>C1
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C2
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C3
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C4
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C5
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C6
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=267
C1 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C2 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C3 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C4 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C5 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C6 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
**************************************************
C1 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C2 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C3 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C4 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C5 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C6 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
**************************************************
C1 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C2 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C3 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C4 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C5 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C6 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
**************************************************
C1 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C2 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C3 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C4 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C5 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C6 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
**************************************************
C1 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C2 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C3 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C4 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C5 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C6 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
**************************************************
C1 AVNVVLTTIGVRFGTGH
C2 AVNVVLTTIGVRFGTGH
C3 AVNVVLTTIGVRFGTGH
C4 AVNVVLTTIGVRFGTGH
C5 AVNVVLTTIGVRFGTGH
C6 AVNVVLTTIGVRFGTGH
*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 267 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 267 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8010]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8010]--->[8010]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.498 Mb, Max= 30.823 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C2 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C3 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C4 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C5 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
C6 VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
**************************************************
C1 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C2 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C3 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C4 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C5 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
C6 QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
**************************************************
C1 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C2 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C3 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C4 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C5 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
C6 TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
**************************************************
C1 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C2 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C3 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C4 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C5 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
C6 RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
**************************************************
C1 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C2 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C3 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C4 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C5 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
C6 EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
**************************************************
C1 AVNVVLTTIGVRFGTGH
C2 AVNVVLTTIGVRFGTGH
C3 AVNVVLTTIGVRFGTGH
C4 AVNVVLTTIGVRFGTGH
C5 AVNVVLTTIGVRFGTGH
C6 AVNVVLTTIGVRFGTGH
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
C2 GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
C3 GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
C4 GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
C5 GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
C6 GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
**************************************************
C1 CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
C2 CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
C3 CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
C4 CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
C5 CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
C6 CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
**************************************************
C1 CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
C2 CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
C3 CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
C4 CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
C5 CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
C6 CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
**************************************************
C1 CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
C2 CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
C3 CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
C4 CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
C5 CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
C6 CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
**************************************************
C1 GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
C2 GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
C3 GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
C4 GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
C5 GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
C6 GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
**************************************************
C1 AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
C2 AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
C3 AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
C4 AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
C5 AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
C6 AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
**************************************************
C1 ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
C2 ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
C3 ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
C4 ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
C5 ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
C6 ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
**************************************************
C1 GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
C2 GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
C3 GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
C4 GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
C5 GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
C6 GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
**************************************************
C1 ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
C2 ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
C3 ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
C4 ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
C5 ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
C6 ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
**************************************************
C1 CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
C2 CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
C3 CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
C4 CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
C5 CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
C6 CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
**************************************************
C1 CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
C2 CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
C3 CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
C4 CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
C5 CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
C6 CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
**************************************************
C1 TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
C2 TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
C3 TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
C4 TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
C5 TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
C6 TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
**************************************************
C1 GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
C2 GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
C3 GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
C4 GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
C5 GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
C6 GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
**************************************************
C1 CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
C2 CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
C3 CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
C4 CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
C5 CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
C6 CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
**************************************************
C1 TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
C2 TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
C3 TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
C4 TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
C5 TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
C6 TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
**************************************************
C1 GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C2 GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C3 GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C4 GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C5 GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C6 GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
**************************************************
C1 C
C2 C
C3 C
C4 C
C5 C
C6 C
*
>C1
GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C
>C2
GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C
>C3
GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C
>C4
GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C
>C5
GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C
>C6
GTGACGACGGAGACGCGCTCGAGCCTGGTCGAGTACGCCCACACCAAACT
CCAGACGCCACTGGTTCTTGTTGGCGGGTTCTTCCGAATGCTCGTCCTGA
CCGGAAAGGCGTTGTTCCGGCGGCCATTCCAATGGCGCGAGTTCATATTA
CAGTGCTGGTTCATCATGCGGGTTGCATTTCTGCCGACCGTCATGGTGTC
GATTCCGCTGACCGTGCTGCTGATCTTCACCCTCAACGTTCTGCTGGCTC
AGTTCAGCGCTGCAGACTTATCTGGCGCGGGCGCGGCGATCGGGGCCGTC
ACCCAGCTCGGCCCGTTGACCACGGTGCTGGTGGTGGCCGGCGCCGGATC
GACGTCCATCTGTGCGGACCTGGGTGCGCGCACTATCCGCGAGGAGATCG
ACGCGATGGAGGTTCTCGGCATCGACCCCATACATAGACTGGTAGTGCCC
CGGGTCCTTGCCGCGACGCTGGTAGCCACGCTGCTCAACGGCTTGGTCAT
CACCGTAGGCCTAGTGGGCGGCTACCTCTTCGGAGTTTACCTGCAGAATG
