55 165000 -- (-1737.291) (-1747.274) (-1742.869) [-1738.873] * (-1738.420) (-1739.870) [-1737.247] (-1739.781) -- 0:00:55 Average standard deviation of split frequencies: 0.013410 165500 -- [-1737.482] (-1741.460) (-1738.359) (-1738.491) * (-1739.344) (-1737.859) (-1737.726) [-1738.263] -- 0:00:55 166000 -- (-1737.400) (-1742.214) (-1738.990) [-1738.625] * (-1742.309) (-1737.986) (-1738.303) [-1740.565] -- 0:00:55 166500 -- (-1741.235) [-1738.557] (-1738.727) (-1739.553) * [-1743.670] (-1740.195) (-1738.641) (-1738.787) -- 0:00:55 167000 -- (-1738.209) (-1737.931) (-1737.866) [-1740.525] * (-1742.094) (-1741.847) [-1739.790] (-1738.803) -- 0:00:54 167500 -- [-1739.306] (-1737.964) (-1739.884) (-1742.086) * (-1741.000) (-1740.179) (-1737.862) [-1738.832] -- 0:00:54 168000 -- (-1740.971) [-1738.958] (-1738.652) (-1742.958) * (-1745.935) (-1741.817) (-1737.701) [-1739.086] -- 0:00:54 168500 -- (-1744.228) (-1739.638) [-1737.824] (-1739.646) * (-1742.654) [-1743.459] (-1737.742) (-1737.961) -- 0:00:54 169000 -- (-1748.510) (-1740.579) [-1738.238] (-1739.218) * (-1739.640) (-1740.491) (-1740.426) [-1737.325] -- 0:00:54 169500 -- (-1740.531) (-1741.370) [-1738.706] (-1739.048) * (-1739.728) (-1739.990) (-1742.351) [-1737.630] -- 0:00:53 170000 -- [-1744.156] (-1739.404) (-1738.423) (-1740.366) * (-1742.346) (-1740.680) [-1741.250] (-1737.624) -- 0:00:53 Average standard deviation of split frequencies: 0.013964 170500 -- (-1740.344) (-1739.054) (-1739.520) [-1740.167] * (-1745.690) (-1740.678) (-1738.422) [-1738.768] -- 0:00:53 171000 -- (-1737.966) (-1739.866) [-1739.306] (-1742.924) * (-1741.909) (-1744.433) [-1737.385] (-1739.226) -- 0:00:53 171500 -- [-1738.056] (-1737.928) (-1742.211) (-1742.864) * [-1742.106] (-1741.627) (-1737.823) (-1740.540) -- 0:00:53 172000 -- (-1738.438) (-1737.558) (-1743.112) [-1742.190] * [-1738.454] (-1740.556) (-1738.038) (-1738.601) -- 0:00:52 172500 -- [-1739.424] (-1740.112) (-1744.073) (-1739.351) * [-1737.688] (-1740.349) (-1739.224) (-1738.900) -- 0:00:52 173000 -- (-1739.881) (-1737.649) [-1738.799] (-1744.971) * (-1738.617) [-1739.198] (-1739.899) (-1738.820) -- 0:00:52 173500 -- (-1739.450) (-1739.335) (-1740.529) [-1739.567] * (-1739.230) (-1739.217) [-1738.607] (-1741.349) -- 0:00:52 174000 -- (-1739.607) [-1739.814] (-1742.406) (-1738.162) * (-1742.677) (-1740.074) (-1738.074) [-1738.234] -- 0:00:52 174500 -- (-1741.495) (-1741.626) [-1741.413] (-1739.178) * (-1742.419) (-1740.172) (-1742.318) [-1739.865] -- 0:00:52 175000 -- (-1740.456) (-1740.193) (-1739.660) [-1738.718] * (-1741.903) [-1740.969] (-1739.186) (-1740.090) -- 0:00:51 Average standard deviation of split frequencies: 0.011344 175500 -- (-1738.487) [-1739.071] (-1742.134) (-1742.154) * (-1741.887) (-1739.369) [-1739.224] (-1739.636) -- 0:00:51 176000 -- (-1738.970) [-1738.405] (-1737.367) (-1738.948) * (-1738.969) (-1745.784) (-1739.156) [-1738.028] -- 0:00:51 176500 -- [-1737.848] (-1737.535) (-1738.035) (-1741.047) * (-1738.488) [-1742.036] (-1738.524) (-1740.397) -- 0:00:51 177000 -- (-1737.328) (-1738.903) [-1737.649] (-1738.439) * (-1740.035) (-1742.029) (-1740.077) [-1740.445] -- 0:00:51 177500 -- (-1738.699) (-1737.810) (-1738.914) [-1739.415] * (-1742.657) (-1741.422) (-1738.211) [-1744.394] -- 0:00:50 178000 -- [-1739.517] (-1739.574) (-1741.375) (-1738.965) * (-1741.639) (-1740.432) [-1740.339] (-1742.560) -- 0:00:50 178500 -- [-1738.991] (-1739.498) (-1742.095) (-1738.604) * (-1741.508) (-1738.194) [-1740.232] (-1743.255) -- 0:00:50 179000 -- (-1738.740) (-1739.255) (-1737.855) [-1739.516] * (-1740.096) (-1739.618) (-1743.203) [-1741.021] -- 0:00:55 179500 -- (-1737.788) (-1739.795) (-1739.014) [-1743.819] * (-1739.210) (-1738.453) (-1742.628) [-1738.660] -- 0:00:54 180000 -- (-1738.993) (-1738.666) [-1740.280] (-1739.136) * (-1743.300) [-1738.794] (-1739.050) (-1737.593) -- 0:00:54 Average standard deviation of split frequencies: 0.012909 180500 -- (-1737.672) (-1737.557) (-1738.826) [-1739.274] * (-1740.189) [-1737.031] (-1741.413) (-1738.346) -- 0:00:54 181000 -- (-1738.643) [-1738.233] (-1738.873) (-1739.756) * (-1738.850) (-1744.226) [-1740.558] (-1742.551) -- 0:00:54 181500 -- (-1739.081) (-1737.804) [-1741.502] (-1749.263) * (-1739.726) [-1739.041] (-1743.050) (-1741.830) -- 0:00:54 182000 -- [-1737.964] (-1738.050) (-1737.689) (-1740.071) * [-1739.351] (-1738.909) (-1743.886) (-1741.830) -- 0:00:53 182500 -- (-1737.374) (-1740.967) [-1740.134] (-1738.375) * [-1739.554] (-1738.768) (-1744.376) (-1738.627) -- 0:00:53 183000 -- [-1737.123] (-1739.859) (-1738.023) (-1740.897) * [-1739.816] (-1739.196) (-1741.602) (-1738.558) -- 0:00:53 183500 -- [-1737.617] (-1739.505) (-1739.340) (-1738.119) * (-1739.921) (-1739.443) [-1739.090] (-1742.821) -- 0:00:53 184000 -- [-1738.913] (-1743.158) (-1744.157) (-1738.659) * (-1740.496) (-1743.739) [-1738.637] (-1737.925) -- 0:00:53 184500 -- (-1740.779) (-1746.390) (-1742.007) [-1738.125] * (-1737.927) (-1737.128) [-1738.507] (-1739.197) -- 0:00:53 185000 -- [-1740.609] (-1739.943) (-1739.238) (-1741.394) * (-1738.880) [-1737.989] (-1739.542) (-1740.721) -- 0:00:52 Average standard deviation of split frequencies: 0.011872 185500 -- [-1739.265] (-1737.556) (-1739.522) (-1741.049) * [-1738.506] (-1739.375) (-1738.035) (-1741.446) -- 0:00:52 186000 -- (-1739.553) (-1737.057) (-1739.703) [-1739.930] * [-1738.595] (-1737.476) (-1742.391) (-1740.437) -- 0:00:52 186500 -- (-1741.686) (-1738.682) [-1740.047] (-1744.293) * (-1739.949) (-1738.322) [-1743.831] (-1739.662) -- 0:00:52 187000 -- (-1740.151) (-1740.513) (-1740.246) [-1741.952] * [-1741.197] (-1738.135) (-1741.825) (-1739.471) -- 0:00:52 187500 -- (-1743.048) (-1738.959) (-1740.073) [-1741.714] * [-1742.114] (-1738.824) (-1739.627) (-1739.019) -- 0:00:52 188000 -- (-1740.237) [-1737.763] (-1739.193) (-1740.581) * (-1739.933) (-1739.129) [-1739.183] (-1737.648) -- 0:00:51 188500 -- (-1739.601) (-1739.409) [-1738.447] (-1741.504) * (-1741.891) [-1738.777] (-1739.185) (-1737.030) -- 0:00:51 189000 -- (-1739.624) (-1740.093) (-1743.160) [-1738.749] * (-1737.723) (-1738.752) [-1738.958] (-1742.420) -- 0:00:51 189500 -- (-1739.159) [-1741.049] (-1739.206) (-1738.578) * (-1737.563) (-1738.772) (-1740.330) [-1739.919] -- 0:00:51 190000 -- (-1739.541) [-1739.464] (-1742.424) (-1740.764) * (-1738.542) (-1739.316) [-1739.068] (-1739.424) -- 0:00:51 Average standard deviation of split frequencies: 0.012087 190500 -- (-1739.179) [-1740.877] (-1738.583) (-1742.357) * (-1737.396) (-1739.230) [-1737.816] (-1739.763) -- 0:00:50 191000 -- [-1740.337] (-1741.075) (-1741.238) (-1738.981) * [-1738.148] (-1739.701) (-1738.993) (-1741.835) -- 0:00:50 191500 -- (-1740.460) (-1739.475) (-1743.714) [-1738.154] * [-1739.471] (-1741.080) (-1739.419) (-1738.569) -- 0:00:50 192000 -- (-1740.295) (-1738.792) [-1740.174] (-1739.609) * (-1740.120) (-1743.071) (-1739.660) [-1737.904] -- 0:00:50 192500 -- (-1738.026) (-1738.792) (-1738.510) [-1739.334] * (-1741.944) (-1739.447) [-1738.764] (-1739.921) -- 