TGTCGGGCGGTGCCTATCTTGCTACTCTCACCACTATTACCGGTCTTCCC
GAAGTGGTGATCGCGACTGTCAAAGCCGCGACGTTCGGACTCATCGCTGG
CTTGGTCGGCTGTTATCGCGGGCTGATCGTACGCGGTGGTTCCAACGGAC
TGGGCGCCGCCGTCAACGAAACCGTGGTGCTTTGCGTGGTCGCGTTGTAC
GCGGTCAATGTGGTGCTGACCACCATCGGCGTGCGCTTCGGAACTGGACA
C
>C1
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C2
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C3
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C4
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C5
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
>C6
VTTETRSSLVEYAHTKLQTPLVLVGGFFRMLVLTGKALFRRPFQWREFIL
QCWFIMRVAFLPTVMVSIPLTVLLIFTLNVLLAQFSAADLSGAGAAIGAV
TQLGPLTTVLVVAGAGSTSICADLGARTIREEIDAMEVLGIDPIHRLVVP
RVLAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLP
EVVIATVKAATFGLIAGLVGCYRGLIVRGGSNGLGAAVNETVVLCVVALY
AVNVVLTTIGVRFGTGH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 801 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791775
Setting output file names to "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1139979788
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0810667071
Seed = 995602280
Swapseed = 1579791775
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1792.676397 -- -24.965149
Chain 2 -- -1792.676397 -- -24.965149
Chain 3 -- -1792.676124 -- -24.965149
Chain 4 -- -1792.676293 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1792.676124 -- -24.965149
Chain 2 -- -1792.676397 -- -24.965149
Chain 3 -- -1792.676397 -- -24.965149
Chain 4 -- -1792.676293 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1792.676] (-1792.676) (-1792.676) (-1792.676) * [-1792.676] (-1792.676) (-1792.676) (-1792.676)
500 -- (-1098.759) (-1109.714) (-1101.172) [-1102.999] * (-1111.001) (-1096.203) (-1106.972) [-1089.491] -- 0:33:19
1000 -- (-1090.977) (-1101.158) [-1088.598] (-1097.651) * (-1096.790) (-1090.101) (-1092.556) [-1088.887] -- 0:16:39
1500 -- (-1097.645) (-1091.300) [-1087.390] (-1099.920) * [-1092.165] (-1099.190) (-1100.383) (-1091.784) -- 0:11:05
2000 -- [-1089.371] (-1090.453) (-1093.514) (-1099.126) * (-1093.893) (-1091.615) (-1100.089) [-1092.367] -- 0:08:19
2500 -- (-1087.866) (-1093.052) [-1090.475] (-1091.174) * [-1093.963] (-1094.278) (-1097.193) (-1095.019) -- 0:06:39
3000 -- (-1087.968) (-1092.966) (-1098.337) [-1088.036] * (-1099.691) (-1090.671) [-1088.513] (-1093.334) -- 0:05:32
3500 -- (-1097.510) (-1100.458) [-1091.241] (-1091.944) * (-1099.637) (-1096.512) [-1098.205] (-1095.336) -- 0:04:44
4000 -- [-1094.265] (-1098.023) (-1097.764) (-1098.341) * (-1101.588) (-1099.428) [-1090.727] (-1093.878) -- 0:04:09
4500 -- (-1092.963) (-1095.376) [-1091.573] (-1087.637) * (-1097.473) (-1096.501) [-1095.067] (-1098.771) -- 0:03:41
5000 -- (-1090.629) (-1096.268) [-1091.581] (-1100.478) * (-1097.402) (-1093.171) [-1090.423] (-1100.944) -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- (-1093.637) (-1098.768) [-1097.509] (-1096.558) * [-1090.947] (-1091.665) (-1098.933) (-1095.537) -- 0:03:00
6000 -- (-1092.157) (-1100.444) [-1093.139] (-1091.604) * [-1089.986] (-1100.961) (-1094.671) (-1090.077) -- 0:02:45
6500 -- (-1103.562) (-1093.407) [-1086.878] (-1091.949) * (-1088.331) [-1088.675] (-1106.543) (-1091.809) -- 0:02:32
7000 -- (-1091.554) (-1090.937) (-1095.574) [-1096.249] * (-1089.768) (-1098.243) [-1092.101] (-1092.363) -- 0:02:21
7500 -- (-1091.378) (-1088.861) (-1091.897) [-1095.245] * (-1096.582) (-1091.442) [-1089.349] (-1095.362) -- 0:02:12
8000 -- (-1094.065) [-1093.747] (-1095.097) (-1093.248) * (-1097.453) (-1089.444) (-1088.069) [-1091.065] -- 0:02:04
8500 -- (-1094.617) [-1094.328] (-1100.289) (-1090.428) * (-1100.539) [-1088.723] (-1104.912) (-1093.243) -- 0:01:56
9000 -- (-1093.851) (-1092.729) (-1093.848) [-1089.546] * (-1091.235) [-1089.198] (-1092.346) (-1093.653) -- 0:01:50
9500 -- (-1095.049) (-1093.331) [-1090.499] (-1092.666) * [-1098.673] (-1093.232) (-1094.597) (-1092.018) -- 0:01:44
10000 -- (-1097.045) (-1096.443) (-1097.539) [-1096.573] * (-1089.357) (-1098.364) (-1094.659) [-1092.283] -- 0:01:39
Average standard deviation of split frequencies: 0.073657
10500 -- (-1092.937) (-1100.365) [-1096.184] (-1099.229) * (-1087.242) [-1093.756] (-1085.998) (-1092.132) -- 0:01:34
11000 -- (-1093.041) [-1091.686] (-1099.013) (-1093.501) * [-1092.653] (-1091.263) (-1094.065) (-1108.137) -- 0:01:29
11500 -- (-1098.788) (-1093.403) [-1088.701] (-1096.449) * (-1100.410) (-1088.253) (-1095.691) [-1091.092] -- 0:01:25
12000 -- [-1095.021] (-1090.459) (-1084.983) (-1092.732) * (-1092.649) (-1096.908) (-1093.287) [-1091.205] -- 0:01:22
12500 -- [-1091.008] (-1090.134) (-1084.967) (-1089.396) * [-1089.014] (-1098.108) (-1090.700) (-1093.051) -- 0:01:19
13000 -- (-1089.712) [-1097.444] (-1083.929) (-1096.003) * (-1094.988) (-1098.823) [-1093.945] (-1086.938) -- 0:01:15
13500 -- [-1095.993] (-1095.397) (-1084.471) (-1095.816) * (-1095.868) [-1091.766] (-1100.910) (-1094.773) -- 0:01:13
14000 -- (-1092.648) (-1098.294) (-1084.945) [-1087.910] * [-1087.622] (-1095.446) (-1104.766) (-1089.772) -- 0:01:10
14500 -- (-1097.412) (-1092.486) (-1083.098) [-1089.280] * (-1091.547) (-1093.172) (-1093.974) [-1093.613] -- 0:01:07
15000 -- (-1096.747) (-1102.421) (-1083.235) [-1091.302] * (-1108.068) (-1090.688) [-1091.500] (-1092.570) -- 0:02:11
Average standard deviation of split frequencies: 0.048071
15500 -- (-1100.091) (-1095.690) [-1084.691] (-1094.075) * (-1097.587) (-1093.397) (-1097.196) [-1090.612] -- 0:02:07
16000 -- (-1099.223) (-1087.747) (-1084.738) [-1091.349] * (-1090.561) (-1089.356) (-1092.820) [-1095.174] -- 0:02:03
16500 -- (-1089.138) (-1088.807) [-1082.499] (-1091.709) * [-1093.112] (-1089.031) (-1097.735) (-1089.744) -- 0:01:59
17000 -- (-1090.803) (-1099.464) [-1083.377] (-1098.495) * (-1105.760) (-1095.314) (-1095.104) [-1091.788] -- 0:01:55
17500 -- (-1096.379) (-1092.925) [-1084.564] (-1093.758) * (-1095.909) (-1098.306) (-1101.645) [-1085.777] -- 0:01:52
18000 -- (-1090.243) [-1095.755] (-1084.996) (-1088.391) * (-1098.408) (-1093.337) (-1091.663) [-1092.255] -- 0:01:49
18500 -- (-1089.932) [-1091.997] (-1090.791) (-1095.543) * [-1090.960] (-1094.431) (-1094.033) (-1097.549) -- 0:01:46
19000 -- (-1092.016) [-1092.189] (-1082.837) (-1092.708) * (-1093.619) [-1092.527] (-1098.162) (-1094.508) -- 0:01:43
19500 -- (-1094.233) (-1089.823) (-1086.643) [-1091.994] * (-1088.643) [-1088.330] (-1094.847) (-1091.562) -- 0:01:40
20000 -- [-1091.454] (-1097.462) (-1082.803) (-1092.859) * (-1095.654) (-1107.689) (-1094.033) [-1088.383] -- 0:01:38
Average standard deviation of split frequencies: 0.040818
20500 -- (-1096.035) (-1093.571) (-1082.725) [-1092.213] * (-1092.931) [-1086.455] (-1093.329) (-1090.106) -- 0:01:35
21000 -- (-1096.421) (-1103.156) (-1082.116) [-1089.221] * (-1100.251) (-1092.696) (-1089.573) [-1089.396] -- 0:01:33
21500 -- (-1088.329) (-1106.049) (-1082.411) [-1088.428] * (-1095.216) (-1097.792) (-1094.571) [-1095.071] -- 0:01:31
22000 -- (-1093.440) (-1094.371) [-1082.956] (-1093.826) * (-1101.633) (-1088.462) [-1088.576] (-1094.869) -- 0:01:28
22500 -- (-1093.543) (-1090.933) (-1084.531) [-1091.969] * (-1114.744) (-1093.276) (-1089.439) [-1096.738] -- 0:01:26
23000 -- (-1093.146) (-1090.372) (-1083.497) [-1096.626] * (-1099.037) (-1093.086) (-1089.616) [-1092.769] -- 0:01:24
23500 -- (-1094.357) (-1100.966) [-1083.161] (-1094.195) * (-1110.331) [-1097.990] (-1092.556) (-1102.888) -- 0:01:23
24000 -- [-1090.551] (-1090.369) (-1084.786) (-1089.835) * [-1082.600] (-1098.235) (-1093.690) (-1100.286) -- 0:01:21
24500 -- (-1087.757) (-1094.258) (-1082.794) [-1099.138] * (-1085.301) [-1089.037] (-1094.174) (-1093.253) -- 0:01:19
25000 -- (-1096.253) (-1101.664) [-1083.073] (-1095.825) * (-1086.701) (-1093.951) [-1092.451] (-1094.572) -- 0:01:18
Average standard deviation of split frequencies: 0.043169
25500 -- [-1092.067] (-1093.844) (-1082.743) (-1099.324) * (-1083.984) [-1091.196] (-1097.321) (-1099.592) -- 0:01:16
26000 -- (-1091.483) (-1091.693) [-1083.166] (-1094.448) * (-1082.615) (-1093.749) (-1089.288) [-1093.627] -- 0:01:14
26500 -- (-1093.030) (-1100.543) [-1090.186] (-1096.278) * (-1083.800) (-1089.488) [-1096.093] (-1091.431) -- 0:01:13
27000 -- (-1089.783) (-1093.337) (-1087.488) [-1088.941] * (-1084.675) [-1101.116] (-1091.603) (-1092.971) -- 0:01:12
27500 -- (-1090.502) (-1097.612) (-1082.741) [-1093.056] * (-1082.105) [-1093.144] (-1093.400) (-1090.791) -- 0:01:10
28000 -- [-1086.985] (-1108.586) (-1087.381) (-1088.367) * (-1082.867) (-1089.828) (-1092.087) [-1089.728] -- 0:01:09
28500 -- (-1096.153) (-1092.594) (-1090.931) [-1096.568] * [-1083.636] (-1091.235) (-1092.045) (-1095.118) -- 0:01:08
29000 -- [-1092.342] (-1095.320) (-1085.716) (-1091.225) * [-1083.204] (-1095.038) (-1098.710) (-1091.039) -- 0:01:06
29500 -- (-1093.126) (-1088.949) (-1086.811) [-1093.570] * (-1086.579) [-1090.274] (-1094.877) (-1093.872) -- 0:01:38
30000 -- [-1090.578] (-1095.558) (-1086.115) (-1085.467) * (-1085.737) (-1090.288) (-1097.966) [-1095.826] -- 0:01:37
Average standard deviation of split frequencies: 0.041225
30500 -- (-1084.368) (-1089.954) (-1083.623) [-1085.209] * (-1084.160) (-1092.095) [-1094.605] (-1094.929) -- 0:01:35
31000 -- [-1085.368] (-1093.182) (-1082.903) (-1083.480) * [-1083.539] (-1098.286) (-1091.004) (-1092.895) -- 0:01:33
31500 -- [-1085.460] (-1099.424) (-1083.513) (-1082.060) * (-1082.935) (-1099.048) (-1092.174) [-1083.158] -- 0:01:32
32000 -- (-1086.689) (-1094.650) [-1084.118] (-1086.381) * [-1084.482] (-1091.805) (-1094.659) (-1084.874) -- 0:01:30
32500 -- [-1085.936] (-1090.378) (-1083.699) (-1083.069) * (-1082.199) (-1099.684) [-1092.289] (-1085.291) -- 0:01:29
33000 -- (-1085.972) (-1092.416) (-1083.692) [-1083.439] * (-1083.632) (-1093.584) [-1090.136] (-1084.752) -- 0:01:27
33500 -- (-1088.312) (-1098.706) [-1083.037] (-1084.361) * [-1083.854] (-1091.405) (-1098.259) (-1085.427) -- 0:01:26
34000 -- (-1085.756) (-1092.377) [-1082.549] (-1084.996) * (-1085.668) (-1092.835) (-1096.762) [-1083.957] -- 0:01:25
34500 -- (-1087.480) [-1096.225] (-1083.858) (-1083.110) * (-1083.480) (-1091.075) (-1091.971) [-1081.702] -- 0:01:23
35000 -- [-1084.822] (-1094.267) (-1082.694) (-1082.543) * (-1086.114) (-1091.528) [-1094.585] (-1087.248) -- 0:01:22
Average standard deviation of split frequencies: 0.039284
35500 -- (-1085.283) [-1095.088] (-1082.874) (-1083.235) * (-1085.293) [-1097.064] (-1089.564) (-1087.519) -- 0:01:21
36000 -- [-1086.305] (-1090.103) (-1085.096) (-1083.992) * (-1084.862) (-1092.878) (-1110.469) [-1082.402] -- 0:01:20
36500 -- (-1083.156) (-1089.759) [-1083.082] (-1084.103) * (-1083.623) [-1089.266] (-1091.712) (-1082.738) -- 0:01:19
37000 -- (-1084.444) (-1095.667) [-1082.522] (-1083.894) * (-1082.568) (-1093.912) (-1101.314) [-1083.179] -- 0:01:18
37500 -- [-1087.573] (-1094.858) (-1087.379) (-1085.430) * (-1082.045) (-1091.196) [-1092.594] (-1085.085) -- 0:01:17
38000 -- (-1086.030) (-1089.782) [-1091.209] (-1083.515) * (-1082.212) [-1090.931] (-1090.044) (-1084.548) -- 0:01:15
38500 -- (-1086.004) [-1094.368] (-1082.592) (-1084.157) * (-1085.642) (-1100.240) [-1093.648] (-1084.027) -- 0:01:14
39000 -- [-1083.862] (-1098.002) (-1083.696) (-1083.221) * (-1083.595) (-1095.498) (-1092.408) [-1082.385] -- 0:01:13
39500 -- [-1086.126] (-1091.580) (-1082.753) (-1083.071) * [-1083.652] (-1098.654) (-1091.593) (-1085.939) -- 0:01:12
40000 -- [-1084.533] (-1091.983) (-1082.697) (-1082.536) * [-1083.733] (-1095.861) (-1091.342) (-1084.325) -- 0:01:12
Average standard deviation of split frequencies: 0.045758
40500 -- (-1084.057) (-1088.947) (-1082.994) [-1083.099] * (-1085.265) (-1100.180) (-1097.317) [-1084.271] -- 0:01:11
41000 -- [-1083.428] (-1099.402) (-1089.492) (-1088.279) * [-1084.638] (-1095.872) (-1090.614) (-1086.626) -- 0:01:10
41500 -- (-1083.866) (-1095.259) [-1083.793] (-1084.283) * (-1084.910) (-1095.603) [-1090.492] (-1086.780) -- 0:01:09
42000 -- (-1082.410) (-1091.283) (-1084.162) [-1083.039] * (-1084.717) (-1093.861) [-1087.611] (-1082.613) -- 0:01:08
42500 -- (-1082.306) (-1097.607) [-1084.835] (-1083.245) * [-1085.924] (-1086.897) (-1093.215) (-1082.725) -- 0:01:07
43000 -- (-1083.257) [-1090.629] (-1086.490) (-1083.068) * [-1088.544] (-1090.401) (-1102.642) (-1083.029) -- 0:01:06
43500 -- (-1084.628) [-1094.706] (-1084.851) (-1083.291) * (-1086.886) [-1088.921] (-1087.628) (-1083.976) -- 0:01:27
44000 -- (-1085.078) (-1088.482) [-1082.960] (-1083.265) * (-1084.164) (-1088.307) [-1093.458] (-1083.584) -- 0:01:26
44500 -- [-1084.987] (-1094.711) (-1082.044) (-1083.595) * (-1085.524) (-1092.967) [-1093.414] (-1086.117) -- 0:01:25
45000 -- (-1085.182) (-1103.238) (-1085.175) [-1083.676] * (-1087.635) [-1088.136] (-1083.542) (-1084.907) -- 0:01:24
Average standard deviation of split frequencies: 0.044228
45500 -- (-1089.946) (-1090.231) (-1085.070) [-1084.748] * (-1085.034) [-1089.791] (-1084.453) (-1084.753) -- 0:01:23
46000 -- [-1084.093] (-1095.558) (-1084.177) (-1087.215) * (-1084.758) (-1094.269) [-1083.132] (-1085.785) -- 0:01:22
46500 -- (-1086.544) [-1089.614] (-1085.807) (-1086.454) * (-1084.758) (-1098.217) [-1082.160] (-1086.106) -- 0:01:22
47000 -- (-1085.756) [-1089.432] (-1087.084) (-1082.110) * (-1083.136) (-1094.948) [-1082.723] (-1084.076) -- 0:01:21
47500 -- (-1085.738) (-1098.273) [-1086.705] (-1084.456) * (-1083.703) (-1100.996) [-1081.872] (-1083.642) -- 0:01:20
48000 -- (-1084.523) (-1091.064) [-1085.773] (-1082.826) * (-1084.278) [-1089.680] (-1082.773) (-1082.687) -- 0:01:19
48500 -- (-1083.488) [-1092.803] (-1084.162) (-1083.437) * (-1086.072) (-1090.728) [-1085.696] (-1082.692) -- 0:01:18
49000 -- (-1084.055) (-1091.645) (-1086.628) [-1083.574] * (-1082.920) [-1093.804] (-1090.634) (-1082.162) -- 0:01:17
49500 -- (-1083.435) [-1087.785] (-1092.545) (-1081.612) * (-1088.078) (-1090.322) (-1082.841) [-1082.223] -- 0:01:16
50000 -- (-1085.157) [-1092.201] (-1083.975) (-1087.373) * (-1084.953) [-1087.848] (-1086.645) (-1083.429) -- 0:01:16
Average standard deviation of split frequencies: 0.048381
50500 -- (-1086.234) (-1090.690) [-1081.751] (-1086.925) * [-1082.325] (-1095.291) (-1087.393) (-1082.163) -- 0:01:15
51000 -- (-1086.630) [-1094.956] (-1083.047) (-1085.072) * [-1084.596] (-1098.432) (-1088.291) (-1082.697) -- 0:01:14
51500 -- [-1083.318] (-1093.541) (-1084.413) (-1083.433) * [-1083.380] (-1090.448) (-1086.045) (-1084.137) -- 0:01:13
52000 -- (-1083.927) [-1097.574] (-1087.379) (-1086.223) * (-1085.278) (-1092.799) [-1081.745] (-1083.202) -- 0:01:12
52500 -- (-1084.891) (-1090.845) [-1082.236] (-1087.023) * [-1085.249] (-1088.767) (-1083.129) (-1084.516) -- 0:01:12
53000 -- [-1085.374] (-1096.671) (-1082.234) (-1085.854) * (-1083.867) [-1093.373] (-1083.062) (-1088.344) -- 0:01:11
53500 -- [-1087.457] (-1091.038) (-1082.692) (-1084.595) * (-1086.439) (-1106.170) [-1084.172] (-1085.300) -- 0:01:10
54000 -- (-1086.556) [-1090.677] (-1083.758) (-1082.277) * (-1083.280) (-1095.635) (-1092.986) [-1082.313] -- 0:01:10
54500 -- (-1086.261) (-1095.762) (-1086.768) [-1083.969] * (-1083.095) (-1083.069) [-1084.893] (-1088.055) -- 0:01:09
55000 -- (-1083.782) (-1090.012) (-1086.107) [-1084.495] * (-1084.054) (-1082.929) (-1084.785) [-1086.341] -- 0:01:08
Average standard deviation of split frequencies: 0.045297
55500 -- [-1083.130] (-1093.998) (-1085.442) (-1084.000) * [-1083.635] (-1085.298) (-1085.592) (-1083.469) -- 0:01:08
56000 -- (-1087.920) (-1092.798) (-1084.862) [-1082.063] * (-1083.250) (-1084.363) (-1084.677) [-1082.767] -- 0:01:07
56500 -- (-1090.590) [-1090.896] (-1084.393) (-1084.297) * (-1087.102) [-1086.445] (-1084.540) (-1084.067) -- 0:01:06
57000 -- [-1083.020] (-1089.991) (-1087.143) (-1082.824) * (-1084.399) [-1083.921] (-1081.910) (-1083.805) -- 0:01:06
57500 -- (-1085.723) [-1088.109] (-1083.821) (-1083.723) * (-1083.454) (-1084.288) (-1082.916) [-1085.625] -- 0:01:05
58000 -- (-1086.416) [-1089.762] (-1083.727) (-1083.253) * [-1082.349] (-1083.668) (-1087.611) (-1084.204) -- 0:01:04
58500 -- (-1084.442) (-1093.202) (-1084.153) [-1083.693] * (-1083.808) (-1084.070) [-1085.368] (-1085.646) -- 0:01:20
59000 -- (-1084.532) [-1091.713] (-1088.307) (-1083.969) * (-1082.008) [-1084.422] (-1086.954) (-1085.231) -- 0:01:19
59500 -- (-1083.500) (-1103.000) [-1085.836] (-1083.105) * (-1082.392) [-1085.799] (-1085.460) (-1088.094) -- 0:01:19
60000 -- [-1082.554] (-1089.839) (-1085.194) (-1086.939) * (-1083.450) [-1084.316] (-1085.775) (-1083.419) -- 0:01:18
Average standard deviation of split frequencies: 0.036909
60500 -- [-1083.223] (-1088.523) (-1083.927) (-1086.700) * (-1083.216) (-1084.773) (-1081.783) [-1083.502] -- 0:01:17
61000 -- (-1085.207) (-1089.729) (-1087.744) [-1084.646] * (-1083.941) [-1085.541] (-1082.176) (-1084.049) -- 0:01:16
61500 -- (-1083.227) [-1095.766] (-1082.969) (-1087.262) * [-1084.919] (-1083.873) (-1081.951) (-1083.479) -- 0:01:16
62000 -- (-1085.897) (-1092.355) (-1082.388) [-1082.606] * (-1082.098) (-1084.369) [-1082.410] (-1083.249) -- 0:01:15
62500 -- (-1083.825) (-1092.704) (-1082.151) [-1082.743] * [-1082.688] (-1084.632) (-1083.902) (-1083.432) -- 0:01:15
63000 -- [-1083.749] (-1095.845) (-1084.193) (-1082.452) * (-1082.434) (-1083.950) (-1084.002) [-1083.476] -- 0:01:14
63500 -- (-1085.991) [-1089.575] (-1082.329) (-1082.624) * (-1083.014) (-1083.052) (-1082.146) [-1082.675] -- 0:01:13
64000 -- [-1082.849] (-1087.201) (-1085.683) (-1083.828) * (-1087.482) (-1083.176) (-1081.897) [-1082.683] -- 0:01:13
64500 -- (-1085.431) [-1089.087] (-1092.528) (-1084.605) * (-1086.600) [-1082.914] (-1082.165) (-1082.334) -- 0:01:12
65000 -- (-1083.024) [-1090.293] (-1088.961) (-1084.531) * (-1082.020) (-1083.481) (-1081.798) [-1083.616] -- 0:01:11
Average standard deviation of split frequencies: 0.033332
65500 -- (-1083.513) (-1094.190) (-1085.829) [-1086.348] * [-1082.422] (-1082.496) (-1084.624) (-1085.966) -- 0:01:11
66000 -- (-1084.671) (-1094.577) [-1091.355] (-1083.170) * (-1083.054) (-1083.546) [-1086.433] (-1086.632) -- 0:01:10
66500 -- (-1083.064) (-1094.387) [-1085.901] (-1083.444) * (-1082.904) [-1082.950] (-1087.460) (-1083.234) -- 0:01:10
67000 -- [-1083.532] (-1090.290) (-1089.749) (-1085.433) * [-1083.614] (-1083.768) (-1084.605) (-1084.127) -- 0:01:09
67500 -- (-1084.840) (-1093.296) (-1085.513) [-1085.708] * (-1083.132) (-1086.235) [-1085.425] (-1083.288) -- 0:01:09
68000 -- (-1082.485) [-1089.160] (-1083.870) (-1089.554) * (-1083.858) [-1085.538] (-1087.447) (-1083.386) -- 0:01:08
68500 -- [-1082.955] (-1092.208) (-1081.891) (-1086.612) * [-1081.954] (-1089.394) (-1083.378) (-1083.634) -- 0:01:07
69000 -- [-1082.174] (-1091.043) (-1082.509) (-1090.203) * (-1083.176) (-1084.381) (-1083.002) [-1084.814] -- 0:01:07
69500 -- [-1083.229] (-1093.189) (-1083.330) (-1085.693) * (-1085.249) (-1086.341) [-1084.363] (-1086.370) -- 0:01:06
70000 -- [-1084.393] (-1096.881) (-1088.857) (-1085.239) * (-1083.948) (-1085.131) (-1086.029) [-1082.936] -- 0:01:06
Average standard deviation of split frequencies: 0.034625
70500 -- (-1082.095) (-1101.194) (-1083.150) [-1084.062] * (-1082.920) (-1088.603) (-1084.789) [-1083.580] -- 0:01:05
71000 -- (-1084.405) (-1087.960) (-1085.052) [-1082.246] * [-1083.516] (-1084.555) (-1085.288) (-1083.834) -- 0:01:05
71500 -- (-1087.223) (-1086.860) (-1083.586) [-1083.865] * [-1086.896] (-1085.016) (-1085.950) (-1082.799) -- 0:01:04
72000 -- (-1084.814) (-1083.302) (-1085.688) [-1082.022] * (-1085.369) (-1083.596) [-1082.730] (-1085.017) -- 0:01:04
72500 -- (-1083.191) (-1087.292) (-1088.910) [-1083.618] * [-1083.981] (-1084.820) (-1085.953) (-1084.742) -- 0:01:03
73000 -- (-1088.313) (-1084.721) (-1082.756) [-1083.423] * (-1083.148) (-1086.759) (-1083.143) [-1083.290] -- 0:01:03
73500 -- (-1083.792) (-1083.151) (-1085.849) [-1083.160] * (-1083.807) (-1083.342) (-1086.749) [-1083.858] -- 0:01:03
74000 -- (-1084.956) [-1081.650] (-1087.527) (-1083.130) * (-1082.577) (-1082.030) (-1088.039) [-1084.109] -- 0:01:15
74500 -- (-1083.803) (-1081.656) (-1083.175) [-1084.439] * (-1082.778) (-1082.109) [-1086.304] (-1084.238) -- 0:01:14
75000 -- (-1083.925) (-1081.628) (-1083.479) [-1085.188] * [-1082.416] (-1083.109) (-1087.820) (-1083.978) -- 0:01:14
Average standard deviation of split frequencies: 0.034735
75500 -- (-1085.496) (-1082.032) [-1082.764] (-1084.394) * (-1083.026) [-1081.704] (-1087.741) (-1087.029) -- 0:01:13
76000 -- [-1082.426] (-1083.644) (-1084.704) (-1083.843) * (-1084.885) (-1083.253) (-1090.745) [-1083.897] -- 0:01:12
76500 -- [-1085.242] (-1083.543) (-1084.378) (-1084.424) * [-1084.440] (-1082.745) (-1084.931) (-1087.099) -- 0:01:12
77000 -- (-1081.908) (-1084.666) (-1082.969) [-1082.769] * [-1084.803] (-1083.141) (-1086.600) (-1084.378) -- 0:01:11
77500 -- (-1082.966) [-1084.781] (-1082.437) (-1083.927) * (-1082.524) [-1082.041] (-1083.418) (-1086.293) -- 0:01:11
78000 -- (-1082.905) (-1084.452) (-1083.017) [-1085.353] * [-1083.796] (-1086.221) (-1086.138) (-1085.771) -- 0:01:10
78500 -- (-1082.924) (-1082.915) [-1082.974] (-1086.036) * (-1084.794) (-1085.644) [-1085.501] (-1086.602) -- 0:01:10
79000 -- (-1082.541) (-1081.904) (-1084.080) [-1083.271] * (-1082.388) [-1086.168] (-1087.135) (-1084.168) -- 0:01:09
79500 -- (-1086.102) (-1085.292) [-1086.801] (-1084.680) * (-1082.845) (-1085.265) (-1083.917) [-1082.216] -- 0:01:09
80000 -- [-1084.603] (-1085.303) (-1087.270) (-1084.643) * (-1083.080) [-1088.794] (-1083.630) (-1083.082) -- 0:01:09
Average standard deviation of split frequencies: 0.033833
80500 -- [-1083.053] (-1085.095) (-1085.396) (-1084.409) * [-1082.869] (-1083.123) (-1085.242) (-1085.253) -- 0:01:08
81000 -- (-1087.453) (-1086.707) (-1083.890) [-1084.781] * (-1084.562) (-1086.638) (-1085.341) [-1082.939] -- 0:01:08
81500 -- (-1089.291) (-1085.569) [-1082.945] (-1085.193) * (-1085.595) (-1088.788) (-1082.363) [-1085.624] -- 0:01:07
82000 -- (-1089.158) (-1085.982) [-1082.817] (-1083.637) * [-1083.199] (-1088.090) (-1082.398) (-1086.068) -- 0:01:07
82500 -- (-1088.560) [-1085.140] (-1082.790) (-1088.518) * [-1083.867] (-1086.433) (-1082.444) (-1086.230) -- 0:01:06
83000 -- (-1084.952) (-1083.696) [-1082.964] (-1084.406) * [-1083.776] (-1084.489) (-1082.358) (-1086.221) -- 0:01:06
83500 -- (-1084.409) (-1081.971) [-1082.640] (-1083.932) * (-1085.368) (-1082.944) [-1083.452] (-1084.969) -- 0:01:05
84000 -- (-1084.664) (-1085.825) [-1084.350] (-1087.241) * (-1082.225) (-1082.050) (-1087.154) [-1085.741] -- 0:01:05
84500 -- (-1085.383) (-1082.729) [-1086.140] (-1085.514) * [-1083.857] (-1085.319) (-1087.138) (-1083.344) -- 0:01:05
85000 -- (-1083.859) (-1083.041) (-1087.528) [-1084.317] * (-1084.842) (-1081.826) (-1083.742) [-1085.443] -- 0:01:04
Average standard deviation of split frequencies: 0.031062
85500 -- (-1087.433) [-1083.309] (-1087.954) (-1085.779) * (-1083.286) [-1082.741] (-1084.917) (-1087.238) -- 0:01:04
86000 -- (-1085.979) (-1087.301) [-1082.544] (-1083.565) * [-1084.033] (-1084.711) (-1083.732) (-1087.658) -- 0:01:03
86500 -- (-1082.585) (-1082.266) (-1082.959) [-1082.722] * (-1084.020) (-1082.415) (-1087.944) [-1090.708] -- 0:01:03
87000 -- (-1082.021) [-1082.518] (-1085.209) (-1082.426) * (-1084.732) [-1083.081] (-1086.285) (-1090.570) -- 0:01:02
87500 -- [-1082.945] (-1086.459) (-1088.091) (-1083.550) * (-1082.686) (-1084.108) (-1082.373) [-1087.609] -- 0:01:02
88000 -- (-1083.095) (-1085.841) (-1085.138) [-1084.972] * [-1082.266] (-1083.256) (-1082.727) (-1085.860) -- 0:01:02
88500 -- (-1083.605) [-1083.487] (-1087.106) (-1085.325) * (-1081.892) (-1083.066) [-1081.759] (-1084.343) -- 0:01:01
89000 -- [-1083.667] (-1083.375) (-1085.699) (-1084.412) * [-1082.122] (-1084.142) (-1083.487) (-1084.918) -- 0:01:01
89500 -- (-1083.814) (-1083.039) [-1082.592] (-1087.338) * (-1083.520) [-1084.418] (-1083.259) (-1085.659) -- 0:01:01
90000 -- (-1083.332) [-1084.865] (-1082.587) (-1083.469) * [-1083.811] (-1084.105) (-1083.525) (-1084.053) -- 0:01:10
Average standard deviation of split frequencies: 0.029710
90500 -- [-1082.905] (-1085.770) (-1082.103) (-1083.351) * (-1085.555) (-1085.148) [-1083.082] (-1083.855) -- 0:01:10