0:00:50 193000 -- (-1739.261) (-1738.722) [-1738.992] (-1737.354) * (-1738.814) (-1738.392) [-1737.861] (-1746.680) -- 0:00:50 193500 -- (-1740.230) [-1737.432] (-1738.761) (-1742.559) * [-1738.970] (-1741.049) (-1739.088) (-1745.848) -- 0:00:50 194000 -- [-1737.507] (-1741.323) (-1738.760) (-1739.997) * [-1739.002] (-1738.225) (-1739.932) (-1739.478) -- 0:00:49 194500 -- (-1737.926) (-1738.742) (-1741.693) [-1740.858] * (-1741.128) [-1740.634] (-1741.793) (-1739.883) -- 0:00:53 195000 -- [-1737.819] (-1737.565) (-1742.082) (-1742.537) * (-1741.364) [-1739.274] (-1738.500) (-1739.393) -- 0:00:53 Average standard deviation of split frequencies: 0.012560 195500 -- [-1738.362] (-1737.707) (-1738.822) (-1741.769) * (-1739.565) [-1739.531] (-1739.647) (-1740.835) -- 0:00:53 196000 -- (-1737.489) [-1737.173] (-1738.486) (-1742.285) * (-1739.105) (-1739.568) (-1741.947) [-1738.826] -- 0:00:53 196500 -- [-1739.978] (-1737.081) (-1740.720) (-1741.948) * (-1739.105) (-1739.490) [-1743.773] (-1742.937) -- 0:00:53 197000 -- (-1744.282) (-1741.105) [-1738.580] (-1743.659) * (-1737.648) (-1740.930) [-1739.498] (-1740.561) -- 0:00:52 197500 -- (-1737.846) (-1742.892) [-1738.706] (-1743.954) * [-1737.770] (-1741.224) (-1741.846) (-1744.205) -- 0:00:52 198000 -- [-1738.000] (-1737.982) (-1738.653) (-1743.394) * [-1739.914] (-1739.384) (-1744.402) (-1746.246) -- 0:00:52 198500 -- [-1744.445] (-1737.798) (-1738.594) (-1741.624) * [-1739.526] (-1739.408) (-1744.154) (-1739.662) -- 0:00:52 199000 -- (-1746.803) [-1738.443] (-1739.139) (-1743.695) * (-1737.734) (-1737.936) (-1741.144) [-1741.335] -- 0:00:52 199500 -- (-1738.469) [-1740.393] (-1739.287) (-1743.909) * (-1737.634) (-1737.893) (-1740.541) [-1740.387] -- 0:00:52 200000 -- [-1737.899] (-1739.221) (-1738.919) (-1741.291) * [-1737.491] (-1740.937) (-1740.747) (-1739.478) -- 0:00:51 Average standard deviation of split frequencies: 0.013704 200500 -- (-1738.859) [-1739.734] (-1740.946) (-1742.504) * (-1739.180) (-1739.831) [-1739.857] (-1739.869) -- 0:00:51 201000 -- [-1739.411] (-1738.870) (-1737.824) (-1739.366) * [-1737.721] (-1739.481) (-1742.453) (-1738.914) -- 0:00:51 201500 -- (-1738.268) [-1738.851] (-1737.592) (-1741.574) * (-1737.520) (-1738.661) [-1742.577] (-1738.262) -- 0:00:51 202000 -- (-1738.213) [-1740.022] (-1737.455) (-1739.086) * [-1737.770] (-1739.527) (-1741.520) (-1741.142) -- 0:00:51 202500 -- (-1740.058) (-1739.999) [-1737.750] (-1739.426) * [-1737.281] (-1739.094) (-1740.844) (-1738.233) -- 0:00:51 203000 -- (-1738.522) [-1738.764] (-1737.876) (-1743.448) * [-1738.121] (-1739.508) (-1737.678) (-1738.513) -- 0:00:51 203500 -- [-1739.061] (-1741.551) (-1738.057) (-1741.489) * [-1737.719] (-1738.152) (-1738.783) (-1739.383) -- 0:00:50 204000 -- (-1737.662) (-1740.288) [-1737.285] (-1741.798) * [-1738.565] (-1737.950) (-1741.720) (-1738.590) -- 0:00:50 204500 -- (-1737.794) [-1739.592] (-1740.340) (-1740.479) * (-1738.380) [-1738.635] (-1741.556) (-1738.790) -- 0:00:50 205000 -- [-1738.306] (-1740.368) (-1737.833) (-1737.442) * (-1741.575) (-1738.549) [-1741.222] (-1740.209) -- 0:00:50 Average standard deviation of split frequencies: 0.012967 205500 -- (-1738.146) (-1738.813) (-1738.369) [-1738.716] * [-1741.952] (-1738.644) (-1739.386) (-1738.897) -- 0:00:50 206000 -- (-1739.086) (-1739.056) (-1739.311) [-1739.874] * (-1737.756) (-1739.008) [-1741.695] (-1740.038) -- 0:00:50 206500 -- (-1742.390) (-1739.656) [-1742.238] (-1739.084) * [-1738.811] (-1737.684) (-1743.503) (-1740.038) -- 0:00:49 207000 -- (-1744.149) [-1740.298] (-1738.822) (-1737.499) * [-1743.177] (-1738.315) (-1742.857) (-1738.256) -- 0:00:49 207500 -- (-1742.415) (-1738.012) [-1738.539] (-1740.877) * (-1738.619) (-1739.792) (-1742.453) [-1738.804] -- 0:00:49 208000 -- (-1740.577) [-1738.207] (-1738.975) (-1738.221) * [-1741.120] (-1738.558) (-1739.399) (-1738.471) -- 0:00:49 208500 -- (-1740.438) (-1738.886) [-1738.461] (-1743.331) * (-1739.350) (-1738.680) (-1738.762) [-1739.060] -- 0:00:49 209000 -- (-1740.067) [-1739.914] (-1740.471) (-1740.188) * (-1739.350) (-1738.245) (-1738.741) [-1739.181] -- 0:00:49 209500 -- (-1740.602) [-1742.077] (-1741.085) (-1738.919) * (-1738.296) [-1738.218] (-1739.996) (-1739.266) -- 0:00:49 210000 -- (-1740.503) [-1738.982] (-1737.923) (-1739.741) * (-1738.269) [-1739.304] (-1742.512) (-1740.578) -- 0:00:52 Average standard deviation of split frequencies: 0.012768 210500 -- (-1738.064) (-1741.962) (-1738.800) [-1739.615] * [-1738.555] (-1737.608) (-1738.407) (-1737.706) -- 0:00:52 211000 -- (-1740.153) (-1741.189) [-1742.929] (-1739.257) * (-1738.676) (-1737.619) (-1739.281) [-1743.184] -- 0:00:52 211500 -- (-1739.752) [-1740.407] (-1742.448) (-1739.552) * (-1738.272) [-1740.513] (-1739.148) (-1739.913) -- 0:00:52 212000 -- (-1738.858) (-1738.993) [-1743.105] (-1740.230) * (-1738.273) (-1742.793) (-1738.805) [-1743.127] -- 0:00:52 212500 -- (-1738.785) [-1739.959] (-1740.334) (-1740.101) * [-1738.250] (-1740.993) (-1737.232) (-1739.347) -- 0:00:51 213000 -- (-1739.700) (-1740.115) (-1742.988) [-1738.404] * (-1738.457) (-1739.421) [-1738.200] (-1739.347) -- 0:00:51 213500 -- (-1741.379) [-1739.917] (-1740.868) (-1740.426) * (-1737.620) (-1739.749) (-1739.176) [-1737.289] -- 0:00:51 214000 -- [-1740.117] (-1739.690) (-1738.102) (-1739.689) * (-1738.475) (-1739.841) [-1738.025] (-1737.262) -- 0:00:51 214500 -- (-1740.267) (-1738.527) (-1738.149) [-1740.488] * [-1737.286] (-1738.070) (-1738.428) (-1740.244) -- 0:00:51 215000 -- (-1739.786) (-1738.886) [-1740.635] (-1743.642) * [-1737.289] (-1738.754) (-1739.949) (-1739.050) -- 0:00:51 Average standard deviation of split frequencies: 0.013216 215500 -- (-1738.102) [-1741.781] (-1740.102) (-1744.190) * [-1741.334] (-1739.698) (-1741.664) (-1737.974) -- 0:00:50 216000 -- (-1737.896) [-1742.069] (-1738.012) (-1744.161) * (-1743.117) [-1738.590] (-1741.892) (-1740.845) -- 0:00:50 216500 -- (-1739.044) [-1739.613] (-1737.673) (-1742.145) * (-1740.809) (-1739.453) [-1738.895] (-1737.179) -- 0:00:50 217000 -- (-1741.169) (-1739.471) [-1737.910] (-1740.637) * (-1740.416) [-1740.380] (-1738.740) (-1738.442) -- 0:00:50 217500 -- (-1742.613) [-1737.732] (-1741.059) (-1740.387) * (-1738.857) (-1742.214) (-1738.715) [-1738.388] -- 0:00:50 218000 -- (-1739.526) (-1737.805) [-1738.911] (-1738.663) * (-1740.476) (-1740.982) [-1739.817] (-1738.909) -- 0:00:50 218500 -- (-1740.778) (-1737.790) (-1739.076) [-1739.476] * (-1737.829) (-1739.359) (-1740.857) [-1741.525] -- 0:00:50 219000 -- [-1740.580] (-1738.093) (-1737.374) (-1740.881) * [-1738.841] (-1740.366) (-1740.641) (-1738.290) -- 0:00:49 219500 -- (-1747.075) (-1738.626) [-1739.468] (-1740.348) * (-1738.488) (-1738.090) [-1740.379] (-1736.899) -- 0:00:49 220000 -- (-1748.500) (-1741.145) [-1740.379] (-1738.914) * (-1738.750) (-1737.618) (-1741.315) [-1738.190] -- 0:00:49 Average standard deviation of split frequencies: 0.012951 220500 -- (-1745.121) (-1739.752) (-1741.221) [-1740.991] * [-1738.216] (-1738.651) (-1741.101) (-1739.704) -- 