91000 -- (-1083.071) [-1082.775] (-1085.246) (-1082.312) * (-1089.092) (-1088.743) [-1082.579] (-1087.294) -- 0:01:09
91500 -- [-1084.700] (-1087.908) (-1087.623) (-1082.544) * [-1084.919] (-1083.693) (-1083.182) (-1087.003) -- 0:01:09
92000 -- (-1086.687) [-1083.009] (-1086.054) (-1082.592) * (-1082.914) [-1081.865] (-1087.463) (-1085.702) -- 0:01:09
92500 -- (-1086.851) [-1085.783] (-1084.268) (-1083.370) * (-1083.381) [-1081.695] (-1084.141) (-1085.970) -- 0:01:08
93000 -- [-1083.641] (-1083.518) (-1082.781) (-1087.063) * (-1086.221) (-1084.328) (-1084.899) [-1083.433] -- 0:01:08
93500 -- [-1082.716] (-1084.725) (-1084.143) (-1088.096) * (-1086.109) (-1085.055) [-1083.379] (-1082.218) -- 0:01:07
94000 -- [-1083.308] (-1083.078) (-1084.854) (-1082.894) * (-1084.179) (-1083.829) [-1082.671] (-1082.987) -- 0:01:07
94500 -- (-1084.213) (-1083.108) (-1082.479) [-1083.123] * [-1083.038] (-1082.499) (-1083.360) (-1082.774) -- 0:01:07
95000 -- [-1083.159] (-1082.928) (-1082.851) (-1082.655) * (-1084.081) (-1086.404) [-1086.463] (-1084.108) -- 0:01:06
Average standard deviation of split frequencies: 0.029217
95500 -- (-1082.941) (-1086.372) (-1082.671) [-1082.894] * [-1083.549] (-1088.679) (-1088.838) (-1083.714) -- 0:01:06
96000 -- (-1083.348) (-1083.801) (-1084.112) [-1083.476] * (-1082.766) (-1083.045) (-1086.153) [-1084.214] -- 0:01:05
96500 -- (-1087.047) (-1084.910) (-1084.844) [-1082.411] * [-1082.702] (-1084.291) (-1084.982) (-1083.570) -- 0:01:05
97000 -- (-1084.255) [-1084.276] (-1085.137) (-1083.717) * (-1083.012) [-1083.560] (-1086.367) (-1082.298) -- 0:01:05
97500 -- (-1084.024) (-1082.857) (-1083.570) [-1082.604] * [-1085.059] (-1083.608) (-1088.325) (-1082.819) -- 0:01:04
98000 -- (-1085.853) (-1083.008) [-1082.823] (-1083.321) * (-1084.230) (-1082.697) (-1088.792) [-1082.719] -- 0:01:04
98500 -- (-1083.356) (-1084.553) (-1085.096) [-1083.187] * (-1084.843) [-1082.655] (-1087.867) (-1082.412) -- 0:01:04
99000 -- (-1085.716) (-1084.880) (-1082.869) [-1083.161] * [-1082.008] (-1082.620) (-1086.060) (-1083.808) -- 0:01:03
99500 -- (-1088.163) [-1083.502] (-1082.246) (-1083.580) * [-1082.480] (-1083.476) (-1084.812) (-1084.845) -- 0:01:03
100000 -- (-1085.872) [-1084.450] (-1083.483) (-1084.360) * (-1083.213) (-1082.453) (-1085.088) [-1085.428] -- 0:01:02
Average standard deviation of split frequencies: 0.029881
100500 -- (-1083.145) (-1083.001) [-1083.250] (-1083.673) * (-1090.335) [-1084.532] (-1087.813) (-1083.239) -- 0:01:02
101000 -- [-1083.802] (-1084.283) (-1083.856) (-1082.947) * (-1089.426) (-1084.060) (-1085.344) [-1084.051] -- 0:01:02
101500 -- (-1085.908) [-1083.772] (-1086.060) (-1083.591) * (-1083.426) (-1083.842) [-1084.477] (-1084.701) -- 0:01:01
102000 -- (-1085.648) [-1083.923] (-1087.356) (-1084.345) * [-1083.284] (-1084.969) (-1084.562) (-1085.952) -- 0:01:01
102500 -- (-1081.991) [-1084.584] (-1085.204) (-1089.669) * (-1082.330) [-1084.350] (-1083.940) (-1086.071) -- 0:01:01
103000 -- (-1082.153) (-1084.700) [-1084.645] (-1086.538) * [-1084.586] (-1083.953) (-1084.935) (-1084.867) -- 0:01:00
103500 -- [-1082.028] (-1086.630) (-1082.376) (-1085.227) * (-1085.191) (-1083.323) (-1084.630) [-1082.038] -- 0:01:00
104000 -- (-1082.883) (-1090.138) (-1082.831) [-1082.821] * [-1084.515] (-1083.037) (-1083.882) (-1083.684) -- 0:01:00
104500 -- (-1082.411) (-1085.237) (-1082.793) [-1083.189] * (-1084.167) (-1085.272) (-1086.784) [-1083.229] -- 0:00:59
105000 -- (-1083.473) (-1085.235) [-1082.721] (-1084.373) * (-1082.536) (-1086.933) [-1084.360] (-1082.432) -- 0:00:59
Average standard deviation of split frequencies: 0.029013
105500 -- (-1082.894) [-1088.963] (-1082.456) (-1084.020) * (-1083.604) [-1085.258] (-1082.960) (-1083.455) -- 0:00:59
106000 -- [-1082.954] (-1087.698) (-1085.106) (-1085.089) * (-1082.681) (-1083.191) (-1083.849) [-1084.892] -- 0:01:07
106500 -- [-1082.697] (-1082.524) (-1088.961) (-1086.045) * (-1084.262) [-1083.759] (-1082.596) (-1085.419) -- 0:01:07
107000 -- (-1082.268) (-1083.209) (-1087.734) [-1082.392] * (-1090.799) (-1092.114) [-1082.240] (-1083.297) -- 0:01:06
107500 -- [-1083.241] (-1082.916) (-1089.351) (-1082.099) * [-1087.515] (-1088.372) (-1083.135) (-1084.664) -- 0:01:06
108000 -- [-1084.058] (-1089.907) (-1088.555) (-1082.298) * (-1091.732) (-1084.952) [-1083.630] (-1087.561) -- 0:01:06
108500 -- (-1083.012) (-1082.455) [-1082.673] (-1082.552) * (-1084.541) [-1083.353] (-1084.178) (-1088.410) -- 0:01:05
109000 -- (-1083.749) (-1082.913) [-1082.072] (-1089.721) * (-1082.782) [-1086.608] (-1084.332) (-1087.369) -- 0:01:05
109500 -- (-1083.891) (-1085.846) (-1081.883) [-1082.793] * (-1082.275) (-1086.021) (-1084.257) [-1082.307] -- 0:01:05
110000 -- (-1083.527) [-1085.485] (-1082.941) (-1082.667) * (-1086.559) (-1084.065) (-1084.820) [-1082.180] -- 0:01:04
Average standard deviation of split frequencies: 0.030629
110500 -- [-1084.531] (-1084.214) (-1083.610) (-1082.267) * (-1084.099) (-1083.654) [-1083.058] (-1083.976) -- 0:01:04
111000 -- (-1083.667) (-1081.932) [-1085.402] (-1085.354) * (-1081.994) (-1082.884) [-1083.763] (-1084.610) -- 0:01:04
111500 -- (-1083.748) (-1083.524) [-1084.186] (-1085.108) * [-1085.216] (-1085.378) (-1082.326) (-1083.151) -- 0:01:03
112000 -- (-1083.964) (-1084.724) [-1083.994] (-1084.477) * (-1084.902) (-1082.980) [-1084.311] (-1083.806) -- 0:01:03
112500 -- [-1084.394] (-1082.011) (-1085.826) (-1088.989) * (-1082.036) [-1089.475] (-1083.521) (-1084.202) -- 0:01:03
113000 -- (-1086.039) [-1082.620] (-1084.447) (-1084.030) * (-1084.517) (-1083.586) (-1086.848) [-1085.277] -- 0:01:02
113500 -- (-1083.751) (-1085.746) (-1083.450) [-1083.710] * [-1083.792] (-1082.595) (-1083.286) (-1085.197) -- 0:01:02
114000 -- (-1083.782) (-1086.834) [-1085.595] (-1085.810) * (-1083.538) (-1083.290) (-1086.967) [-1085.095] -- 0:01:02
114500 -- (-1083.681) [-1084.116] (-1083.310) (-1084.686) * [-1084.384] (-1083.216) (-1084.580) (-1083.195) -- 0:01:01
115000 -- (-1084.060) (-1094.361) [-1082.853] (-1089.454) * (-1082.899) (-1082.250) (-1083.416) [-1083.443] -- 0:01:01
Average standard deviation of split frequencies: 0.031543
115500 -- (-1085.382) (-1085.317) [-1082.972] (-1088.288) * (-1085.618) [-1082.314] (-1082.910) (-1084.997) -- 0:01:01
116000 -- (-1084.954) (-1085.634) [-1084.755] (-1088.728) * (-1085.363) (-1082.310) [-1084.800] (-1083.748) -- 0:01:00
116500 -- [-1085.086] (-1083.560) (-1088.150) (-1084.644) * [-1084.503] (-1082.668) (-1081.777) (-1087.882) -- 0:01:00
117000 -- (-1086.539) (-1082.270) (-1091.302) [-1082.575] * [-1084.046] (-1085.064) (-1084.230) (-1089.236) -- 0:01:00
117500 -- (-1085.639) (-1085.406) [-1085.300] (-1083.861) * (-1082.682) [-1086.776] (-1085.681) (-1082.735) -- 0:01:00
118000 -- (-1085.011) (-1083.449) [-1086.112] (-1082.596) * (-1082.324) [-1084.278] (-1088.183) (-1082.839) -- 0:00:59
118500 -- (-1083.651) (-1083.572) [-1086.597] (-1085.483) * (-1086.497) [-1086.669] (-1084.293) (-1085.186) -- 0:00:59
119000 -- (-1086.116) (-1082.570) [-1084.953] (-1084.405) * (-1084.573) (-1086.898) [-1083.084] (-1082.661) -- 0:00:59
119500 -- (-1083.490) [-1085.462] (-1082.825) (-1086.976) * [-1084.244] (-1082.449) (-1082.903) (-1084.127) -- 0:00:58
120000 -- (-1083.573) (-1087.248) [-1083.819] (-1087.085) * (-1083.525) [-1083.729] (-1083.055) (-1090.395) -- 0:00:58
Average standard deviation of split frequencies: 0.029021
120500 -- [-1083.625] (-1088.690) (-1082.424) (-1082.751) * [-1082.854] (-1084.153) (-1082.596) (-1085.578) -- 0:00:58
121000 -- (-1081.697) [-1082.881] (-1085.504) (-1084.615) * (-1084.508) (-1082.123) [-1082.339] (-1084.634) -- 0:00:58
121500 -- [-1083.218] (-1081.650) (-1084.362) (-1085.904) * (-1085.579) [-1082.067] (-1084.157) (-1086.106) -- 0:00:57
122000 -- (-1083.182) (-1084.211) [-1083.449] (-1086.852) * (-1085.678) (-1083.039) [-1084.675] (-1085.100) -- 0:00:57
122500 -- (-1082.327) (-1084.083) [-1083.548] (-1085.163) * [-1083.989] (-1082.259) (-1084.770) (-1084.859) -- 0:01:04
123000 -- (-1086.589) [-1083.426] (-1086.771) (-1089.924) * (-1087.490) [-1089.949] (-1085.462) (-1085.394) -- 0:01:04
123500 -- [-1082.820] (-1085.600) (-1083.000) (-1085.086) * (-1086.406) [-1083.363] (-1083.070) (-1086.482) -- 0:01:03
124000 -- (-1083.884) [-1087.872] (-1084.663) (-1083.726) * (-1086.666) [-1083.404] (-1083.117) (-1082.881) -- 0:01:03
124500 -- [-1083.218] (-1081.920) (-1084.300) (-1084.125) * (-1083.316) (-1085.125) [-1083.010] (-1082.902) -- 0:01:03
125000 -- [-1081.787] (-1083.930) (-1082.869) (-1084.177) * (-1081.605) (-1086.470) (-1082.197) [-1082.292] -- 0:01:03
Average standard deviation of split frequencies: 0.027080
125500 -- [-1082.761] (-1083.930) (-1083.938) (-1083.502) * [-1082.410] (-1090.410) (-1082.152) (-1083.679) -- 0:01:02
126000 -- (-1083.044) (-1086.906) (-1083.126) [-1083.576] * (-1084.730) (-1090.835) (-1082.584) [-1083.717] -- 0:01:02
126500 -- [-1081.667] (-1082.777) (-1086.849) (-1085.325) * (-1085.832) (-1083.349) (-1085.764) [-1082.827] -- 0:01:02
127000 -- [-1081.667] (-1084.176) (-1082.422) (-1084.063) * (-1082.860) [-1082.332] (-1083.506) (-1083.341) -- 0:01:01
127500 -- (-1082.613) [-1085.318] (-1082.022) (-1084.861) * (-1083.232) (-1085.875) (-1084.711) [-1084.273] -- 0:01:01
128000 -- [-1083.081] (-1086.308) (-1081.855) (-1083.016) * [-1084.474] (-1085.292) (-1087.781) (-1084.885) -- 0:01:01
128500 -- [-1082.012] (-1083.316) (-1082.382) (-1082.544) * (-1085.005) (-1086.024) (-1084.521) [-1084.884] -- 0:01:01
129000 -- (-1082.600) (-1086.118) [-1082.366] (-1082.072) * [-1084.597] (-1087.822) (-1084.357) (-1083.591) -- 0:01:00
129500 -- (-1082.445) (-1088.470) [-1082.904] (-1085.006) * (-1088.215) (-1089.022) (-1083.759) [-1083.024] -- 0:01:00
130000 -- (-1086.942) (-1081.834) (-1087.643) [-1084.967] * [-1087.650] (-1086.490) (-1083.943) (-1084.822) -- 0:01:00
Average standard deviation of split frequencies: 0.026285
130500 -- (-1082.416) (-1084.018) (-1087.871) [-1083.041] * (-1088.033) (-1084.324) [-1083.049] (-1084.955) -- 0:00:59
131000 -- (-1083.556) (-1084.599) (-1088.694) [-1083.931] * (-1085.517) (-1083.552) [-1083.184] (-1081.758) -- 0:00:59
131500 -- [-1083.401] (-1084.342) (-1085.408) (-1083.854) * (-1082.866) (-1084.319) (-1085.125) [-1084.607] -- 0:00:59
132000 -- [-1083.668] (-1084.307) (-1084.162) (-1084.516) * (-1082.452) (-1084.282) (-1084.037) [-1082.337] -- 0:00:59
132500 -- (-1085.459) (-1082.819) (-1084.652) [-1083.109] * [-1082.365] (-1086.500) (-1085.346) (-1084.292) -- 0:00:58
133000 -- (-1083.646) (-1085.287) [-1084.025] (-1082.304) * (-1085.625) (-1083.134) [-1082.718] (-1083.870) -- 0:00:58
133500 -- [-1081.718] (-1088.415) (-1082.796) (-1082.221) * (-1085.852) (-1085.141) [-1084.007] (-1083.135) -- 0:00:58
134000 -- (-1082.167) [-1084.916] (-1083.450) (-1082.221) * (-1087.425) [-1083.570] (-1083.553) (-1083.814) -- 0:00:58
134500 -- (-1083.385) (-1085.490) (-1083.392) [-1082.136] * [-1082.407] (-1083.060) (-1082.796) (-1083.740) -- 0:00:57
135000 -- [-1084.362] (-1082.496) (-1085.738) (-1082.641) * (-1082.371) [-1083.173] (-1086.186) (-1084.484) -- 0:00:57
Average standard deviation of split frequencies: 0.026863
135500 -- (-1087.054) [-1086.853] (-1086.305) (-1082.533) * (-1084.254) (-1082.863) [-1087.240] (-1082.353) -- 0:00:57
136000 -- (-1083.107) [-1086.975] (-1085.279) (-1086.340) * [-1082.845] (-1090.147) (-1084.025) (-1082.984) -- 0:00:57
136500 -- [-1082.795] (-1084.484) (-1084.975) (-1086.378) * (-1082.941) (-1085.225) [-1085.715] (-1089.143) -- 0:00:56
137000 -- (-1085.509) [-1083.758] (-1085.165) (-1083.584) * (-1083.133) [-1083.286] (-1085.615) (-1083.907) -- 0:00:56
137500 -- (-1086.106) (-1083.682) (-1085.649) [-1082.409] * (-1082.880) (-1083.350) (-1082.897) [-1084.933] -- 0:00:56
138000 -- (-1085.936) (-1083.511) [-1087.253] (-1082.072) * (-1083.863) (-1084.808) [-1085.671] (-1083.952) -- 0:00:56
138500 -- (-1084.268) (-1085.060) (-1085.453) [-1082.778] * (-1082.998) [-1083.901] (-1084.107) (-1087.536) -- 0:00:55
139000 -- (-1083.975) (-1084.763) [-1085.753] (-1083.347) * (-1083.084) [-1082.827] (-1082.685) (-1085.120) -- 0:01:01
139500 -- (-1083.806) (-1084.887) [-1084.767] (-1083.092) * (-1083.764) (-1083.276) [-1085.285] (-1083.322) -- 0:01:01
140000 -- (-1082.955) (-1084.586) [-1084.384] (-1082.775) * (-1083.527) [-1082.764] (-1083.541) (-1086.344) -- 0:01:01
Average standard deviation of split frequencies: 0.026810
140500 -- [-1083.872] (-1083.812) (-1085.662) (-1083.598) * [-1082.396] (-1082.792) (-1082.882) (-1083.319) -- 0:01:01
141000 -- [-1081.875] (-1086.521) (-1088.669) (-1086.173) * (-1082.377) (-1084.307) [-1083.598] (-1083.641) -- 0:01:00
141500 -- [-1081.882] (-1086.954) (-1085.578) (-1083.187) * [-1082.885] (-1082.929) (-1089.621) (-1083.243) -- 0:01:00
142000 -- (-1083.795) [-1084.875] (-1087.113) (-1083.407) * (-1085.961) (-1082.766) (-1082.862) [-1082.892] -- 0:01:00
142500 -- (-1085.213) [-1090.405] (-1085.008) (-1083.129) * (-1083.581) [-1082.000] (-1082.644) (-1084.445) -- 0:01:00
143000 -- [-1083.152] (-1085.427) (-1084.605) (-1083.312) * (-1083.580) [-1082.869] (-1082.469) (-1085.868) -- 0:00:59
143500 -- [-1082.379] (-1084.508) (-1084.608) (-1083.619) * (-1083.198) (-1085.186) [-1082.578] (-1089.575) -- 0:00:59
144000 -- [-1083.400] (-1082.968) (-1082.932) (-1085.648) * (-1081.917) (-1082.860) [-1084.223] (-1084.017) -- 0:00:59
144500 -- (-1083.490) [-1082.389] (-1089.315) (-1087.793) * (-1082.154) (-1083.942) (-1086.803) [-1082.525] -- 0:00:59
145000 -- (-1085.700) (-1081.882) (-1087.057) [-1084.588] * [-1083.014] (-1086.506) (-1084.448) (-1082.917) -- 0:00:58
Average standard deviation of split frequencies: 0.025830
145500 -- (-1086.530) [-1085.253] (-1085.512) (-1085.994) * (-1082.777) [-1085.283] (-1084.783) (-1084.706) -- 0:00:58
146000 -- (-1087.336) [-1081.964] (-1087.786) (-1082.486) * (-1085.906) (-1085.701) [-1088.297] (-1083.283) -- 0:00:58
146500 -- [-1083.097] (-1087.292) (-1084.679) (-1082.593) * (-1085.581) (-1084.389) [-1090.254] (-1083.309) -- 0:00:58
147000 -- (-1085.851) (-1089.608) [-1082.845] (-1084.204) * (-1083.064) (-1085.769) (-1088.613) [-1086.306] -- 0:00:58
147500 -- (-1083.688) (-1087.775) (-1083.112) [-1082.934] * (-1083.063) (-1083.137) [-1083.179] (-1089.272) -- 0:00:57
148000 -- (-1082.891) (-1086.567) [-1083.375] (-1083.113) * [-1081.927] (-1082.312) (-1084.928) (-1086.546) -- 0:00:57
148500 -- (-1083.285) (-1084.596) (-1082.912) [-1084.597] * [-1081.829] (-1084.749) (-1084.063) (-1083.267) -- 0:00:57
149000 -- [-1082.762] (-1087.432) (-1084.606) (-1084.057) * (-1082.581) (-1083.313) (-1082.904) [-1083.613] -- 0:00:57
149500 -- [-1083.045] (-1086.532) (-1085.535) (-1084.837) * (-1083.518) [-1086.745] (-1083.077) (-1086.703) -- 0:00:56
150000 -- (-1083.495) (-1084.629) (-1085.434) [-1082.255] * [-1083.497] (-1085.031) (-1082.225) (-1084.301) -- 0:00:56
Average standard deviation of split frequencies: 0.025500
150500 -- (-1083.159) (-1089.669) (-1087.288) [-1087.530] * (-1081.685) (-1084.106) (-1083.712) [-1082.195] -- 0:00:56
151000 -- (-1083.083) (-1085.197) (-1087.905) [-1085.346] * [-1081.685] (-1083.156) (-1084.522) (-1083.463) -- 0:00:56
151500 -- [-1083.049] (-1083.518) (-1084.184) (-1086.070) * (-1083.425) (-1083.234) [-1085.541] (-1083.826) -- 0:00:56
152000 -- (-1082.788) [-1083.963] (-1084.498) (-1086.434) * [-1084.574] (-1085.580) (-1087.311) (-1083.274) -- 0:00:55
152500 -- (-1082.950) (-1084.387) (-1084.120) [-1082.818] * [-1083.843] (-1084.362) (-1084.106) (-1082.944) -- 0:00:55
153000 -- [-1084.341] (-1085.612) (-1083.366) (-1083.800) * [-1083.446] (-1084.175) (-1086.472) (-1082.133) -- 0:00:55
153500 -- (-1082.610) [-1086.404] (-1084.070) (-1083.754) * (-1082.707) (-1083.340) (-1084.792) [-1082.976] -- 0:00:55
154000 -- (-1083.927) (-1084.899) (-1082.479) [-1084.508] * (-1083.877) (-1082.875) [-1082.049] (-1087.824) -- 0:00:54
154500 -- (-1086.066) (-1083.776) [-1082.152] (-1085.607) * (-1084.189) [-1084.530] (-1081.987) (-1082.474) -- 0:00:54
155000 -- (-1083.974) (-1083.714) [-1084.059] (-1084.846) * [-1083.096] (-1084.633) (-1083.772) (-1083.694) -- 0:00:54
Average standard deviation of split frequencies: 0.025447
155500 -- (-1085.329) [-1082.299] (-1085.571) (-1085.404) * (-1083.207) (-1086.308) [-1082.824] (-1085.175) -- 0:00:59
156000 -- (-1084.031) [-1084.103] (-1084.956) (-1086.864) * [-1084.093] (-1083.827) (-1083.539) (-1083.347) -- 0:00:59
156500 -- [-1082.141] (-1083.216) (-1085.477) (-1088.093) * (-1083.635) (-1082.660) [-1084.593] (-1084.033) -- 0:00:59
157000 -- (-1082.141) (-1083.564) (-1085.383) [-1086.459] * (-1088.986) (-1088.953) [-1084.845] (-1085.867) -- 0:00:59
157500 -- [-1082.712] (-1083.242) (-1086.004) (-1085.234) * (-1089.710) [-1085.681] (-1083.337) (-1091.131) -- 0:00:58
158000 -- (-1082.900) (-1084.692) (-1083.936) [-1085.622] * (-1087.007) (-1084.598) (-1085.420) [-1083.998] -- 0:00:58
158500 -- (-1082.099) [-1083.263] (-1083.557) (-1082.784) * (-1084.765) [-1084.894] (-1083.827) (-1084.615) -- 0:00:58
159000 -- [-1084.003] (-1084.621) (-1082.139) (-1083.552) * (-1084.006) (-1083.515) [-1084.696] (-1083.965) -- 0:00:58
159500 -- (-1083.138) [-1085.600] (-1084.756) (-1083.764) * (-1085.677) [-1086.313] (-1088.158) (-1083.348) -- 0:00:57
160000 -- (-1086.161) (-1084.554) [-1083.730] (-1086.645) * (-1086.124) (-1084.473) [-1085.325] (-1084.996) -- 0:00:57
Average standard deviation of split frequencies: 0.023766
160500 -- [-1085.605] (-1086.350) (-1082.843) (-1086.449) * [-1087.121] (-1083.212) (-1082.357) (-1083.723) -- 0:00:57
161000 -- [-1084.557] (-1082.146) (-1083.872) (-1090.233) * (-1085.713) (-1083.088) (-1087.141) [-1084.325] -- 0:00:57
161500 -- (-1090.386) (-1082.146) [-1083.100] (-1084.152) * (-1089.107) [-1083.452] (-1084.980) (-1085.604) -- 0:00:57
162000 -- (-1086.391) [-1082.116] (-1090.634) (-1082.688) * (-1083.227) (-1087.785) (-1084.259) [-1084.564] -- 0:00:56
162500 -- (-1085.763) [-1082.119] (-1087.952) (-1082.188) * [-1081.726] (-1086.272) (-1084.254) (-1084.216) -- 0:00:56
163000 -- (-1083.359) (-1082.330) [-1082.992] (-1087.350) * [-1081.655] (-1082.975) (-1083.992) (-1082.219) -- 0:00:56
163500 -- (-1083.475) (-1084.207) [-1084.650] (-1083.436) * [-1081.792] (-1081.805) (-1083.403) (-1085.382) -- 0:00:56
164000 -- (-1083.678) (-1083.473) (-1083.658) [-1086.860] * [-1081.789] (-1082.179) (-1083.418) (-1081.792) -- 0:00:56
164500 -- [-1082.255] (-1085.676) (-1081.996) (-1085.069) * [-1082.455] (-1082.099) (-1083.355) (-1083.154) -- 0:00:55
165000 -- (-1083.759) (-1086.059) [-1082.326] (-1084.940) * (-1082.134) (-1083.925) [-1081.771] (-1082.180) -- 0:00:55
Average standard deviation of split frequencies: 0.023286
165500 -- (-1087.404) (-1082.567) [-1083.145] (-1083.867) * (-1084.010) (-1083.954) (-1084.571) [-1083.274] -- 0:00:55
166000 -- (-1084.173) [-1083.402] (-1084.830) (-1088.040) * (-1083.978) (-1083.578) [-1083.639] (-1083.628) -- 0:00:55
166500 -- (-1085.763) [-1085.047] (-1083.593) (-1084.451) * [-1083.801] (-1082.876) (-1086.805) (-1081.920) -- 0:00:55
167000 -- (-1083.610) [-1084.656] (-1085.135) (-1084.689) * (-1083.652) [-1085.277] (-1083.792) (-1085.013) -- 0:00:54
167500 -- [-1083.221] (-1085.443) (-1082.131) (-1084.060) * (-1084.124) (-1088.709) (-1084.025) [-1082.945] -- 0:00:54
168000 -- [-1082.446] (-1086.342) (-1084.326) (-1082.098) * (-1084.439) [-1082.351] (-1083.827) (-1084.079) -- 0:00:54
168500 -- (-1083.590) (-1082.847) [-1082.355] (-1084.649) * (-1084.555) [-1083.562] (-1082.777) (-1084.329) -- 0:00:54
169000 -- [-1081.873] (-1083.678) (-1082.410) (-1084.935) * (-1083.442) [-1082.366] (-1082.928) (-1083.827) -- 0:00:54
169500 -- (-1084.127) (-1085.703) [-1085.673] (-1081.882) * (-1084.333) (-1085.471) (-1084.551) [-1084.086] -- 0:00:53
170000 -- (-1083.268) [-1085.073] (-1083.813) (-1084.490) * (-1082.656) [-1084.301] (-1083.061) (-1082.454) -- 0:00:53
Average standard deviation of split frequencies: 0.024132
170500 -- (-1082.759) (-1085.068) (-1082.962) [-1084.341] * (-1082.434) [-1083.647] (-1082.031) (-1088.016) -- 0:00:53
171000 -- (-1085.832) (-1082.631) [-1082.420] (-1085.151) * (-1084.554) (-1083.354) (-1082.166) [-1085.657] -- 0:00:53
171500 -- (-1084.632) [-1084.404] (-1083.611) (-1088.744) * (-1084.812) [-1087.120] (-1082.324) (-1083.881) -- 0:00:53
172000 -- (-1082.698) (-1082.654) [-1083.062] (-1083.752) * (-1086.472) [-1082.755] (-1081.822) (-1086.599) -- 0:00:57
172500 -- (-1083.586) [-1083.531] (-1083.215) (-1082.704) * (-1086.516) (-1084.229) (-1084.676) [-1084.675] -- 0:00:57
173000 -- [-1083.075] (-1084.278) (-1084.511) (-1083.783) * [-1083.837] (-1085.318) (-1085.611) (-1083.706) -- 0:00:57
173500 -- (-1082.788) [-1082.616] (-1085.734) (-1082.239) * (-1086.216) (-1086.800) (-1085.132) [-1082.555] -- 0:00:57
174000 -- (-1082.147) [-1086.140] (-1086.835) (-1082.469) * (-1083.390) [-1083.076] (-1083.089) (-1084.102) -- 0:00:56
174500 -- [-1081.913] (-1084.077) (-1085.496) (-1082.001) * (-1086.315) (-1086.274) [-1082.063] (-1083.127) -- 0:00:56
175000 -- (-1081.927) (-1084.682) (-1085.561) [-1081.877] * (-1083.828) (-1089.158) [-1082.008] (-1086.709) -- 0:00:56
Average standard deviation of split frequencies: 0.021561
175500 -- (-1082.408) (-1083.062) (-1085.461) [-1085.379] * (-1087.512) (-1085.033) (-1083.656) [-1083.773] -- 0:00:56
176000 -- (-1083.760) [-1083.360] (-1088.243) (-1086.724) * (-1085.965) (-1083.571) [-1082.498] (-1083.850) -- 0:00:56
176500 -- (-1082.644) (-1083.603) (-1083.967) [-1086.347] * (-1083.368) (-1088.568) (-1082.200) [-1083.572] -- 0:00:55
177000 -- (-1082.937) (-1086.800) (-1082.314) [-1089.581] * [-1083.536] (-1088.602) (-1082.203) (-1083.874) -- 0:00:55
177500 -- (-1083.587) (-1084.115) [-1083.211] (-1088.779) * (-1082.839) [-1085.122] (-1085.194) (-1087.807) -- 0:00:55
178000 -- (-1085.520) (-1083.085) (-1083.114) [-1083.597] * (-1082.914) (-1083.188) [-1085.194] (-1086.186) -- 0:00:55
178500 -- (-1082.722) [-1084.491] (-1083.672) (-1082.705) * (-1086.225) [-1084.848] (-1083.347) (-1087.354) -- 0:00:55
179000 -- (-1083.706) [-1086.202] (-1082.351) (-1082.927) * (-1083.410) [-1089.154] (-1082.048) (-1084.596) -- 0:00:55
179500 -- (-1086.126) (-1083.220) [-1083.731] (-1083.223) * [-1087.117] (-1088.715) (-1082.985) (-1084.963) -- 0:00:54
180000 -- (-1082.736) (-1083.480) (-1089.483) [-1083.030] * [-1082.225] (-1087.480) (-1083.139) (-1088.476) -- 0:00:54
Average standard deviation of split frequencies: 0.023346
180500 -- (-1082.593) [-1083.639] (-1083.241) (-1083.933) * (-1082.772) [-1083.281] (-1083.801) (-1085.097) -- 0:00:54
181000 -- (-1082.848) (-1082.145) [-1082.536] (-1085.482) * (-1082.650) (-1082.318) (-1084.522) [-1084.631] -- 0:00:54
181500 -- [-1082.282] (-1083.848) (-1083.315) (-1084.578) * [-1082.667] (-1085.296) (-1085.014) (-1082.388) -- 0:00:54
182000 -- [-1081.875] (-1083.732) (-1083.677) (-1083.392) * [-1082.440] (-1082.236) (-1082.682) (-1082.988) -- 0:00:53
182500 -- (-1082.952) [-1082.703] (-1085.764) (-1083.360) * (-1081.919) [-1082.288] (-1082.808) (-1082.828) -- 0:00:53
183000 -- (-1086.619) [-1083.758] (-1086.509) (-1082.518) * [-1082.690] (-1082.711) (-1083.191) (-1083.175) -- 0:00:53
183500 -- (-1082.415) (-1083.629) (-1086.337) [-1082.614] * (-1087.533) [-1082.351] (-1088.792) (-1083.340) -- 0:00:53
184000 -- [-1085.201] (-1083.953) (-1085.020) (-1082.219) * [-1084.378] (-1084.187) (-1082.342) (-1083.788) -- 0:00:53
184500 -- (-1087.011) [-1084.832] (-1084.298) (-1083.152) * (-1084.113) (-1084.981) (-1081.933) [-1086.287] -- 0:00:53
185000 -- [-1088.163] (-1084.550) (-1088.406) (-1085.842) * (-1083.055) (-1083.768) (-1083.415) [-1087.930] -- 0:00:52
Average standard deviation of split frequencies: 0.020656
185500 -- (-1086.066) (-1085.690) [-1082.584] (-1083.059) * (-1082.567) (-1082.646) (-1083.077) [-1085.355] -- 0:00:52
186000 -- (-1085.261) (-1081.671) [-1085.978] (-1087.728) * (-1082.604) (-1083.396) (-1085.567) [-1083.642] -- 0:00:52
186500 -- (-1083.167) (-1083.337) (-1084.599) [-1083.656] * (-1086.968) (-1086.596) [-1084.307] (-1084.311) -- 0:00:52
187000 -- (-1086.536) (-1083.029) (-1084.800) [-1084.764] * (-1086.051) [-1082.530] (-1082.347) (-1084.757) -- 0:00:56
187500 -- (-1084.497) [-1082.385] (-1082.806) (-1082.719) * (-1084.662) (-1082.443) [-1086.107] (-1091.190) -- 0:00:56