0:00:49 221000 -- (-1742.605) (-1739.171) [-1739.119] (-1737.276) * (-1742.922) (-1737.537) (-1740.362) [-1738.620] -- 0:00:49 221500 -- (-1741.744) (-1740.219) (-1738.200) [-1738.485] * (-1741.340) (-1737.388) (-1741.842) [-1740.764] -- 0:00:49 222000 -- (-1738.734) (-1738.352) (-1738.601) [-1738.727] * (-1740.541) (-1738.881) (-1742.049) [-1740.202] -- 0:00:49 222500 -- [-1739.904] (-1738.263) (-1741.118) (-1738.730) * (-1740.007) [-1738.791] (-1743.483) (-1739.712) -- 0:00:48 223000 -- (-1738.068) [-1738.824] (-1743.148) (-1739.014) * (-1740.903) [-1739.065] (-1739.496) (-1740.657) -- 0:00:48 223500 -- (-1738.377) (-1737.737) (-1741.105) [-1738.036] * (-1739.823) (-1739.667) [-1738.440] (-1737.878) -- 0:00:48 224000 -- (-1739.093) (-1740.649) (-1741.342) [-1739.361] * [-1739.487] (-1738.756) (-1741.123) (-1737.836) -- 0:00:48 224500 -- (-1739.003) (-1740.019) [-1739.845] (-1738.908) * [-1739.117] (-1739.057) (-1742.393) (-1738.066) -- 0:00:48 225000 -- (-1738.265) [-1740.667] (-1739.863) (-1738.659) * (-1738.686) [-1738.173] (-1742.807) (-1737.719) -- 0:00:48 Average standard deviation of split frequencies: 0.013742 225500 -- (-1742.029) (-1739.578) (-1739.457) [-1739.147] * (-1738.626) (-1738.168) [-1737.921] (-1737.781) -- 0:00:51 226000 -- [-1739.552] (-1739.816) (-1740.254) (-1739.852) * (-1739.604) (-1738.812) (-1740.822) [-1740.830] -- 0:00:51 226500 -- (-1740.897) [-1740.535] (-1738.618) (-1738.515) * (-1740.424) [-1738.807] (-1740.399) (-1741.213) -- 0:00:51 227000 -- (-1739.894) [-1737.789] (-1737.849) (-1738.770) * (-1738.040) (-1739.124) [-1737.805] (-1739.517) -- 0:00:51 227500 -- (-1741.768) (-1742.070) [-1739.437] (-1739.875) * (-1738.592) (-1738.801) [-1742.158] (-1741.573) -- 0:00:50 228000 -- [-1740.772] (-1740.064) (-1742.082) (-1738.630) * [-1739.853] (-1740.933) (-1741.108) (-1738.505) -- 0:00:50 228500 -- (-1741.816) (-1738.767) [-1738.864] (-1737.660) * (-1738.869) (-1739.956) [-1738.436] (-1740.258) -- 0:00:50 229000 -- (-1738.109) (-1738.754) (-1739.175) [-1740.694] * (-1740.010) (-1737.599) (-1739.570) [-1739.548] -- 0:00:50 229500 -- [-1737.890] (-1737.097) (-1738.902) (-1741.846) * [-1738.055] (-1739.175) (-1739.890) (-1739.542) -- 0:00:50 230000 -- (-1738.298) (-1737.587) (-1742.278) [-1739.299] * (-1739.031) (-1741.749) [-1738.746] (-1741.164) -- 0:00:50 Average standard deviation of split frequencies: 0.013825 230500 -- (-1738.998) [-1742.787] (-1741.962) (-1738.462) * [-1739.621] (-1738.129) (-1738.990) (-1739.380) -- 0:00:50 231000 -- (-1738.220) (-1738.781) [-1738.205] (-1740.136) * (-1737.781) [-1740.928] (-1738.595) (-1739.940) -- 0:00:49 231500 -- (-1738.927) [-1739.129] (-1739.400) (-1739.941) * (-1737.555) [-1739.612] (-1739.604) (-1738.268) -- 0:00:49 232000 -- (-1737.620) [-1740.428] (-1740.509) (-1738.359) * [-1736.955] (-1740.946) (-1738.875) (-1741.213) -- 0:00:49 232500 -- (-1737.511) (-1741.840) (-1740.727) [-1738.143] * [-1737.611] (-1738.041) (-1737.410) (-1739.447) -- 0:00:49 233000 -- (-1737.511) (-1739.439) [-1740.985] (-1738.985) * (-1737.394) (-1737.635) (-1738.251) [-1739.047] -- 0:00:49 233500 -- (-1737.773) [-1740.244] (-1739.736) (-1740.712) * [-1738.876] (-1743.503) (-1737.122) (-1741.802) -- 0:00:49 234000 -- [-1737.490] (-1738.448) (-1740.812) (-1739.426) * (-1738.908) [-1740.222] (-1737.172) (-1743.480) -- 0:00:49 234500 -- (-1740.485) (-1738.697) [-1739.388] (-1739.093) * (-1740.856) [-1737.232] (-1738.308) (-1749.401) -- 0:00:48 235000 -- [-1738.504] (-1740.771) (-1740.635) (-1738.024) * (-1740.665) (-1737.304) [-1740.445] (-1739.935) -- 0:00:48 Average standard deviation of split frequencies: 0.012925 235500 -- [-1739.679] (-1740.802) (-1739.419) (-1741.842) * (-1742.163) [-1737.834] (-1737.582) (-1739.454) -- 0:00:48 236000 -- (-1743.287) [-1739.999] (-1742.209) (-1741.192) * (-1741.459) (-1737.887) (-1739.859) [-1741.581] -- 0:00:48 236500 -- (-1742.137) [-1739.524] (-1737.380) (-1740.112) * (-1741.319) [-1739.552] (-1737.350) (-1740.178) -- 0:00:48 237000 -- (-1742.155) (-1740.286) [-1737.777] (-1740.232) * (-1741.431) (-1738.113) [-1739.158] (-1738.796) -- 0:00:48 237500 -- (-1745.501) (-1740.565) [-1739.192] (-1739.755) * [-1737.686] (-1738.366) (-1740.899) (-1740.630) -- 0:00:48 238000 -- (-1744.946) (-1741.090) [-1739.208] (-1741.930) * (-1738.240) [-1737.689] (-1739.140) (-1741.136) -- 0:00:48 238500 -- (-1744.846) [-1737.955] (-1739.074) (-1739.265) * (-1739.923) (-1737.232) (-1739.911) [-1739.401] -- 0:00:47 239000 -- (-1741.101) [-1738.186] (-1740.645) (-1740.152) * [-1737.884] (-1737.921) (-1739.000) (-1741.564) -- 0:00:47 239500 -- [-1738.382] (-1739.051) (-1739.654) (-1739.808) * [-1738.611] (-1738.826) (-1743.081) (-1739.964) -- 0:00:47 240000 -- [-1737.584] (-1738.922) (-1741.799) (-1749.760) * (-1737.711) [-1738.823] (-1739.568) (-1739.714) -- 0:00:47 Average standard deviation of split frequencies: 0.013589 240500 -- (-1738.120) (-1739.532) [-1739.022] (-1743.034) * [-1737.922] (-1739.011) (-1739.766) (-1740.433) -- 0:00:47 241000 -- (-1738.109) (-1738.545) [-1738.004] (-1739.854) * (-1737.650) (-1739.050) (-1739.310) [-1738.565] -- 0:00:50 241500 -- (-1738.842) [-1739.535] (-1738.286) (-1739.651) * (-1737.638) (-1740.638) [-1738.934] (-1739.007) -- 0:00:50 242000 -- (-1741.667) (-1743.122) (-1738.909) [-1739.606] * [-1740.559] (-1738.880) (-1738.937) (-1739.548) -- 0:00:50 242500 -- (-1737.854) (-1738.998) [-1740.660] (-1740.567) * (-1740.773) (-1739.673) (-1738.476) [-1740.775] -- 0:00:49 243000 -- [-1737.404] (-1739.715) (-1743.213) (-1739.469) * (-1741.238) (-1739.401) (-1740.718) [-1740.639] -- 0:00:49 243500 -- (-1742.978) (-1738.659) (-1741.577) [-1738.828] * (-1741.126) (-1740.092) (-1739.496) [-1741.197] -- 0:00:49 244000 -- (-1741.871) (-1737.736) (-1742.910) [-1740.146] * [-1738.178] (-1739.378) (-1739.782) (-1741.033) -- 0:00:49 244500 -- (-1739.610) (-1737.811) [-1740.429] (-1739.268) * (-1739.219) (-1741.953) [-1738.917] (-1739.948) -- 0:00:49 245000 -- (-1741.787) (-1737.821) [-1739.109] (-1737.522) * (-1737.360) (-1742.880) [-1737.438] (-1742.650) -- 0:00:49 Average standard deviation of split frequencies: 0.013189 245500 -- (-1739.536) [-1738.638] (-1739.556) (-1737.635) * [-1737.324] (-1739.247) (-1737.437) (-1740.996) -- 0:00:49 246000 -- (-1739.426) (-1739.016) (-1739.859) [-1737.549] * (-1737.363) (-1745.055) (-1738.087) [-1739.046] -- 0:00:49 246500 -- (-1737.981) (-1742.496) [-1738.603] (-1737.843) * (-1737.812) (-1739.757) [-1737.867] (-1741.192) -- 0:00:48 247000 -- (-1737.212) (-1743.280) (-1738.694) [-1737.293] * (-1739.282) (-1738.189) [-1737.939] (-1740.756) -- 0:00:48 247500 -- (-1743.277) (-1737.949) [-1737.595] (-1738.751) * (-1738.982) (-1739.337) [-1737.810] (-1744.781) -- 0:00:48 248000 -- [-1743.396] (-1737.948) (-1740.407) (-1739.485) * (-1742.294) [-1737.660] (-1737.463) (-1740.209) -- 0:00:48 248500 -- (-1741.930) (-1738.097) (-1740.942) [-1739.566] * (-1739.118) (-1738.744) [-1737.495] (-1738.719) -- 0:00:48 249000 -- (-1740.605) [-1740.904] (-1738.431) (-1738.969) * (-1739.440) (-1738.109) (-1738.697) [-1739.493] -- 0:00:48 249500 -- [-1740.716] (-1740.807) (-1739.271) (-1741.993) * (-1741.615) (-1737.598) (-1738.037) [-1737.613] -- 0:00:48 250000 -- [-1739.981] (-1740.630) (-1739.968) (-1738.131) * (-1739.656) (-1742.622) [-1740.746] (-1741.367) -- 0:00:48 Average standard deviation of split frequencies: 0.012722 250500 -- (-1741.600) (-1739.665) (-1739.288) [-1738.425] * (-1741.330) [-1738.081] (-1739.809) (-1738.135) -- 0:00:47 251000 -- (-1741.810) [-1737.353] (-1737.797) (-1737.878) * (-1739.450) [-1739.603] (-1738.290) (-1738.748) -- 0:00:47 251500 -- [-1740.409] (-1740.998) (-1739.689) (-1748.560) * (-1741.997) (-1738.508) [-1738.900] (-1738.145) -- 0:00:47 252000 -- (-1739.733) (-1737.823) [-1737.551] (-1743.455) * [-1738.823] (-1742.456) (-1737.503) (-1738.950) -- 0:00:47 252500 -- [-1738.875] (-1738.836) (-1738.522) (-1744.582) * [-1740.635] (-1738.309) (-1738.023) (-1738.043) -- 0:00:47 253000 -- (-1741.483) [-1737.566] (-1737.093) (-1743.652) * (-1740.714) (-1738.479) [-1737.457] (-1737.685) -- 0:00:47 253500 -- (-1739.004) (-1737.556) [-1737.832] (-1739.729) * (-1739.576) (-1740.110) [-1737.961] (-1741.866) -- 0:00:47 254000 -- (-1739.841) (-1737.936) (-1741.542) [-1742.256] * (-1739.773) [-1742.686] (-1739.352) (-1738.000) -- 0:00:46 254500 -- (-1740.887) [-1737.296] (-1740.346) (-1740.029) * (-1742.530) (-1738.436) [-1739.241] (-1737.545) -- 0:00:46 255000 -- (-1740.316) (-1738.753) (-1739.105) [-1739.809] * (-1738.902) (-1739.612) (-1741.029) [-1738.401] -- 0:00:46 Average standard deviation of split frequencies: 0.012673 255500 -- (-1743.225) (-1741.799) (-1743.613) [-1739.726] * (-1739.270) (-1738.706) [-1740.340] (-1739.747) -- 0:00:46 256000 -- [-1740.370] (-1739.299) (-1739.083) (-1740.478) * (-1739.263) (-1738.653) [-1738.277] (-1739.704) -- 0:00:46 256500 -- [-1737.913] (-1738.335) (-1738.164) (-1739.691) * (-1738.457) [-1738.752] (-1738.019) (-1740.175) -- 0:00:49 257000 -- (-1738.657) [-1740.279] (-1744.791) (-1738.560) * (-1738.471) [-1741.955] (-1738.724) (-1739.583) -- 0:00:49 257500 -- (-1739.674) [-1739.162] (-1738.620) (-1738.823) * (-1739.025) (-1739.609) (-1738.264) [-1741.689] -- 0:00:49 258000 -- [-1739.425] (-1738.085) (-1739.255) (-1741.723) * [-1742.440] (-1738.729) (-1737.724) (-1739.175) -- 0:00:48 258500 -- (-1738.002) (-1741.913) [-1739.301] (-1738.999) * [-1739.311] (-1738.536) (-1737.440) (-1739.256) -- 0:00:48 259000 -- (-1738.069) (-1739.317) [-1738.861] (-1737.920) * (-1738.789) [-1739.737] (-1738.888) (-1738.573) -- 0:00:48 259500 -- (-1738.056) (-1737.614) [-1739.872] (-1738.286) * [-1739.663] (-1739.283) (-1737.300) (-1740.532) -- 0:00:48 260000 -- (-1737.056) (-1739.093) [-1739.933] (-1738.282) * (-1742.809) (-1742.643) [-1738.290] (-1741.464) -- 0:00:48 Average standard deviation of split frequencies: 0.012234 260500 -- (-1741.090) (-1741.345) (-1738.227) [-1738.989] * (-1743.929) (-1741.802) [-1738.224] (-1738.551) -- 0:00:48 261000 -- (-1741.343) (-1740.333) (-1738.645) [-1739.360] * (-1743.380) [-1738.866] (-1739.447) (-1739.188) -- 0:00:48 261500 -- [-1737.533] (-1741.717) (-1739.508) (-1738.642) * (-1742.227) (-1740.609) [-1737.746] (-1741.574) -- 0:00:48 262000 -- (-1738.394) (-1743.732) [-1739.779] (-1740.367) * (-1738.553) [-1739.787] (-1737.816) (-1740.139) -- 0:00:47 262500 -- (-1738.645) (-1738.716) [-1739.278] (-1738.613) * (-1738.086) (-1739.807) [-1738.729] (-1739.586) -- 0:00:47 263000 -- (-1737.985) (-1739.548) (-1738.665) [-1738.746] * (-1738.184) (-1739.434) (-1740.692) [-1740.152] -- 0:00:47 263500 -- [-1738.102] (-1740.113) (-1740.322) (-1740.259) * (-1739.293) (-1739.953) (-1737.806) [-1738.546] -- 0:00:47 264000 -- [-1738.561] (-1739.924) (-1737.575) (-1738.624) * (-1739.656) [-1740.218] (-1738.635) (-1738.366) -- 0:00:47 264500 -- (-1738.231) (-1742.331) [-1739.811] (-1738.598) * [-1739.988] (-1738.900) (-1740.147) (-1741.253) -- 0:00:47 265000 -- (-1742.072) (-1740.311) [-1739.583] (-1739.468) * (-1739.807) (-1738.865) (-1739.854) [-1741.971] -- 0:00:47 Average standard deviation of split frequencies: 0.011659 265500 -- (-1743.157) [-1737.662] (-1742.847) (-1740.153) * (-1739.134) (-1740.291) [-1738.430] (-1737.877) -- 0:00:47 266000 -- (-1745.619) (-1738.379) (-1740.987) [-1740.523] * (-1741.968) (-1739.930) [-1740.874] (-1738.885) -- 0:00:46 266500 -- (-1742.046) [-1740.858] (-1739.860) (-1741.165) * (-1740.861) [-1738.216] (-1741.802) (-1738.958) -- 0:00:46 267000 -- (-1744.875) (-1738.456) [-1737.563] (-1739.337) * (-1744.552) (-1738.979) [-1738.567] (-1737.576) -- 0:00:46 267500 -- (-1742.854) (-1738.100) [-1737.476] (-1738.616) * (-1744.994) (-1737.985) [-1741.758] (-1742.345) -- 0:00:46 268000 -- [-1741.433] (-1737.964) (-1737.492) (-1738.886) * (-1741.019) [-1737.985] (-1738.041) (-1742.348) -- 0:00:46 268500 -- (-1738.962) [-1737.467] (-1738.333) (-1740.997) * (-1738.785) [-1739.747] (-1739.609) (-1741.628) -- 0:00:46 269000 -- [-1738.438] (-1739.310) (-1738.333) (-1745.440) * [-1738.574] (-1739.518) (-1741.217) (-1740.537) -- 0:00:46 269500 -- (-1739.479) (-1738.373) [-1738.473] (-1738.016) * [-1738.458] (-1739.722) (-1743.917) (-1739.851) -- 0:00:46 270000 -- (-1737.743) [-1741.153] (-1737.852) (-1743.756) * (-1741.465) (-1741.800) (-1740.755) [-1738.791] -- 0:00:45 Average standard deviation of split frequencies: 0.012966 270500 -- (-1740.996) (-1741.841) (-1737.720) [-1742.971] * [-1738.330] (-1739.780) (-1743.871) (-1741.672) -- 0:00:45 271000 -- (-1741.369) [-1738.727] (-1739.131) (-1738.019) * (-1738.488) (-1739.102) [-1739.695] (-1740.168) -- 0:00:45 271500 -- (-1741.009) (-1739.014) (-1740.764) [-1739.303] * (-1740.121) [-1739.601] (-1741.003) (-1742.628) -- 0:00:45 272000 -- (-1740.930) (-1742.081) (-1738.671) [-1739.421] * [-1738.020] (-1740.339) (-1738.490) (-1741.316) -- 0:00:45 272500 -- (-1739.121) (-1738.829) [-1737.478] (-1742.024) * (-1738.826) (-1737.073) (-1738.758) [-1741.465] -- 0:00:48 273000 -- (-1737.790) (-1738.861) [-1738.484] (-1738.631) * [-1739.003] (-1737.072) (-1738.350) (-1740.952) -- 0:00:47 273500 -- (-1737.876) [-1737.942] (-1737.186) (-1737.847) * (-1741.346) (-1741.222) [-1737.145] (-1740.870) -- 0:00:47 274000 -- [-1740.583] (-1737.845) (-1737.911) (-1738.715) * (-1739.000) (-1741.917) [-1737.520] (-1741.149) -- 0:00:47 274500 -- (-1737.893) (-1741.445) (-1739.043) [-1737.920] * (-1738.696) [-1738.248] (-1741.911) (-1740.190) -- 0:00:47 275000 -- (-1738.310) (-1744.337) (-1738.447) [-1738.252] * (-1741.057) [-1738.895] (-1741.774) (-1738.881) -- 0:00:47 Average standard deviation of split frequencies: 0.012051 275500 -- (-1739.737) (-1741.081) [-1738.805] (-1742.133) * [-1738.723] (-1737.454) (-1737.650) (-1742.261) -- 0:00:47 276000 -- (-1738.713) [-1738.521] (-1739.363) (-1741.111) * (-1739.110) [-1737.922] (-1739.311) (-1739.350) -- 0:00:47 276500 -- [-1738.623] (-1739.755) (-1739.809) (-1743.687) * (-1737.791) [-1739.886] (-1743.822) (-1741.232) -- 0:00:47 277000 -- (-1740.685) (-1742.011) [-1738.641] (-1739.889) * (-1738.923) (-1737.448) (-1741.125) [-1739.033] -- 0:00:46 277500 -- (-1740.058) (-1742.135) [-1737.815] (-1739.782) * (-1740.266) [-1738.903] (-1741.738) (-1738.493) -- 0:00:46 278000 -- (-1739.213) [-1739.806] (-1738.263) (-1740.242) * (-1740.199) (-1737.986) (-1740.987) [-1738.374] -- 0:00:46 278500 -- (-1739.241) (-1738.627) (-1738.124) [-1741.351] * (-1740.481) [-1738.224] (-1738.704) (-1739.887) -- 0:00:46 279000 -- (-1738.724) (-1737.991) [-1737.878] (-1741.171) * [-1740.268] (-1739.561) (-1738.775) (-1740.076) -- 0:00:46 279500 -- (-1742.004) [-1741.118] (-1738.443) (-1740.219) * (-1738.235) [-1739.918] (-1739.189) (-1739.315) -- 0:00:46 280000 -- (-1737.258) [-1740.812] (-1738.591) (-1739.953) * (-1739.573) (-1738.518) [-1738.794] (-1738.911) -- 0:00:46 Average standard deviation of split frequencies: 0.011011 280500 -- (-1737.332) (-1743.050) [-1737.944] (-1739.347) * (-1739.642) (-1738.983) (-1737.756) [-1737.757] -- 0:00:46 281000 -- (-1741.237) (-1744.315) [-1739.326] (-1739.076) * (-1742.592) (-1738.101) [-1737.629] (-1738.151) -- 0:00:46 281500 -- [-1740.109] (-1738.174) (-1740.751) (-1741.828) * (-1740.321) (-1738.101) (-1738.452) [-1737.778] -- 0:00:45 282000 -- (-1742.286) (-1739.306) [-1739.742] (-1741.037) * [-1739.563] (-1738.956) (-1737.411) (-1740.904) -- 0:00:45 282500 -- (-1741.020) (-1739.778) [-1738.983] (-1741.886) * (-1739.225) (-1737.694) [-1737.412] (-1739.494) -- 0:00:45 283000 -- (-1741.844) [-1739.896] (-1739.583) (-1741.184) * (-1739.129) [-1737.722] (-1739.039) (-1739.386) -- 0:00:45 283500 -- (-1744.847) (-1739.479) [-1738.984] (-1744.964) * (-1738.820) (-1737.742) [-1736.913] (-1739.846) -- 0:00:45 284000 -- (-1740.668) (-1739.137) [-1738.125] (-1740.963) * (-1741.866) [-1740.363] (-1738.293) (-1740.128) -- 0:00:45 284500 -- (-1741.213) (-1740.855) [-1738.917] (-1738.522) * (-1737.520) [-1739.795] (-1737.950) (-1739.392) -- 0:00:45 285000 -- (-1742.210) (-1741.278) (-1741.354) [-1739.143] * (-1741.380) [-1738.424] (-1740.480) (-1739.173) -- 0:00:45 Average standard deviation of split frequencies: 0.010150 285500 -- (-1743.924) (-1740.837) [-1737.511] (-1739.721) * (-1738.430) (-1737.247) (-1742.274) [-1738.610] -- 0:00:45 286000 -- [-1740.860] (-1739.423) (-1738.798) (-1740.633) * (-1740.298) [-1737.548] (-1748.229) (-1739.934) -- 0:00:44 286500 -- [-1740.987] (-1740.404) (-1737.885) (-1740.840) * [-1739.188] (-1738.129) (-1742.996) (-1740.334) -- 0:00:44 287000 -- (-1739.774) (-1740.615) [-1741.846] (-1738.211) * (-1740.018) [-1740.986] (-1740.287) (-1740.413) -- 0:00:44 287500 -- (-1741.723) [-1739.110] (-1738.264) (-1738.268) * (-1742.313) (-1742.027) (-1739.281) [-1744.252] -- 0:00:44 288000 -- (-1739.173) [-1738.167] (-1738.579) (-1739.049) * (-1740.142) (-1741.893) [-1740.197] (-1742.889) -- 0:00:46 288500 -- (-1738.394) [-1738.120] (-1738.670) (-1738.668) * (-1741.224) (-1743.019) (-1738.069) [-1740.738] -- 0:00:46 289000 -- (-1741.064) [-1738.373] (-1738.703) (-1740.145) * (-1740.703) (-1742.183) (-1738.069) [-1739.610] -- 0:00:46 289500 -- (-1739.240) (-1737.968) [-1738.043] (-1739.447) * (-1741.998) [-1738.204] (-1737.394) (-1738.192) -- 0:00:46 290000 -- (-1738.284) (-1737.268) [-1738.078] (-1738.555) * (-1739.774) [-1740.444] (-1738.347) (-1737.808) -- 0:00:46 Average standard deviation of split frequencies: 0.010158 290500 -- (-1738.318) [-1737.578] (-1740.195) (-1739.109) * (-1740.734) (-1739.880) [-1739.079] (-1737.601) -- 0:00:46 291000 -- [-1738.529] (-1739.899) (-1739.222) (-1740.622) * (-1738.788) [-1738.745] (-1740.008) (-1739.803) -- 0:00:46 291500 -- (-1739.579) (-1738.036) (-1738.566) [-1741.243] * (-1737.643) [-1738.656] (-1737.202) (-1741.452) -- 0:00:46 292000 -- (-1740.925) [-1738.709] (-1737.136) (-1740.792) * (-1737.310) [-1739.200] (-1738.291) (-1739.970) -- 0:00:46 292500 -- (-1741.703) (-1739.680) (-1738.703) [-1740.203] * (-1739.288) [-1737.246] (-1738.735) (-1739.475) -- 0:00:45 293000 -- (-1740.040) (-1738.437) [-1737.920] (-1741.397) * (-1739.732) (-1739.345) (-1738.704) [-1739.194] -- 0:00:45 293500 -- (-1739.511) (-1739.071) [-1738.301] (-1738.367) * (-1743.837) [-1737.328] (-1740.007) (-1739.842) -- 0:00:45 294000 -- [-1739.341] (-1739.109) (-1737.730) (-1738.449) * (-1737.087) [-1737.792] (-1739.107) (-1737.848) -- 0:00:45 294500 -- (-1740.569) [-1739.762] (-1739.690) (-1738.972) * (-1737.089) (-1739.585) (-1739.586) [-1738.025] -- 0:00:45 295000 -- [-1738.408] (-1739.740) (-1739.322) (-1740.174) * [-1739.109] (-1739.945) (-1737.223) (-1738.849) -- 0:00:45 Average standard deviation of split frequencies: 0.010175 295500 -- (-1739.023) (-1740.363) (-1741.650) [-1739.652] * (-1738.963) (-1739.144) [-1737.445] (-1740.274) -- 0:00:45 296000 -- (-1739.424) [-1739.083] (-1741.094) (-1739.563) * (-1738.562) (-1739.349) (-1737.684) [-1738.209] -- 0:00:45 296500 -- (-1740.189) (-1743.374) (-1739.693) [-1737.571] * (-1741.165) (-1738.989) [-1738.158] (-1737.977) -- 0:00:45 297000 -- [-1738.174] (-1739.467) (-1738.615) (-1737.181) * [-1738.265] (-1739.811) (-1740.963) (-1744.485) -- 0:00:44 297500 -- (-1741.871) (-1740.533) (-1738.401) [-1737.934] * [-1738.685] (-1738.717) (-1739.593) (-1739.533) -- 0:00:44 298000 -- (-1738.126) (-1747.287) (-1741.582) [-1738.370] * (-1737.953) [-1738.081] (-1738.714) (-1738.432) -- 0:00:44 298500 -- (-1738.305) (-1737.698) [-1743.875] (-1738.969) * (-1739.324) (-1739.143) (-1737.067) [-1743.314] -- 0:00:44 299000 -- (-1738.527) (-1737.716) [-1745.255] (-1739.514) * (-1739.900) (-1739.614) [-1743.418] (-1737.364) -- 0:00:44 299500 -- (-1739.343) [-1740.731] (-1746.267) (-1738.223) * (-1738.543) (-1738.948) [-1742.367] (-1739.163) -- 0:00:44 300000 -- [-1738.077] (-1743.157) (-1743.284) (-1738.416) * [-1739.121] (-1740.033) (-1737.394) (-1738.613) -- 0:00:44 Average standard deviation of split frequencies: 0.009505 300500 -- [-1737.899] (-1738.853) (-1743.581) (-1740.557) * (-1737.039) [-1739.931] (-1739.017) (-1739.836) -- 0:00:44 301000 -- (-1738.853) (-1737.184) (-1748.011) [-1742.124] * (-1742.303) [-1737.516] (-1739.080) (-1743.928) -- 0:00:44 301500 -- (-1738.872) (-1737.525) (-1739.573) [-1740.282] * (-1738.012) (-1737.945) [-1740.094] (-1742.971) -- 0:00:44 302000 -- (-1739.100) [-1737.226] (-1739.727) (-1740.712) * (-1739.049) (-1739.925) [-1739.203] (-1742.323) -- 0:00:43 302500 -- (-1740.318) (-1738.983) (-1739.143) [-1739.966] * [-1739.198] (-1738.894) (-1738.492) (-1740.872) -- 0:00:43 303000 -- (-1738.030) [-1739.427] (-1741.241) (-1740.002) * (-1742.424) (-1741.762) (-1738.864) [-1739.785] -- 0:00:43 303500 -- [-1739.493] (-1739.084) (-1741.125) (-1739.518) * (-1742.411) (-1738.518) (-1739.493) [-1739.428] -- 0:00:45 304000 -- (-1743.894) (-1738.769) [-1739.890] (-1738.519) * (-1738.999) [-1741.405] (-1740.025) (-1742.864) -- 0:00:45 304500 -- (-1741.766) (-1739.879) [-1740.825] (-1737.951) * (-1738.513) (-1738.805) (-1737.810) [-1741.549] -- 0:00:45 305000 -- [-1739.533] (-1738.448) (-1740.151) (-1738.805) * [-1737.473] (-1738.726) (-1739.563) (-1743.300) -- 0:00:45 Average standard deviation of split frequencies: 0.008428 305500 -- [-1738.594] (-1739.035) (-1740.196) (-1738.046) * (-1737.633) [-1737.356] (-1737.304) (-1739.748) -- 0:00:45 306000 -- (-1743.089) (-1740.667) (-1737.636) [-1738.248] * (-1738.979) (-1737.709) [-1738.447] (-1741.733) -- 0:00:45 306500 -- (-1741.465) (-1743.116) (-1739.730) [-1742.189] * (-1738.097) (-1739.047) [-1739.143] (-1737.836) -- 0:00:45 307000 -- (-1744.789) (-1740.273) [-1740.862] (-1740.499) * [-1738.121] (-1742.161) (-1738.464) (-1737.906) -- 0:00:45 307500 -- [-1737.736] (-1746.719) (-1739.974) (-1743.057) * (-1738.688) [-1739.019] (-1738.573) (-1738.896) -- 0:00:45 308000 -- (-1739.190) [-1738.918] (-1743.868) (-1740.412) * (-1741.019) (-1743.548) (-1737.298) [-1738.420] -- 0:00:44 308500 -- (-1739.941) (-1738.900) (-1743.438) [-1738.322] * (-1739.328) [-1739.088] (-1738.052) (-1738.704) -- 0:00:44 309000 -- (-1737.655) [-1737.854] (-1741.809) (-1738.543) * (-1740.120) (-1737.938) (-1738.728) [-1740.110] -- 0:00:44 309500 -- (-1742.505) [-1737.969] (-1737.326) (-1741.395) * (-1740.257) (-1738.604) (-1739.752) [-1738.774] -- 0:00:44 310000 -- (-1744.077) (-1739.004) (-1737.937) [-1738.595] * (-1739.195) (-1739.135) (-1741.782) [-1738.895] -- 0:00:44 Average standard deviation of split frequencies: 0.007587 310500 -- [-1737.384] (-1739.238) (-1737.923) (-1738.773) * (-1739.215) (-1737.426) (-1739.732) [-1742.298] -- 0:00:44 311000 -- (-1739.682) [-1738.455] (-1740.459) (-1738.478) * (-1741.137) (-1740.038) (-1738.050) [-1738.745] -- 0:00:44 311500 -- (-1738.209) (-1738.513) [-1740.013] (-1737.682) * (-1743.330) (-1740.568) [-1738.294] (-1741.147) -- 0:00:44 312000 -- [-1737.771] (-1737.868) (-1746.516) (-1738.301) * [-1740.444] (-1737.465) (-1739.185) (-1739.649) -- 0:00:44 312500 -- (-1738.074) [-1737.987] (-1741.872) (-1739.773) * (-1740.112) (-1738.394) (-1737.929) [-1737.394] -- 0:00:44 313000 -- (-1745.907) (-1737.905) (-1740.257) [-1745.917] * [-1740.982] (-1737.323) (-1739.266) (-1744.054) -- 0:00:43 313500 -- (-1737.843) (-1739.508) [-1739.970] (-1740.999) * (-1740.818) (-1737.570) (-1738.856) [-1737.724] -- 0:00:43 314000 -- (-1739.377) [-1739.256] (-1743.134) (-1738.230) * [-1738.201] (-1737.556) (-1739.328) (-1739.124) -- 0:00:43 314500 -- [-1739.718] (-1737.484) (-1743.425) (-1739.762) * (-1739.210) (-1737.390) (-1739.171) [-1738.195] -- 0:00:43 315000 -- (-1740.540) [-1737.207] (-1739.399) (-1745.096) * (-1739.022) (-1737.412) (-1737.686) [-1737.465] -- 0:00:43 Average standard deviation of split frequencies: 0.008073 315500 -- (-1740.024) [-1737.536] (-1740.858) (-1741.578) * (-1743.895) (-1738.917) (-1738.788) [-1737.144] -- 0:00:43 316000 -- (-1740.370) [-1740.788] (-1741.206) (-1742.339) * [-1739.402] (-1738.023) (-1741.739) (-1737.747) -- 0:00:43 316500 -- (-1739.497) (-1738.805) [-1738.512] (-1740.756) * (-1739.014) (-1739.244) (-1741.197) [-1737.988] -- 0:00:43 317000 -- (-1744.297) (-1741.464) [-1737.810] (-1739.616) * [-1738.150] (-1738.725) (-1738.993) (-1739.106) -- 0:00:43 317500 -- [-1742.337] (-1741.751) (-1739.723) (-1739.448) * (-1738.150) (-1738.216) [-1739.281] (-1740.838) -- 0:00:42 318000 -- [-1741.140] (-1741.168) (-1738.514) (-1739.079) * [-1740.200] (-1745.912) (-1741.089) (-1740.782) -- 0:00:42 318500 -- (-1739.807) (-1739.847) (-1738.093) [-1738.678] * (-1738.851) [-1741.696] (-1740.670) (-1738.928) -- 0:00:42 319000 -- (-1741.412) (-1742.515) [-1738.427] (-1740.659) * (-1738.743) (-1739.565) (-1739.508) [-1738.421] -- 0:00:44 319500 -- [-1739.308] (-1740.481) (-1737.834) (-1742.520) * [-1737.650] (-1737.722) (-1740.557) (-1739.221) -- 0:00:44 320000 -- (-1738.505) (-1738.531) (-1739.542) [-1737.454] * (-1737.651) (-1740.566) [-1740.407] (-1739.246) -- 0:00:44 Average standard deviation of split frequencies: 0.007610 320500 -- (-1739.928) (-1739.518) (-1739.840) [-1738.173] * (-1740.084) [-1737.826] (-1739.179) (-1739.632) -- 0:00:44 321000 -- (-1738.672) (-1740.012) (-1738.497) [-1738.452] * [-1738.397] (-1741.601) (-1741.290) (-1741.874) -- 0:00:44 321500 -- [-1737.208] (-1742.409) (-1737.424) (-1738.713) * (-1738.156) (-1737.056) [-1742.483] (-1743.382) -- 0:00:44 322000 -- (-1739.758) [-1740.106] (-1739.254) (-1741.641) * (-1738.365) [-1737.221] (-1743.593) (-1738.587) -- 0:00:44 322500 -- (-1737.732) (-1738.862) [-1737.825] (-1739.653) * (-1738.377) [-1738.308] (-1741.707) (-1738.883) -- 0:00:44 323000 -- [-1737.703] (-1738.368) (-1739.305) (-1738.341) * (-1740.569) [-1738.404] (-1741.669) (-1739.278) -- 0:00:44 323500 -- (-1737.855) [-1738.008] (-1741.367) (-1737.697) * (-1741.401) (-1739.543) [-1738.900] (-1739.150) -- 0:00:43 324000 -- [-1737.818] (-1738.157) (-1739.171) (-1741.619) * (-1738.851) [-1740.121] (-1737.850) (-1741.302) -- 0:00:43 324500 -- (-1740.862) (-1738.375) [-1739.898] (-1738.428) * (-1740.813) (-1739.482) [-1740.379] (-1739.885) -- 0:00:43 325000 -- (-1741.157) [-1738.308] (-1739.737) (-1738.212) * (-1746.539) [-1737.296] (-1740.614) (-1739.402) -- 0:00:43 Average standard deviation of split frequencies: 0.007632 325500 -- (-1741.123) [-1739.357] (-1737.562) (-1742.763) * (-1737.414) [-1738.040] (-1738.399) (-1738.445) -- 0:00:43 326000 -- (-1740.318) [-1739.661] (-1738.094) (-1741.011) * (-1740.249) [-1739.634] (-1739.634) (-1741.505) -- 0:00:43 326500 -- (-1740.067) (-1744.156) (-1739.376) [-1740.289] * [-1737.809] (-1737.736) (-1739.278) (-1737.138) -- 0:00:43 327000 -- (-1741.766) [-1738.714] (-1739.308) (-1742.686) * (-1744.295) (-1740.708) (-1741.975) [-1740.717] -- 0:00:43 327500 -- (-1745.154) (-1738.123) [-1738.136] (-1740.450) * (-1744.935) (-1741.518) (-1738.889) [-1742.308] -- 0:00:43 328000 -- (-1743.191) (-1740.690) (-1738.184) [-1738.153] * (-1738.584) (-1741.258) (-1740.982) [-1742.365] -- 0:00:43 328500 -- (-1741.321) (-1740.482) [-1739.116] (-1737.022) * (-1738.548) (-1740.714) (-1741.188) [-1741.508] -- 0:00:42 329000 -- (-1744.242) (-1739.845) (-1739.132) [-1738.818] * (-1738.894) (-1744.172) [-1739.757] (-1741.644) -- 0:00:42 329500 -- (-1739.728) [-1738.702] (-1739.863) (-1740.263) * (-1739.300) (-1740.969) (-1739.013) [-1739.905] -- 0:00:42 330000 -- (-1739.588) (-1739.677) (-1741.871) [-1738.329] * [-1737.652] (-1740.008) (-1741.374) (-1739.098) -- 0:00:42 Average standard deviation of split frequencies: 0.008237 330500 -- [-1741.621] (-1739.124) (-1742.176) (-1739.780) * [-1739.973] (-1739.746) (-1745.061) (-1738.334) -- 0:00:42 331000 -- (-1737.936) (-1738.808) [-1745.339] (-1741.666) * [-1738.373] (-1742.087) (-1743.746) (-1739.971) -- 0:00:42 331500 -- (-1740.226) (-1737.997) [-1739.170] (-1741.096) * (-1738.497) (-1739.064) (-1743.640) [-1741.704] -- 0:00:42 332000 -- (-1739.981) [-1738.081] (-1739.067) (-1740.412) * (-1737.975) [-1739.692] (-1743.052) (-1742.694) -- 0:00:42 332500 -- (-1739.962) (-1737.479) [-1738.290] (-1738.960) * (-1739.147) [-1739.026] (-1738.686) (-1741.886) -- 0:00:42 333000 -- [-1738.314] (-1738.867) (-1738.828) (-1742.898) * (-1738.498) (-1739.779) [-1740.243] (-1739.683) -- 0:00:42 333500 -- (-1741.361) [-1738.277] (-1742.489) (-1748.358) * (-1739.743) (-1738.935) [-1737.608] (-1737.885) -- 0:00:41 334000 -- [-1738.774] (-1738.481) (-1741.116) (-1738.995) * (-1738.928) [-1738.956] (-1738.509) (-1738.198) -- 0:00:41 334500 -- (-1739.034) (-1738.186) (-1739.421) [-1738.209] * (-1742.450) [-1738.525] (-1742.340) (-1738.120) -- 0:00:43 335000 -- [-1739.223] (-1739.604) (-1745.345) (-1739.875) * (-1739.695) [-1737.289] (-1743.129) (-1738.416) -- 0:00:43 Average standard deviation of split frequencies: 0.007716 335500 -- (-1739.306) (-1741.449) (-1741.760) [-1738.355] * [-1742.278] (-1737.969) (-1739.221) (-1738.381) -- 0:00:43 336000 -- (-1738.095) [-1739.095] (-1740.494) (-1739.256) * (-1743.263) (-1737.929) (-1739.769) [-1739.105] -- 0:00:43 336500 -- (-1738.064) [-1737.828] (-1741.257) (-1741.599) * (-1740.085) (-1737.398) [-1740.025] (-1738.767) -- 0:00:43 337000 -- (-1738.064) (-1741.456) (-1741.068) [-1739.348] * (-1739.539) [-1738.787] (-1737.978) (-1739.590) -- 0:00:43 337500 -- (-1738.723) (-1740.017) (-1740.345) [-1739.721] * (-1738.753) (-1741.997) (-1738.262) [-1740.213] -- 0:00:43 338000 -- (-1738.552) (-1740.364) [-1737.704] (-1741.760) * (-1738.919) [-1741.316] (-1741.275) (-1742.416) -- 0:00:43 338500 -- (-1738.624) [-1739.199] (-1739.670) (-1740.939) * [-1740.308] (-1739.553) (-1738.681) (-1740.834) -- 0:00:42 339000 -- (-1739.002) (-1738.619) (-1739.647) [-1740.793] * (-1738.342) (-1741.137) [-1739.497] (-1742.243) -- 0:00:42 339500 -- (-1738.469) (-1738.743) (-1745.183) [-1738.039] * (-1737.523) [-1737.520] (-1742.607) (-1740.053) -- 0:00:42 340000 -- (-1740.410) (-1738.103) (-1739.146) [-1738.868] * [-1738.581] (-1739.030) (-1740.016) (-1738.464) -- 0:00:42 Average standard deviation of split frequencies: 0.007697 340500 -- [-1738.640] (-1740.150) (-1739.882) (-1740.600) * (-1738.935) (-1740.996) [-1738.765] (-1739.177) -- 0:00:42 341000 -- (-1738.560) [-1737.847] (-1737.985) (-1742.541) * (-1739.727) [-1737.527] (-1742.736) (-1737.530) -- 0:00:42 341500 -- (-1738.740) (-1741.399) [-1738.446] (-1741.909) * (-1740.616) (-1737.557) (-1739.109) [-1737.779] -- 0:00:42 342000 -- (-1739.196) (-1743.400) [-1738.353] (-1743.214) * (-1738.630) (-1737.513) [-1739.451] (-1737.626) -- 0:00:42 342500 -- [-1741.046] (-1740.535) (-1738.407) (-1740.226) * (-1737.587) (-1738.077) [-1738.856] (-1739.227) -- 0:00:42 343000 -- (-1740.512) (-1738.057) [-1738.702] (-1738.783) * (-1738.819) [-1737.991] (-1741.564) (-1738.183) -- 0:00:42 343500 -- (-1740.340) [-1737.976] (-1738.791) (-1739.871) * (-1738.151) (-1737.922) [-1739.258] (-1742.951) -- 0:00:42 344000 -- (-1740.107) (-1739.262) [-1739.788] (-1737.847) * (-1739.199) (-1743.889) [-1739.388] (-1741.645) -- 0:00:41 344500 -- (-1739.854) (-1739.230) (-1739.151) [-1742.089] * [-1739.558] (-1740.831) (-1737.353) (-1741.992) -- 0:00:41 345000 -- (-1743.071) (-1739.009) [-1739.351] (-1740.816) * (-1739.689) (-1738.485) [-1737.921] (-1743.517) -- 0:00:41 Average standard deviation of split frequencies: 0.006983 345500 -- (-1743.495) [-1738.790] (-1739.186) (-1741.157) * [-1737.753] (-1738.233) (-1738.863) (-1747.389) -- 0:00:41 346000 -- [-1740.923] (-1739.875) (-1738.109) (-1740.854) * (-1741.197) [-1741.189] (-1739.639) (-1744.055) -- 0:00:41 346500 -- (-1741.650) (-1740.394) (-1737.644) [-1740.019] * (-1739.685) (-1741.435) [-1740.465] (-1738.259) -- 0:00:41 347000 -- (-1739.659) (-1739.004) (-1737.569) [-1740.686] * (-1745.239) (-1739.384) [-1740.410] (-1738.918) -- 0:00:41 347500 -- (-1737.949) (-1737.138) [-1738.519] (-1739.301) * (-1738.502) [-1739.220] (-1739.830) (-1738.227) -- 0:00:41 348000 -- (-1738.125) [-1739.739] (-1738.166) (-1741.076) * (-1738.501) (-1739.332) [-1740.203] (-1737.454) -- 0:00:41 348500 -- (-1738.789) (-1738.197) [-1737.565] (-1741.624) * (-1738.492) [-1738.096] (-1740.092) (-1738.985) -- 0:00:41 349000 -- (-1738.186) (-1739.838) [-1737.670] (-1741.419) * (-1738.887) [-1738.551] (-1740.456) (-1738.787) -- 0:00:41 349500 -- [-1740.840] (-1740.984) (-1737.455) (-1744.764) * (-1737.597) [-1739.772] (-1741.617) (-1739.955) -- 0:00:40 350000 -- [-1738.187] (-1741.083) (-1739.039) (-1740.225) * [-1737.432] (-1741.033) (-1738.943) (-1740.520) -- 0:00:42 Average standard deviation of split frequencies: 0.006217 350500 -- (-1738.881) [-1740.141] (-1739.408) (-1741.827) * (-1738.599) (-1739.841) (-1737.762) [-1739.720] -- 0:00:42 351000 -- [-1737.212] (-1743.196) (-1738.851) (-1741.274) * [-1737.577] (-1742.280) (-1737.939) (-1740.588) -- 0:00:42 351500 -- [-1738.606] (-1740.659) (-1738.336) (-1739.525) * (-1738.786) [-1737.648] (-1741.234) (-1739.794) -- 0:00:42 352000 -- (-1737.096) (-1739.880) [-1738.455] (-1741.864) * [-1740.079] (-1737.760) (-1742.273) (-1741.085) -- 0:00:42 352500 -- (-1737.020) (-1737.164) [-1739.727] (-1744.248) * [-1739.348] (-1739.728) (-1739.908) (-1739.085) -- 0:00:42 353000 -- [-1738.469] (-1738.799) (-1737.592) (-1739.517) * [-1738.688] (-1737.673) (-1746.644) (-1739.398) -- 0:00:42 353500 -- (-1741.250) [-1738.386] (-1740.092) (-1739.757) * (-1741.437) (-1742.389) [-1738.228] (-1738.258) -- 0:00:42 354000 -- [-1741.193] (-1741.991) (-1740.319) (-1739.872) * [-1740.212] (-1738.103) (-1742.273) (-1739.624) -- 0:00:41 354500 -- (-1740.167) [-1738.071] (-1738.161) (-1738.522) * (-1740.880) (-1737.317) [-1740.284] (-1740.131) -- 0:00:41 355000 -- (-1739.200) (-1738.312) (-1739.110) [-1738.286] * (-1740.126) [-1737.271] (-1741.595) (-1738.700) -- 0:00:41 Average standard deviation of split frequencies: 0.007200 355500 -- (-1738.688) (-1739.784) [-1739.433] (-1738.534) * [-1743.905] (-1739.046) (-1746.035) (-1738.327) -- 0:00:41 356000 -- (-1742.521) [-1739.716] (-1739.417) (-1738.545) * (-1742.727) (-1737.881) (-1739.510) [-1739.446] -- 0:00:41 356500 -- (-1738.828) (-1738.877) [-1738.537] (-1738.486) * (-1738.484) (-1737.691) [-1740.955] (-1739.275) -- 0:00:41 357000 -- (-1738.745) [-1738.497] (-1739.039) (-1738.305) * [-1739.707] (-1742.827) (-1738.681) (-1738.656) -- 0:00:41 357500 -- (-1740.392) (-1738.177) [-1738.568] (-1739.020) * [-1738.597] (-1739.498) (-1744.080) (-1739.955) -- 0:00:41 358000 -- (-1739.488) (-1740.654) (-1740.547) [-1739.190] * [-1738.573] (-1738.495) (-1744.323) (-1740.915) -- 0:00:41 358500 -- (-1740.102) [-1737.603] (-1740.484) (-1737.604) * (-1741.686) [-1740.556] (-1739.589) (-1738.137) -- 0:00:41 359000 -- (-1738.722) [-1739.199] (-1739.572) (-1739.626) * (-1741.526) [-1743.705] (-1739.518) (-1738.284) -- 0:00:41 359500 -- [-1738.865] (-1742.070) (-1739.828) (-1738.790) * (-1738.290) [-1741.914] (-1740.533) (-1739.091) -- 0:00:40 360000 -- (-1738.743) [-1739.507] (-1737.676) (-1737.976) * [-1740.030] (-1739.267) (-1738.786) (-1742.622) -- 0:00:40 Average standard deviation of split frequencies: 0.008611 360500 -- (-1738.670) (-1738.766) (-1738.749) [-1738.479] * (-1737.555) [-1739.244] (-1737.814) (-1740.404) -- 0:00:40 361000 -- (-1738.638) (-1740.420) [-1742.366] (-1741.876) * [-1738.889] (-1737.532) (-1738.768) (-1739.082) -- 0:00:40 361500 -- (-1738.848) (-1738.607) [-1739.934] (-1740.534) * (-1738.233) (-1740.857) (-1737.891) [-1739.881] -- 0:00:40 362000 -- [-1737.715] (-1737.548) (-1740.063) (-1739.716) * (-1737.933) (-1736.996) [-1742.485] (-1739.578) -- 0:00:40 362500 -- (-1739.217) [-1739.175] (-1742.007) (-1742.039) * (-1737.931) (-1740.444) [-1737.784] (-1739.429) -- 0:00:40 363000 -- [-1743.109] (-1741.921) (-1745.442) (-1739.148) * (-1738.394) (-1738.198) [-1738.543] (-1737.718) -- 0:00:40 363500 -- (-1741.607) (-1740.583) (-1741.763) [-1738.907] * [-1738.209] (-1738.023) (-1740.218) (-1741.213) -- 0:00:40 364000 -- (-1741.003) (-1740.335) [-1740.118] (-1740.662) * (-1738.043) [-1738.061] (-1737.659) (-1740.344) -- 0:00:40 364500 -- (-1740.428) (-1737.880) [-1739.758] (-1740.278) * (-1739.305) (-1739.054) [-1739.967] (-1740.233) -- 0:00:40 365000 -- (-1739.930) [-1737.491] (-1739.154) (-1743.631) * (-1744.315) (-1738.071) [-1737.572] (-1744.468) -- 0:00:40 Average standard deviation of split frequencies: 0.008713 365500 -- (-1740.031) [-1740.090] (-1738.930) (-1739.228) * (-1746.733) (-1739.176) [-1737.246] (-1742.858) -- 0:00:41 366000 -- [-1740.517] (-1741.531) (-1737.589) (-1739.965) * (-1747.518) [-1738.556] (-1740.495) (-1741.670) -- 0:00:41 366500 -- (-1738.199) (-1740.799) [-1741.219] (-1737.944) * [-1738.015] (-1738.693) (-1738.355) (-1740.951) -- 0:00:41 367000 -- (-1738.328) (-1739.918) [-1740.076] (-1737.258) * (-1738.306) (-1737.634) [-1738.028] (-1740.882) -- 0:00:41 367500 -- (-1737.085) (-1739.785) (-1745.285) [-1737.495] * [-1739.166] (-1739.063) (-1738.036) (-1738.179) -- 0:00:41 368000 -- [-1740.771] (-1739.310) (-1740.134) (-1740.238) * (-1738.979) (-1740.716) [-1738.398] (-1739.238) -- 0:00:41 368500 -- (-1738.136) (-1739.139) (-1743.581) [-1740.203] * (-1738.368) (-1741.458) [-1738.087] (-1743.586) -- 0:00:41 369000 -- (-1743.604) (-1739.812) [-1738.027] (-1740.842) * (-1738.192) [-1742.826] (-1747.810) (-1743.381) -- 0:00:41 369500 -- [-1743.837] (-1739.205) (-1740.109) (-1745.994) * (-1739.717) [-1744.416] (-1737.716) (-1741.651) -- 0:00:40 370000 -- [-1740.040] (-1738.552) (-1739.585) (-1738.007) * (-1742.048) [-1738.090] (-1737.357) (-1739.572) -- 0:00:40 Average standard deviation of split frequencies: 0.009276 370500 -- (-1740.364) (-1737.176) (-1738.397) [-1737.439] * (-1742.451) [-1739.984] (-1739.533) (-1742.326) -- 0:00:40 371000 -- (-1738.477) [-1737.889] (-1738.096) (-1743.338) * (-1741.117) (-1739.094) [-1738.636] (-1741.318) -- 0:00:40 371500 -- (-1743.057) (-1741.489) (-1740.859) [-1737.838] * (-1738.597) (-1744.185) [-1738.606] (-1740.738) -- 0:00:40 372000 -- (-1740.488) (-1739.999) [-1737.240] (-1738.091) * (-1738.260) [-1738.329] (-1738.133) (-1740.699) -- 0:00:40 372500 -- (-1740.994) [-1740.376] (-1737.516) (-1743.457) * (-1738.830) [-1739.780] (-1740.810) (-1738.879) -- 0:00:40 373000 -- [-1739.987] (-1739.688) (-1737.849) (-1741.570) * (-1738.504) (-1741.455) [-1738.532] (-1738.881) -- 0:00:40 373500 -- [-1737.706] (-1742.108) (-1740.910) (-1741.879) * (-1738.900) (-1739.913) [-1739.181] (-1737.575) -- 0:00:40 374000 -- (-1739.339) [-1740.349] (-1740.373) (-1739.981) * (-1739.014) (-1743.243) [-1739.623] (-1740.523) -- 0:00:40 374500 -- (-1739.021) (-1738.081) (-1739.040) [-1738.518] * (-1739.690) [-1740.291] (-1739.104) (-1740.872) -- 0:00:40 375000 -- (-1737.781) (-1737.991) [-1738.058] (-1738.316) * (-1739.134) (-1740.455) [-1738.624] (-1738.632) -- 0:00:40 Average standard deviation of split frequencies: 0.009168 375500 -- (-1739.074) (-1738.256) (-1739.448) [-1739.113] * (-1738.769) (-1739.056) [-1740.033] (-1739.283) -- 0:00:39 376000 -- (-1739.134) (-1741.059) [-1738.155] (-1738.521) * (-1738.681) (-1739.167) [-1739.491] (-1737.784) -- 0:00:39 376500 -- (-1739.194) (-1742.910) (-1741.205) [-1738.189] * (-1740.319) [-1741.668] (-1739.110) (-1739.443) -- 0:00:39 377000 -- (-1741.335) (-1742.919) [-1739.909] (-1743.723) * (-1743.428) [-1740.310] (-1739.645) (-1737.871) -- 0:00:39 377500 -- [-1740.280] (-1742.330) (-1738.435) (-1750.375) * (-1743.405) (-1739.349) (-1739.609) [-1737.809] -- 0:00:39 378000 -- [-1740.915] (-1740.370) (-1738.582) (-1739.610) * [-1740.798] (-1739.390) (-1737.138) (-1738.788) -- 0:00:39 378500 -- (-1742.661) (-1737.336) (-1739.985) [-1739.732] * [-1737.998] (-1739.390) (-1738.058) (-1737.519) -- 0:00:39 379000 -- (-1737.787) (-1739.896) [-1738.670] (-1751.925) * (-1739.399) (-1739.333) (-1738.274) [-1738.183] -- 0:00:39 379500 -- (-1737.899) [-1739.462] (-1741.080) (-1740.042) * [-1739.398] (-1739.662) (-1737.643) (-1740.856) -- 0:00:39 380000 -- [-1738.476] (-1740.978) (-1739.858) (-1738.264) * (-1739.789) [-1738.084] (-1738.834) (-1737.121) -- 0:00:39 Average standard deviation of split frequencies: 0.009520 380500 -- (-1738.008) (-1739.949) (-1742.589) [-1739.042] * [-1739.477] (-1739.031) (-1738.694) (-1739.401) -- 0:00:39 381000 -- (-1738.469) (-1738.351) (-1742.967) [-1740.786] * [-1740.029] (-1738.498) (-1741.043) (-1740.671) -- 0:00:40 381500 -- (-1739.843) (-1741.671) (-1746.109) [-1738.724] * (-1740.894) [-1738.498] (-1738.918) (-1741.214) -- 0:00:40 382000 -- (-1742.490) [-1740.203] (-1739.289) (-1738.912) * (-1741.511) (-1738.498) [-1739.246] (-1738.677) -- 0:00:40 382500 -- (-1744.205) (-1738.980) (-1741.574) [-1738.357] * (-1738.677) (-1737.794) (-1739.085) [-1740.367] -- 0:00:40 383000 -- (-1739.911) [-1737.971] (-1740.191) (-1740.425) * (-1739.721) [-1737.984] (-1738.808) (-1738.478) -- 0:00:40 383500 -- (-1743.554) [-1740.588] (-1742.345) (-1739.554) * [-1741.192] (-1744.075) (-1739.077) (-1739.030) -- 0:00:40 384000 -- (-1741.283) (-1739.959) (-1743.668) [-1740.189] * (-1741.598) [-1738.850] (-1739.705) (-1738.951) -- 0:00:40 384500 -- (-1742.466) [-1739.126] (-1744.373) (-1738.544) * (-1739.949) [-1738.449] (-1741.363) (-1739.066) -- 0:00:40 385000 -- (-1742.859) (-1740.948) [-1738.967] (-1739.510) * [-1740.566] (-1738.134) (-1740.366) (-1740.018) -- 0:00:39 Average standard deviation of split frequencies: 0.008701 385500 -- (-1744.078) (-1739.144) [-1737.969] (-1738.739) * (-1743.710) (-1739.143) (-1740.208) [-1738.119] -- 0:00:39 386000 -- [-1741.409] (-1738.009) (-1740.378) (-1739.112) * (-1742.446) (-1739.349) [-1740.555] (-1739.005) -- 0:00:39 386500 -- [-1742.755] (-1739.920) (-1742.450) (-1738.954) * (-1741.298) (-1737.662) [-1742.282] (-1740.453) -- 0:00:39 387000 -- [-1738.607] (-1743.038) (-1740.745) (-1739.865) * (-1741.804) [-1738.862] (-1737.540) (-1739.287) -- 0:00:39 387500 -- [-1739.827] (-1741.397) (-1740.576) (-1738.870) * (-1741.171) [-1737.969] (-1739.934) (-1737.246) -- 0:00:39 388000 -- (-1738.424) (-1740.601) [-1742.010] (-1738.911) * (-1741.255) [-1737.993] (-1743.842) (-1737.266) -- 0:00:39 388500 -- (-1743.534) [-1740.489] (-1742.841) (-1737.964) * (-1739.821) (-1742.709) (-1740.086) [-1736.981] -- 0:00:39 389000 -- (-1745.967) (-1739.811) (-1738.666) [-1737.882] * (-1743.36