188000 -- (-1083.815) (-1088.818) (-1082.548) [-1081.842] * (-1083.380) (-1083.031) [-1082.891] (-1085.918) -- 0:00:56
188500 -- (-1084.671) (-1091.893) [-1084.201] (-1082.242) * (-1084.084) (-1082.885) [-1082.366] (-1085.388) -- 0:00:55
189000 -- (-1086.902) (-1091.781) [-1083.377] (-1085.537) * (-1083.763) (-1084.988) (-1086.457) [-1083.074] -- 0:00:55
189500 -- (-1084.614) (-1082.493) [-1083.082] (-1087.888) * [-1082.243] (-1085.516) (-1084.625) (-1088.211) -- 0:00:55
190000 -- (-1087.252) (-1082.494) (-1083.282) [-1085.712] * (-1082.697) (-1089.213) (-1088.243) [-1081.946] -- 0:00:55
Average standard deviation of split frequencies: 0.018914
190500 -- (-1085.729) (-1084.030) [-1086.099] (-1082.923) * (-1084.082) [-1087.481] (-1085.303) (-1083.740) -- 0:00:55
191000 -- (-1083.166) (-1082.072) (-1084.521) [-1082.348] * [-1083.017] (-1083.471) (-1083.294) (-1083.602) -- 0:00:55
191500 -- (-1083.212) (-1083.873) (-1087.622) [-1082.867] * (-1084.550) (-1085.920) (-1088.592) [-1082.833] -- 0:00:54
192000 -- [-1084.819] (-1082.048) (-1082.965) (-1083.616) * [-1083.716] (-1085.034) (-1086.903) (-1083.717) -- 0:00:54
192500 -- (-1084.861) [-1082.352] (-1082.792) (-1085.599) * [-1084.499] (-1083.085) (-1087.709) (-1083.152) -- 0:00:54
193000 -- (-1084.063) [-1084.138] (-1082.733) (-1088.017) * (-1087.074) (-1083.152) (-1092.824) [-1084.240] -- 0:00:54
193500 -- (-1084.037) [-1083.718] (-1083.207) (-1087.248) * [-1083.720] (-1082.923) (-1087.334) (-1083.315) -- 0:00:54
194000 -- (-1084.088) (-1086.457) (-1083.326) [-1082.966] * (-1084.424) (-1084.697) [-1086.662] (-1086.153) -- 0:00:54
194500 -- (-1084.046) [-1083.899] (-1090.738) (-1084.144) * (-1083.018) [-1084.251] (-1082.830) (-1086.048) -- 0:00:53
195000 -- (-1084.574) (-1082.663) (-1087.461) [-1085.157] * (-1082.633) (-1085.644) [-1082.677] (-1083.655) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
195500 -- [-1084.780] (-1083.865) (-1084.475) (-1083.444) * [-1084.446] (-1082.455) (-1082.776) (-1083.231) -- 0:00:53
196000 -- (-1085.696) (-1086.268) (-1082.235) [-1082.770] * (-1084.187) (-1085.580) [-1085.889] (-1083.328) -- 0:00:53
196500 -- (-1084.040) (-1082.912) [-1083.673] (-1085.755) * [-1086.440] (-1085.975) (-1084.079) (-1083.695) -- 0:00:53
197000 -- [-1084.946] (-1083.335) (-1087.246) (-1088.423) * (-1087.517) [-1083.721] (-1082.459) (-1086.533) -- 0:00:52
197500 -- (-1084.302) (-1083.489) (-1083.803) [-1084.229] * (-1086.614) (-1082.086) [-1086.306] (-1084.756) -- 0:00:52
198000 -- (-1084.386) (-1083.216) (-1083.362) [-1082.492] * [-1084.423] (-1083.701) (-1086.878) (-1083.549) -- 0:00:52
198500 -- (-1084.613) [-1083.816] (-1088.110) (-1082.896) * (-1084.708) [-1081.769] (-1085.293) (-1084.584) -- 0:00:52
199000 -- (-1085.679) (-1083.692) [-1084.143] (-1084.636) * (-1081.810) (-1083.919) (-1088.251) [-1083.790] -- 0:00:52
199500 -- (-1086.359) (-1082.588) [-1086.076] (-1088.133) * [-1084.010] (-1083.521) (-1083.083) (-1085.854) -- 0:00:52
200000 -- (-1085.830) [-1082.305] (-1083.393) (-1084.973) * (-1083.173) [-1086.847] (-1086.156) (-1084.372) -- 0:00:51
Average standard deviation of split frequencies: 0.019577
200500 -- (-1084.997) (-1082.826) (-1086.264) [-1082.451] * (-1082.294) (-1084.824) (-1086.594) [-1083.091] -- 0:00:51
201000 -- (-1086.631) [-1083.891] (-1082.146) (-1084.833) * [-1085.303] (-1081.957) (-1088.401) (-1084.467) -- 0:00:51
201500 -- (-1084.961) (-1083.501) (-1082.035) [-1085.496] * [-1086.117] (-1085.051) (-1084.821) (-1083.947) -- 0:00:51
202000 -- [-1083.792] (-1082.650) (-1084.314) (-1083.988) * (-1084.184) (-1082.656) (-1085.258) [-1087.811] -- 0:00:55
202500 -- (-1083.653) [-1082.645] (-1082.736) (-1090.097) * (-1083.704) [-1083.028] (-1082.379) (-1084.953) -- 0:00:55
203000 -- (-1085.651) [-1082.331] (-1083.379) (-1088.185) * (-1085.307) (-1082.439) [-1083.470] (-1082.709) -- 0:00:54
203500 -- (-1085.286) [-1082.805] (-1086.683) (-1085.870) * (-1085.422) (-1083.515) (-1086.136) [-1081.891] -- 0:00:54
204000 -- (-1082.306) (-1083.009) (-1082.426) [-1085.258] * (-1082.392) [-1082.623] (-1084.855) (-1082.346) -- 0:00:54
204500 -- (-1083.222) (-1084.869) [-1082.158] (-1084.213) * (-1096.017) (-1082.253) [-1082.740] (-1087.585) -- 0:00:54
205000 -- (-1082.965) (-1086.477) [-1082.066] (-1082.873) * (-1088.347) (-1085.144) [-1084.096] (-1082.027) -- 0:00:54
Average standard deviation of split frequencies: 0.018427
205500 -- (-1082.880) (-1084.945) (-1084.374) [-1082.571] * (-1084.807) [-1085.298] (-1082.629) (-1087.776) -- 0:00:54
206000 -- [-1083.309] (-1083.540) (-1084.018) (-1083.632) * (-1082.546) [-1085.099] (-1086.178) (-1085.313) -- 0:00:53
206500 -- (-1084.081) [-1086.980] (-1082.990) (-1085.300) * (-1083.421) (-1085.392) (-1088.538) [-1085.301] -- 0:00:53
207000 -- [-1084.344] (-1084.650) (-1084.344) (-1084.985) * (-1082.947) (-1083.865) [-1083.076] (-1083.300) -- 0:00:53
207500 -- (-1085.000) (-1084.768) (-1083.086) [-1084.919] * (-1086.389) (-1085.245) (-1083.387) [-1082.309] -- 0:00:53
208000 -- (-1085.285) (-1085.967) (-1083.004) [-1084.733] * (-1083.086) (-1081.728) (-1083.130) [-1081.731] -- 0:00:53
208500 -- (-1082.736) (-1085.448) [-1083.797] (-1086.199) * [-1083.361] (-1082.252) (-1083.962) (-1083.477) -- 0:00:53
209000 -- (-1083.535) (-1082.419) [-1082.497] (-1085.617) * (-1086.195) [-1081.760] (-1082.824) (-1083.497) -- 0:00:52
209500 -- (-1086.146) (-1083.556) (-1083.464) [-1083.921] * (-1083.928) (-1085.027) (-1083.671) [-1082.744] -- 0:00:52
210000 -- [-1083.199] (-1086.414) (-1081.738) (-1083.821) * (-1085.607) (-1083.409) (-1084.461) [-1085.305] -- 0:00:52
Average standard deviation of split frequencies: 0.017653
210500 -- (-1083.550) (-1083.858) [-1082.884] (-1082.365) * (-1084.257) (-1084.984) [-1082.788] (-1083.377) -- 0:00:52
211000 -- (-1085.668) [-1084.206] (-1082.486) (-1084.683) * [-1083.468] (-1083.251) (-1082.351) (-1085.427) -- 0:00:52
211500 -- (-1086.513) (-1084.232) [-1082.482] (-1084.620) * (-1085.380) [-1083.714] (-1084.941) (-1084.433) -- 0:00:52
212000 -- (-1085.499) [-1087.343] (-1083.051) (-1083.171) * (-1088.631) (-1083.808) [-1084.390] (-1084.671) -- 0:00:52
212500 -- [-1084.115] (-1085.475) (-1086.997) (-1083.016) * [-1084.537] (-1082.373) (-1085.093) (-1083.416) -- 0:00:51
213000 -- [-1084.639] (-1083.473) (-1092.318) (-1084.403) * [-1084.516] (-1083.505) (-1086.184) (-1081.884) -- 0:00:51
213500 -- (-1091.296) [-1084.099] (-1090.014) (-1085.013) * (-1085.463) [-1083.411] (-1086.521) (-1083.631) -- 0:00:51
214000 -- (-1091.581) [-1084.503] (-1086.987) (-1083.592) * (-1084.892) (-1084.897) (-1085.125) [-1086.108] -- 0:00:51
214500 -- (-1089.025) (-1085.364) [-1087.786] (-1085.051) * (-1084.032) [-1082.761] (-1086.606) (-1086.023) -- 0:00:51
215000 -- [-1085.993] (-1087.203) (-1082.559) (-1087.898) * (-1084.362) (-1082.486) (-1086.965) [-1083.992] -- 0:00:51
Average standard deviation of split frequencies: 0.017459
215500 -- (-1083.376) (-1087.920) [-1082.393] (-1087.083) * [-1084.695] (-1090.694) (-1082.233) (-1084.271) -- 0:00:50
216000 -- (-1083.440) (-1087.165) [-1082.704] (-1085.284) * [-1082.915] (-1087.738) (-1083.929) (-1082.015) -- 0:00:54
216500 -- (-1085.334) (-1083.990) (-1084.239) [-1083.770] * [-1084.697] (-1086.414) (-1084.188) (-1082.748) -- 0:00:54
217000 -- [-1084.449] (-1082.587) (-1084.729) (-1087.517) * (-1089.677) (-1084.191) [-1082.912] (-1082.180) -- 0:00:54
217500 -- [-1084.927] (-1083.907) (-1082.710) (-1084.416) * (-1087.511) (-1082.930) [-1083.043] (-1084.088) -- 0:00:53
218000 -- (-1084.789) (-1083.907) (-1082.569) [-1081.810] * [-1084.901] (-1082.712) (-1084.456) (-1082.428) -- 0:00:53
218500 -- (-1086.902) (-1083.781) (-1082.751) [-1082.761] * (-1086.272) (-1085.734) (-1084.674) [-1083.299] -- 0:00:53
219000 -- (-1085.504) (-1083.192) [-1083.005] (-1087.210) * [-1085.862] (-1093.708) (-1083.195) (-1084.975) -- 0:00:53
219500 -- (-1087.763) (-1084.192) (-1082.832) [-1083.266] * (-1083.769) (-1081.724) (-1083.857) [-1084.391] -- 0:00:53
220000 -- (-1088.122) [-1082.837] (-1084.366) (-1082.113) * [-1083.114] (-1083.308) (-1086.117) (-1084.060) -- 0:00:53
Average standard deviation of split frequencies: 0.017446
220500 -- (-1084.535) (-1082.837) [-1084.393] (-1084.175) * (-1082.806) (-1082.063) (-1082.915) [-1083.217] -- 0:00:53
221000 -- [-1084.022] (-1083.162) (-1085.103) (-1083.592) * (-1083.118) (-1085.060) [-1085.844] (-1085.028) -- 0:00:52
221500 -- (-1086.497) (-1088.404) (-1085.782) [-1082.594] * (-1083.610) (-1085.292) (-1083.227) [-1085.556] -- 0:00:52
222000 -- (-1085.307) (-1084.228) [-1085.657] (-1084.640) * (-1083.300) (-1090.617) [-1084.283] (-1087.116) -- 0:00:52
222500 -- [-1082.667] (-1083.085) (-1084.723) (-1082.281) * (-1084.383) (-1084.401) [-1083.834] (-1082.607) -- 0:00:52
223000 -- [-1081.919] (-1083.491) (-1084.895) (-1088.009) * [-1083.515] (-1085.990) (-1085.139) (-1084.066) -- 0:00:52
223500 -- [-1084.364] (-1086.789) (-1083.730) (-1085.201) * (-1082.428) [-1083.655] (-1082.477) (-1082.988) -- 0:00:52
224000 -- (-1083.124) (-1087.020) [-1082.533] (-1082.587) * [-1083.236] (-1083.960) (-1086.965) (-1083.386) -- 0:00:51
224500 -- (-1083.819) (-1085.670) (-1082.703) [-1083.517] * (-1084.840) [-1082.890] (-1083.082) (-1082.689) -- 0:00:51
225000 -- (-1082.675) (-1083.332) (-1082.596) [-1082.713] * (-1086.881) (-1083.729) (-1086.111) [-1081.849] -- 0:00:51
Average standard deviation of split frequencies: 0.016270
225500 -- (-1082.373) [-1083.742] (-1084.897) (-1084.573) * (-1084.072) (-1084.087) (-1083.634) [-1081.975] -- 0:00:51
226000 -- (-1084.823) (-1090.577) (-1083.760) [-1083.661] * (-1082.287) (-1084.111) (-1084.232) [-1081.732] -- 0:00:51
226500 -- (-1084.550) (-1085.642) [-1082.341] (-1084.196) * (-1082.677) (-1085.641) (-1088.138) [-1082.593] -- 0:00:51
227000 -- (-1084.313) [-1089.938] (-1082.516) (-1083.510) * [-1082.092] (-1083.716) (-1084.300) (-1083.652) -- 0:00:51
227500 -- (-1085.927) [-1087.796] (-1082.615) (-1083.994) * (-1084.559) (-1082.685) [-1084.562] (-1084.577) -- 0:00:50
228000 -- (-1084.609) (-1083.407) (-1082.882) [-1083.685] * [-1086.171] (-1082.535) (-1084.925) (-1083.109) -- 0:00:50
228500 -- (-1083.878) (-1084.380) [-1084.410] (-1085.370) * (-1084.257) [-1083.118] (-1089.070) (-1083.719) -- 0:00:50
229000 -- (-1083.593) (-1082.795) (-1090.189) [-1082.121] * [-1085.591] (-1085.884) (-1084.238) (-1083.973) -- 0:00:50
229500 -- (-1083.008) (-1084.649) [-1084.702] (-1082.151) * [-1086.805] (-1083.559) (-1085.113) (-1083.490) -- 0:00:50
230000 -- (-1083.587) [-1083.303] (-1088.742) (-1082.868) * (-1084.256) [-1085.669] (-1085.143) (-1082.643) -- 0:00:53
Average standard deviation of split frequencies: 0.016236
230500 -- (-1083.319) (-1083.258) [-1083.955] (-1085.395) * (-1086.441) (-1084.337) (-1084.504) [-1082.375] -- 0:00:53
231000 -- (-1081.781) (-1082.978) (-1083.221) [-1084.889] * (-1082.186) (-1082.755) (-1082.667) [-1082.681] -- 0:00:53
231500 -- (-1082.432) [-1084.188] (-1085.222) (-1086.208) * (-1082.028) (-1085.658) [-1085.511] (-1083.601) -- 0:00:53
232000 -- (-1082.751) (-1083.949) [-1085.333] (-1083.627) * (-1086.239) (-1090.940) [-1086.114] (-1086.940) -- 0:00:52
232500 -- (-1082.317) [-1083.430] (-1084.335) (-1084.129) * (-1083.426) (-1090.240) (-1085.088) [-1082.129] -- 0:00:52
233000 -- (-1085.677) (-1083.773) (-1085.311) [-1083.441] * (-1083.276) (-1091.700) [-1083.666] (-1081.744) -- 0:00:52
233500 -- (-1085.560) (-1083.449) [-1084.022] (-1082.375) * (-1087.288) (-1083.132) [-1085.520] (-1081.742) -- 0:00:52
234000 -- (-1082.122) [-1083.806] (-1085.457) (-1082.328) * [-1086.231] (-1082.555) (-1084.994) (-1082.589) -- 0:00:52
234500 -- (-1084.071) (-1082.396) [-1085.794] (-1084.130) * (-1082.653) (-1083.258) (-1086.224) [-1083.855] -- 0:00:52
235000 -- (-1082.108) (-1087.531) [-1085.271] (-1085.059) * (-1082.886) [-1082.318] (-1085.683) (-1083.222) -- 0:00:52
Average standard deviation of split frequencies: 0.016779
235500 -- (-1081.715) [-1084.915] (-1085.252) (-1084.292) * (-1082.773) (-1081.939) (-1084.142) [-1082.502] -- 0:00:51
236000 -- (-1082.139) (-1083.957) [-1083.273] (-1087.317) * [-1082.343] (-1081.960) (-1083.202) (-1083.714) -- 0:00:51
236500 -- (-1084.493) (-1085.358) [-1084.887] (-1084.821) * [-1085.342] (-1082.824) (-1081.983) (-1083.601) -- 0:00:51
237000 -- (-1086.703) (-1085.307) [-1083.747] (-1085.155) * (-1087.748) [-1084.003] (-1088.083) (-1084.736) -- 0:00:51
237500 -- (-1086.689) (-1084.614) (-1082.538) [-1085.405] * (-1086.685) [-1082.155] (-1088.633) (-1085.170) -- 0:00:51
238000 -- (-1085.783) (-1084.935) [-1082.651] (-1086.059) * (-1083.253) (-1083.445) (-1082.513) [-1083.859] -- 0:00:51
238500 -- (-1085.377) (-1083.471) (-1082.458) [-1082.643] * [-1083.640] (-1082.863) (-1084.371) (-1086.516) -- 0:00:51
239000 -- (-1083.679) (-1083.025) [-1082.547] (-1089.705) * (-1083.776) (-1083.211) (-1083.831) [-1081.946] -- 0:00:50
239500 -- (-1082.334) [-1086.133] (-1084.356) (-1090.770) * (-1082.659) (-1083.749) (-1084.965) [-1083.963] -- 0:00:50
240000 -- (-1082.753) (-1084.027) [-1083.080] (-1085.186) * (-1082.897) [-1083.919] (-1083.317) (-1083.730) -- 0:00:50
Average standard deviation of split frequencies: 0.018216
240500 -- (-1086.208) [-1084.209] (-1082.827) (-1083.317) * (-1083.020) (-1083.639) [-1082.214] (-1084.155) -- 0:00:50
241000 -- (-1082.638) (-1084.087) [-1082.778] (-1082.978) * (-1083.100) (-1085.260) [-1084.057] (-1084.164) -- 0:00:50
241500 -- (-1081.617) (-1083.722) [-1082.926] (-1082.795) * (-1085.095) (-1083.931) [-1085.107] (-1084.352) -- 0:00:50
242000 -- (-1083.743) (-1084.268) [-1086.195] (-1081.908) * [-1083.321] (-1083.696) (-1085.472) (-1083.745) -- 0:00:50
242500 -- (-1083.457) (-1085.062) (-1082.775) [-1083.365] * (-1087.228) [-1082.780] (-1086.581) (-1082.813) -- 0:00:49
243000 -- [-1082.781] (-1084.589) (-1082.571) (-1084.726) * (-1089.895) (-1085.189) (-1087.065) [-1088.295] -- 0:00:49
243500 -- [-1083.263] (-1088.913) (-1083.182) (-1085.132) * [-1084.414] (-1083.328) (-1086.436) (-1085.395) -- 0:00:49
244000 -- [-1083.069] (-1082.973) (-1085.950) (-1084.718) * (-1087.791) (-1084.900) (-1084.712) [-1084.832] -- 0:00:52
244500 -- [-1089.148] (-1086.039) (-1084.408) (-1085.842) * (-1084.296) (-1084.524) [-1084.191] (-1085.680) -- 0:00:52
245000 -- (-1086.949) (-1083.723) [-1086.265] (-1084.804) * (-1084.807) [-1083.659] (-1084.061) (-1084.529) -- 0:00:52
Average standard deviation of split frequencies: 0.017448
245500 -- (-1085.025) (-1083.192) (-1082.796) [-1084.369] * [-1084.523] (-1086.165) (-1086.231) (-1086.046) -- 0:00:52
246000 -- (-1083.469) (-1085.683) (-1083.248) [-1084.274] * (-1084.765) [-1086.354] (-1084.846) (-1085.669) -- 0:00:52
246500 -- (-1082.505) (-1082.729) [-1083.933] (-1082.844) * [-1082.751] (-1085.178) (-1091.951) (-1086.411) -- 0:00:51
247000 -- [-1082.185] (-1084.567) (-1082.756) (-1083.316) * (-1085.375) (-1086.709) (-1082.780) [-1083.076] -- 0:00:51
247500 -- [-1082.160] (-1085.092) (-1083.277) (-1084.647) * (-1085.701) (-1085.724) [-1082.063] (-1085.092) -- 0:00:51
248000 -- [-1082.670] (-1084.970) (-1086.086) (-1084.797) * (-1084.198) (-1085.046) [-1082.882] (-1082.857) -- 0:00:51
248500 -- [-1082.954] (-1083.748) (-1089.633) (-1083.519) * (-1082.434) [-1082.953] (-1085.202) (-1084.247) -- 0:00:51
249000 -- (-1084.294) (-1087.271) [-1082.634] (-1082.582) * (-1084.677) [-1082.008] (-1083.539) (-1083.070) -- 0:00:51
249500 -- [-1082.685] (-1083.286) (-1082.161) (-1086.003) * (-1084.877) [-1085.276] (-1082.053) (-1082.917) -- 0:00:51
250000 -- (-1084.054) [-1083.730] (-1085.074) (-1085.451) * (-1087.635) (-1089.494) [-1082.663] (-1084.588) -- 0:00:51
Average standard deviation of split frequencies: 0.017960
250500 -- (-1081.823) (-1084.943) [-1084.178] (-1085.479) * (-1085.710) (-1085.726) [-1082.352] (-1084.077) -- 0:00:50
251000 -- (-1083.095) [-1085.954] (-1083.517) (-1085.001) * (-1085.566) [-1084.358] (-1083.825) (-1083.967) -- 0:00:50
251500 -- (-1082.774) (-1083.646) [-1084.358] (-1088.951) * (-1084.828) (-1084.837) [-1084.561] (-1085.801) -- 0:00:50
252000 -- (-1083.156) (-1083.258) [-1083.037] (-1086.539) * (-1084.083) (-1081.749) (-1082.853) [-1086.683] -- 0:00:50
252500 -- (-1086.379) (-1084.872) (-1084.353) [-1085.732] * (-1083.932) [-1081.755] (-1086.167) (-1085.773) -- 0:00:50
253000 -- (-1083.078) (-1083.333) [-1083.199] (-1085.559) * (-1086.588) (-1082.574) (-1086.279) [-1084.527] -- 0:00:50
253500 -- [-1081.898] (-1083.368) (-1086.604) (-1088.426) * (-1084.215) (-1081.862) [-1083.847] (-1084.307) -- 0:00:50
254000 -- (-1083.066) (-1085.012) (-1087.052) [-1083.586] * (-1083.197) (-1083.477) (-1082.893) [-1085.454] -- 0:00:49
254500 -- (-1086.295) [-1085.031] (-1085.844) (-1087.191) * (-1083.777) (-1085.890) (-1084.358) [-1084.013] -- 0:00:49
255000 -- [-1087.233] (-1086.615) (-1083.727) (-1088.633) * (-1085.223) [-1084.955] (-1085.988) (-1085.488) -- 0:00:49
Average standard deviation of split frequencies: 0.017289
255500 -- (-1088.970) (-1084.303) [-1085.631] (-1083.716) * (-1084.326) [-1083.682] (-1083.596) (-1085.118) -- 0:00:49
256000 -- [-1083.582] (-1084.933) (-1083.839) (-1081.801) * (-1082.714) [-1082.922] (-1085.680) (-1084.659) -- 0:00:49
256500 -- (-1082.888) (-1083.427) [-1082.942] (-1085.535) * (-1083.890) (-1082.303) [-1084.352] (-1084.630) -- 0:00:52
257000 -- (-1082.971) (-1085.475) (-1083.564) [-1085.367] * (-1085.798) [-1086.231] (-1081.646) (-1085.368) -- 0:00:52
257500 -- (-1085.049) [-1082.567] (-1085.155) (-1086.512) * (-1083.376) (-1086.182) [-1082.159] (-1083.370) -- 0:00:51
258000 -- (-1085.133) (-1085.087) [-1085.739] (-1082.055) * [-1084.422] (-1087.498) (-1086.631) (-1084.033) -- 0:00:51
258500 -- (-1085.178) (-1086.228) [-1083.435] (-1085.876) * (-1084.455) [-1083.626] (-1082.556) (-1082.548) -- 0:00:51
259000 -- (-1085.184) (-1085.709) (-1084.147) [-1087.146] * [-1085.649] (-1084.041) (-1082.705) (-1084.292) -- 0:00:51
259500 -- (-1084.353) (-1083.282) [-1083.051] (-1083.595) * (-1085.650) (-1085.651) (-1083.330) [-1085.158] -- 0:00:51
260000 -- (-1086.202) (-1086.021) (-1082.659) [-1083.522] * (-1084.783) (-1081.840) [-1083.953] (-1086.584) -- 0:00:51
Average standard deviation of split frequencies: 0.016578
260500 -- (-1085.454) (-1084.833) (-1082.930) [-1082.723] * (-1083.110) (-1084.535) (-1084.651) [-1086.584] -- 0:00:51
261000 -- (-1083.125) (-1084.469) (-1083.708) [-1084.617] * [-1083.237] (-1083.573) (-1085.410) (-1083.593) -- 0:00:50
261500 -- (-1084.100) [-1082.579] (-1085.004) (-1082.563) * (-1082.885) [-1085.636] (-1085.760) (-1083.223) -- 0:00:50
262000 -- (-1083.737) [-1081.968] (-1089.840) (-1083.139) * (-1082.983) (-1083.466) (-1085.393) [-1087.045] -- 0:00:50
262500 -- [-1085.562] (-1083.687) (-1087.389) (-1082.444) * (-1084.527) [-1083.314] (-1086.039) (-1083.586) -- 0:00:50
263000 -- [-1086.606] (-1086.105) (-1081.826) (-1083.013) * [-1082.356] (-1082.943) (-1084.320) (-1082.061) -- 0:00:50
263500 -- [-1090.063] (-1082.871) (-1083.725) (-1083.612) * [-1082.714] (-1082.461) (-1084.201) (-1082.069) -- 0:00:50
264000 -- (-1089.143) (-1085.479) [-1084.068] (-1084.626) * (-1083.112) (-1084.395) [-1085.605] (-1086.253) -- 0:00:50
264500 -- (-1083.803) (-1087.190) [-1085.060] (-1085.441) * (-1084.447) (-1084.451) [-1082.507] (-1083.435) -- 0:00:50
265000 -- (-1083.580) (-1082.853) [-1083.001] (-1085.334) * (-1083.024) (-1082.595) [-1082.486] (-1084.217) -- 0:00:49
Average standard deviation of split frequencies: 0.015162
265500 -- (-1083.200) (-1083.449) [-1082.442] (-1086.788) * (-1084.168) (-1082.692) [-1084.935] (-1082.258) -- 0:00:49
266000 -- [-1083.491] (-1085.631) (-1082.720) (-1088.532) * (-1084.950) (-1083.690) (-1083.533) [-1085.305] -- 0:00:49
266500 -- (-1084.954) [-1084.569] (-1082.758) (-1086.007) * (-1085.611) (-1082.802) [-1083.718] (-1084.788) -- 0:00:49
267000 -- (-1087.646) [-1084.025] (-1084.489) (-1087.172) * (-1082.949) [-1083.554] (-1086.547) (-1084.499) -- 0:00:49
267500 -- (-1083.702) [-1083.674] (-1084.049) (-1084.732) * [-1082.595] (-1084.195) (-1083.541) (-1083.597) -- 0:00:49
268000 -- [-1083.796] (-1085.060) (-1084.663) (-1086.187) * (-1083.197) (-1084.039) (-1084.151) [-1087.058] -- 0:00:49
268500 -- (-1082.254) [-1085.259] (-1083.425) (-1086.895) * (-1085.336) (-1085.725) (-1082.886) [-1087.108] -- 0:00:49
269000 -- (-1083.493) [-1083.674] (-1085.894) (-1085.488) * (-1082.456) [-1084.431] (-1082.121) (-1082.444) -- 0:00:48
269500 -- (-1082.464) [-1085.583] (-1083.763) (-1083.786) * [-1082.531] (-1082.873) (-1083.599) (-1082.842) -- 0:00:51
270000 -- (-1083.076) (-1085.427) (-1083.926) [-1082.229] * (-1084.631) (-1084.837) [-1083.165] (-1085.355) -- 0:00:51
Average standard deviation of split frequencies: 0.015868
270500 -- [-1085.919] (-1082.274) (-1082.831) (-1082.970) * (-1083.468) (-1082.601) [-1084.439] (-1085.885) -- 0:00:51
271000 -- (-1082.714) (-1082.847) [-1082.941] (-1086.880) * [-1082.425] (-1082.451) (-1087.232) (-1088.225) -- 0:00:51
271500 -- (-1083.395) (-1082.931) (-1083.704) [-1084.872] * (-1082.584) (-1087.409) [-1084.464] (-1086.644) -- 0:00:50
272000 -- (-1083.860) (-1082.777) [-1082.553] (-1083.978) * (-1083.450) (-1084.158) [-1082.211] (-1088.041) -- 0:00:50
272500 -- [-1082.352] (-1083.940) (-1082.326) (-1084.107) * [-1085.512] (-1089.093) (-1083.574) (-1083.889) -- 0:00:50
273000 -- (-1083.245) (-1088.441) [-1085.721] (-1085.685) * (-1083.657) (-1090.782) [-1086.768] (-1083.333) -- 0:00:50
273500 -- [-1082.666] (-1083.145) (-1083.635) (-1084.849) * [-1083.477] (-1084.140) (-1083.589) (-1084.445) -- 0:00:50
274000 -- (-1083.212) [-1086.159] (-1084.500) (-1083.447) * (-1083.270) (-1082.624) [-1084.299] (-1082.598) -- 0:00:50
274500 -- (-1082.745) (-1084.798) [-1085.672] (-1084.860) * (-1083.359) (-1085.059) [-1085.007] (-1083.973) -- 0:00:50
275000 -- [-1085.530] (-1083.204) (-1084.953) (-1084.633) * [-1084.437] (-1085.360) (-1084.817) (-1089.306) -- 0:00:50
Average standard deviation of split frequencies: 0.016979
275500 -- (-1085.620) [-1083.751] (-1084.846) (-1083.267) * [-1084.796] (-1089.999) (-1083.993) (-1082.484) -- 0:00:49
276000 -- (-1087.034) (-1083.509) [-1082.566] (-1085.421) * [-1083.608] (-1085.959) (-1085.005) (-1084.739) -- 0:00:49
276500 -- (-1083.556) (-1085.784) [-1083.034] (-1086.591) * (-1084.227) (-1087.874) (-1084.688) [-1084.000] -- 0:00:49
277000 -- (-1082.650) (-1083.517) (-1085.491) [-1084.232] * [-1082.660] (-1084.648) (-1084.911) (-1082.140) -- 0:00:49
277500 -- [-1084.080] (-1083.640) (-1084.027) (-1083.434) * (-1085.885) (-1084.123) (-1084.688) [-1082.118] -- 0:00:49
278000 -- (-1083.382) (-1085.161) [-1084.388] (-1083.068) * (-1086.595) (-1083.190) (-1084.491) [-1082.957] -- 0:00:49
278500 -- (-1085.073) (-1084.682) (-1085.980) [-1083.613] * (-1090.302) (-1083.011) (-1082.685) [-1084.069] -- 0:00:49
279000 -- (-1086.591) (-1084.080) [-1082.482] (-1084.621) * (-1088.478) (-1082.864) [-1082.639] (-1084.129) -- 0:00:49
279500 -- (-1082.163) (-1084.718) [-1082.600] (-1085.585) * (-1089.690) [-1082.810] (-1083.050) (-1084.147) -- 0:00:48
280000 -- [-1082.029] (-1084.286) (-1082.132) (-1086.295) * (-1084.298) (-1083.903) (-1083.187) [-1084.921] -- 0:00:48
Average standard deviation of split frequencies: 0.016993
280500 -- [-1082.129] (-1083.116) (-1084.299) (-1084.520) * (-1082.829) [-1083.241] (-1082.681) (-1084.924) -- 0:00:48
281000 -- (-1085.016) [-1082.423] (-1083.770) (-1082.534) * [-1085.638] (-1082.780) (-1083.486) (-1084.223) -- 0:00:48
281500 -- (-1083.654) (-1083.582) [-1084.116] (-1082.141) * [-1082.370] (-1084.399) (-1084.686) (-1083.246) -- 0:00:48
282000 -- (-1085.102) (-1083.952) [-1084.273] (-1087.542) * (-1083.424) [-1084.856] (-1082.906) (-1083.287) -- 0:00:50
282500 -- (-1086.235) [-1084.589] (-1081.821) (-1083.460) * (-1085.148) [-1085.470] (-1082.583) (-1087.163) -- 0:00:50
283000 -- (-1083.569) (-1087.223) (-1082.369) [-1083.612] * (-1083.546) (-1086.302) [-1084.336] (-1088.540) -- 0:00:50
283500 -- [-1083.873] (-1086.510) (-1082.841) (-1085.896) * (-1083.863) [-1086.630] (-1085.625) (-1084.823) -- 0:00:50
284000 -- [-1083.552] (-1085.087) (-1082.888) (-1082.546) * (-1082.188) (-1082.080) [-1083.699] (-1082.831) -- 0:00:50
284500 -- (-1083.739) (-1083.816) (-1082.670) [-1089.393] * (-1086.294) [-1085.620] (-1083.292) (-1083.886) -- 0:00:50
285000 -- (-1085.918) (-1083.663) (-1082.525) [-1083.843] * (-1082.526) (-1089.068) [-1083.819] (-1083.027) -- 0:00:50
Average standard deviation of split frequencies: 0.016386
285500 -- [-1084.373] (-1083.529) (-1083.177) (-1084.299) * [-1081.964] (-1084.487) (-1082.676) (-1083.598) -- 0:00:50
286000 -- [-1082.010] (-1085.562) (-1083.176) (-1081.739) * [-1084.563] (-1088.345) (-1082.775) (-1086.067) -- 0:00:49
286500 -- [-1083.808] (-1084.152) (-1084.051) (-1082.961) * [-1085.875] (-1082.887) (-1084.994) (-1082.323) -- 0:00:49
287000 -- [-1082.458] (-1086.015) (-1082.923) (-1082.952) * [-1084.596] (-1082.307) (-1085.780) (-1082.308) -- 0:00:49
287500 -- (-1085.305) (-1084.825) (-1085.995) [-1086.912] * (-1086.642) (-1085.034) [-1086.141] (-1085.364) -- 0:00:49
288000 -- (-1082.477) [-1083.678] (-1086.348) (-1084.364) * (-1084.329) (-1085.066) (-1084.871) [-1082.812] -- 0:00:49
288500 -- (-1083.106) (-1084.164) (-1088.981) [-1085.555] * (-1084.279) (-1083.961) [-1085.074] (-1086.872) -- 0:00:49
289000 -- [-1082.599] (-1091.816) (-1085.324) (-1087.018) * (-1084.214) [-1083.461] (-1086.344) (-1086.674) -- 0:00:49
289500 -- (-1082.436) (-1084.458) (-1085.471) [-1083.218] * (-1092.147) [-1081.713] (-1089.952) (-1085.567) -- 0:00:49
290000 -- [-1083.651] (-1086.895) (-1084.066) (-1082.553) * [-1083.643] (-1081.714) (-1087.654) (-1084.567) -- 0:00:48
Average standard deviation of split frequencies: 0.016504
290500 -- (-1083.812) [-1082.607] (-1084.306) (-1083.191) * (-1084.797) [-1082.014] (-1091.442) (-1083.801) -- 0:00:48
291000 -- (-1082.158) [-1082.592] (-1082.924) (-1084.352) * (-1087.087) (-1082.104) [-1084.330] (-1084.236) -- 0:00:48
291500 -- (-1083.155) (-1082.515) [-1084.785] (-1083.549) * (-1086.806) (-1082.417) [-1083.692] (-1084.811) -- 0:00:48
292000 -- (-1083.619) [-1085.504] (-1085.669) (-1081.627) * (-1085.150) (-1084.457) [-1082.665] (-1083.385) -- 0:00:48
292500 -- [-1083.162] (-1083.220) (-1084.397) (-1081.836) * (-1088.444) [-1085.680] (-1085.005) (-1086.731) -- 0:00:48
293000 -- (-1087.028) (-1084.865) (-1083.752) [-1084.094] * (-1084.452) (-1082.850) (-1084.305) [-1082.550] -- 0:00:48
293500 -- (-1092.757) [-1082.332] (-1082.855) (-1084.194) * (-1084.772) (-1082.766) [-1083.412] (-1083.169) -- 0:00:48
294000 -- (-1083.251) (-1083.776) (-1084.669) [-1084.451] * (-1084.672) (-1082.718) [-1084.955] (-1083.318) -- 0:00:48
294500 -- (-1085.754) (-1083.718) (-1085.679) [-1084.942] * [-1086.041] (-1082.938) (-1083.996) (-1082.926) -- 0:00:47
295000 -- (-1088.313) [-1082.794] (-1082.890) (-1090.059) * [-1083.233] (-1086.687) (-1084.124) (-1082.837) -- 0:00:47
Average standard deviation of split frequencies: 0.016020
295500 -- (-1083.856) [-1082.172] (-1083.024) (-1087.710) * (-1085.231) [-1085.341] (-1084.238) (-1082.722) -- 0:00:47
296000 -- (-1082.570) (-1083.625) (-1087.495) [-1083.652] * (-1083.273) (-1086.309) (-1085.381) [-1083.075] -- 0:00:49
296500 -- [-1082.500] (-1082.898) (-1087.085) (-1082.917) * (-1084.159) [-1083.590] (-1088.977) (-1083.988) -- 0:00:49
297000 -- (-1084.076) (-1083.188) (-1083.112) [-1081.942] * (-1083.826) (-1083.701) [-1092.546] (-1084.048) -- 0:00:49
297500 -- [-1083.711] (-1082.396) (-1083.777) (-1083.089) * (-1082.060) [-1084.392] (-1083.202) (-1081.704) -- 0:00:49
298000 -- (-1082.601) (-1083.971) [-1082.915] (-1082.594) * (-1081.719) [-1083.228] (-1086.296) (-1082.646) -- 0:00:49
298500 -- (-1082.746) (-1082.359) (-1083.083) [-1082.135] * [-1081.754] (-1085.133) (-1083.054) (-1089.653) -- 0:00:49
299000 -- (-1083.343) (-1083.062) (-1083.269) [-1083.020] * (-1087.058) (-1083.106) [-1082.477] (-1085.714) -- 0:00:49
299500 -- (-1081.702) (-1083.556) (-1083.773) [-1085.011] * (-1085.193) (-1084.033) (-1084.884) [-1085.305] -- 0:00:49
300000 -- [-1084.182] (-1083.525) (-1082.459) (-1087.376) * (-1083.459) [-1082.585] (-1086.233) (-1084.533) -- 0:00:48
Average standard deviation of split frequencies: 0.015863
300500 -- [-1083.749] (-1084.915) (-1083.406) (-1082.384) * [-1083.071] (-1082.235) (-1087.339) (-1084.663) -- 0:00:48
301000 -- (-1084.192) [-1085.324] (-1083.250) (-1081.702) * (-1082.300) (-1085.084) [-1085.274] (-1086.127) -- 0:00:48
301500 -- (-1083.957) (-1081.930) (-1085.520) [-1083.773] * (-1082.805) [-1085.926] (-1089.363) (-1082.177) -- 0:00:48
302000 -- (-1087.364) (-1081.928) [-1082.367] (-1082.375) * [-1083.046] (-1083.449) (-1084.346) (-1082.053) -- 0:00:48
302500 -- (-1084.900) (-1082.040) [-1082.474] (-1083.959) * (-1083.418) (-1083.115) [-1083.707] (-1082.549) -- 0:00:48
303000 -- (-1083.637) (-1084.475) [-1084.046] (-1088.644) * (-1085.540) (-1083.768) (-1083.291) [-1083.758] -- 0:00:48
303500 -- (-1087.270) (-1084.245) [-1083.923] (-1086.136) * (-1084.621) (-1083.125) [-1082.777] (-1081.961) -- 0:00:48
304000 -- (-1085.560) (-1085.648) [-1082.790] (-1083.329) * [-1084.204] (-1086.341) (-1083.086) (-1084.547) -- 0:00:48
304500 -- (-1087.054) [-1083.286] (-1084.719) (-1083.729) * (-1082.737) (-1086.705) [-1083.461] (-1084.360) -- 0:00:47
305000 -- [-1082.418] (-1084.775) (-1084.728) (-1085.582) * (-1082.872) (-1086.642) [-1084.214] (-1084.473) -- 0:00:47
Average standard deviation of split frequencies: 0.016221
305500 -- (-1084.815) (-1082.905) (-1084.497) [-1082.738] * [-1083.582] (-1086.519) (-1083.883) (-1085.597) -- 0:00:47
306000 -- (-1083.602) [-1083.623] (-1083.855) (-1083.638) * (-1083.130) (-1087.394) (-1085.346) [-1085.962] -- 0:00:47
306500 -- (-1084.452) (-1083.272) (-1084.884) [-1083.399] * (-1082.818) (-1084.952) (-1085.290) [-1086.427] -- 0:00:47
307000 -- [-1090.229] (-1084.874) (-1085.050) (-1082.965) * (-1083.264) (-1085.564) (-1086.427) [-1085.259] -- 0:00:47
307500 -- (-1087.240) (-1084.013) (-1083.254) [-1082.712] * (-1090.624) (-1085.254) [-1083.360] (-1083.361) -- 0:00:47
308000 -- [-1084.548] (-1084.211) (-1082.837) (-1085.046) * [-1084.072] (-1084.629) (-1084.367) (-1083.430) -- 0:00:47
308500 -- (-1085.944) (-1083.907) [-1082.636] (-1086.214) * (-1084.131) (-1084.344) (-1084.410) [-1083.816] -- 0:00:47
309000 -- [-1082.678] (-1083.971) (-1085.996) (-1086.293) * (-1083.439) (-1084.620) [-1083.451] (-1084.385) -- 0:00:46
309500 -- (-1082.527) (-1083.114) (-1081.569) [-1081.900] * (-1082.926) (-1084.931) (-1081.847) [-1083.200] -- 0:00:46
310000 -- (-1083.033) (-1082.495) [-1081.579] (-1085.553) * (-1090.334) (-1086.059) (-1082.372) [-1086.126] -- 0:00:46
Average standard deviation of split frequencies: 0.017852
310500 -- [-1084.112] (-1082.345) (-1083.913) (-1083.485) * [-1082.779] (-1086.672) (-1083.412) (-1087.190) -- 0:00:48
311000 -- (-1082.376) [-1083.250] (-1083.202) (-1084.349) * (-1083.996) (-1086.888) (-1082.777) [-1083.386] -- 0:00:48
311500 -- [-1085.193] (-1086.905) (-1082.496) (-1082.574) * (-1085.357) (-1085.381) [-1082.367] (-1083.965) -- 0:00:48
312000 -- (-1085.637) (-1085.775) (-1086.807) [-1085.601] * (-1083.172) (-1083.983) (-1082.243) [-1081.973] -- 0:00:48
312500 -- [-1084.843] (-1085.965) (-1083.454) (-1086.640) * (-1083.882) (-1082.775) [-1084.464] (-1083.297) -- 0:00:48
313000 -- (-1083.640) (-1084.157) [-1084.016] (-1085.952) * (-1089.233) (-1082.888) [-1083.556] (-1083.274) -- 0:00:48
313500 -- (-1083.755) (-1086.918) (-1086.081) [-1086.294] * (-1086.105) (-1084.334) (-1084.851) [-1082.711] -- 0:00:48
314000 -- [-1082.950] (-1083.330) (-1083.575) (-1089.433) * (-1085.713) (-1088.291) [-1084.195] (-1084.528) -- 0:00:48
314500 -- (-1089.560) (-1083.761) (-1083.834) [-1088.377] * [-1086.978] (-1085.923) (-1083.966) (-1085.120) -- 0:00:47
315000 -- [-1085.623] (-1083.594) (-1083.407) (-1084.483) * (-1084.526) (-1084.623) (-1083.942) [-1083.149] -- 0:00:47
Average standard deviation of split frequencies: 0.018691
315500 -- (-1082.994) [-1084.540] (-1085.337) (-1084.059) * (-1083.869) [-1081.966] (-1082.451) (-1087.505) -- 0:00:47
316000 -- [-1082.852] (-1083.765) (-1085.365) (-1084.678) * [-1081.856] (-1081.597) (-1083.509) (-1083.161) -- 0:00:47
316500 -- (-1085.927) (-1085.349) (-1084.690) [-1084.962] * (-1082.641) [-1082.886] (-1084.269) (-1082.756) -- 0:00:47
317000 -- (-1086.730) (-1086.575) (-1083.975) [-1085.537] * [-1082.717] (-1082.642) (-1084.087) (-1086.313) -- 0:00:47
317500 -- (-1085.587) (-1082.346) (-1083.442) [-1083.696] * [-1082.947] (-1086.329) (-1084.007) (-1083.152) -- 0:00:47
318000 -- (-1084.382) (-1082.218) (-1087.738) [-1082.611] * [-1085.559] (-1083.702) (-1084.141) (-1083.664) -- 0:00:47
318500 -- (-1082.142) (-1081.769) (-1086.744) [-1086.248] * (-1084.079) [-1082.728] (-1086.339) (-1082.364) -- 0:00:47
319000 -- [-1081.837] (-1081.769) (-1085.867) (-1083.998) * (-1084.236) [-1085.142] (-1086.285) (-1083.013) -- 0:00:46
319500 -- (-1081.938) [-1082.106] (-1082.715) (-1084.853) * (-1085.322) (-1083.240) (-1086.128) [-1081.861] -- 0:00:46
320000 -- (-1082.756) (-1088.005) [-1082.636] (-1085.685) * (-1084.838) (-1083.088) (-1087.939) [-1081.950] -- 0:00:46
Average standard deviation of split frequencies: 0.018743
320500 -- (-1083.421) (-1085.257) (-1085.841) [-1083.945] * (-1085.321) (-1083.964) [-1084.317] (-1086.222) -- 0:00:46
321000 -- (-1084.747) [-1081.796] (-1085.783) (-1082.380) * (-1083.378) (-1083.572) [-1082.396] (-1082.528) -- 0:00:46
321500 -- (-1084.894) [-1082.489] (-1086.060) (-1083.006) * (-1082.672) (-1084.223) (-1083.323) [-1081.885] -- 0:00:46
322000 -- (-1084.438) (-1086.016) (-1088.498) [-1082.657] * (-1084.335) (-1083.914) [-1082.257] (-1085.369) -- 0:00:46
322500 -- (-1084.427) [-1083.011] (-1082.556) (-1082.151) * (-1082.984) [-1083.021] (-1084.271) (-1084.953) -- 0:00:46
323000 -- (-1086.034) (-1082.645) (-1083.883) [-1082.419] * (-1083.240) (-1083.289) [-1083.195] (-1085.331) -- 0:00:46
323500 -- (-1083.698) (-1082.813) [-1084.350] (-1085.078) * (-1083.887) (-1083.789) (-1084.219) [-1082.130] -- 0:00:46
324000 -- (-1084.973) [-1085.219] (-1082.302) (-1085.789) * (-1082.927) [-1083.759] (-1082.508) (-1082.492) -- 0:00:47
324500 -- [-1085.749] (-1084.914) (-1082.283) (-1083.497) * (-1082.322) (-1082.983) (-1083.918) [-1082.785] -- 0:00:47
325000 -- (-1083.407) [-1084.358] (-1084.901) (-1082.809) * (-1083.224) (-1083.333) [-1082.984] (-1085.871) -- 0:00:47
Average standard deviation of split frequencies: 0.018458
325500 -- (-1083.029) (-1082.445) (-1082.907) [-1082.784] * (-1081.855) (-1082.823) [-1083.647] (-1084.282) -- 0:00:47
326000 -- (-1082.309) [-1082.254] (-1083.305) (-1083.680) * [-1081.789] (-1084.078) (-1085.568) (-1086.066) -- 0:00:47
326500 -- (-1082.045) [-1082.425] (-1084.202) (-1089.745) * (-1081.923) [-1082.191] (-1085.351) (-1086.438) -- 0:00:47
327000 -- (-1083.190) [-1082.425] (-1083.106) (-1084.692) * (-1083.578) [-1082.573] (-1082.616) (-1084.740) -- 0:00:47
327500 -- (-1084.325) (-1084.612) [-1085.217] (-1083.142) * [-1082.982] (-1083.608) (-1083.063) (-1083.359) -- 0:00:47
328000 -- [-1085.952] (-1082.570) (-1088.385) (-1082.781) * (-1082.648) (-1085.734) (-1083.151) [-1083.776] -- 0:00:47
328500 -- (-1084.834) (-1082.392) (-1085.445) [-1082.116] * (-1085.423) (-1084.221) [-1083.602] (-1083.671) -- 0:00:47
329000 -- (-1085.115) (-1081.848) (-1084.531) [-1082.041] * (-1084.807) [-1082.931] (-1084.280) (-1084.167) -- 0:00:46
329500 -- (-1085.313) (-1083.358) (-1086.687) [-1082.273] * (-1083.610) (-1084.623) (-1086.112) [-1084.866] -- 0:00:46
330000 -- (-1086.622) (-1084.699) [-1084.003] (-1085.314) * [-1083.935] (-1082.531) (-1085.283) (-1083.823) -- 0:00:46
Average standard deviation of split frequencies: 0.018533
330500 -- (-1086.897) [-1082.648] (-1083.654) (-1082.740) * (-1083.659) (-1084.097) (-1085.049) [-1084.313] -- 0:00:46
331000 -- (-1083.507) (-1082.005) [-1084.328] (-1085.427) * (-1085.026) (-1085.972) (-1090.143) [-1083.615] -- 0:00:46
331500 -- [-1082.053] (-1082.035) (-1088.352) (-1084.007) * (-1083.682) (-1084.060) [-1082.142] (-1083.253) -- 0:00:46
332000 -- (-1083.544) (-1082.731) [-1085.234] (-1087.761) * (-1085.616) (-1085.001) (-1083.973) [-1083.454] -- 0:00:46
332500 -- [-1085.084] (-1083.472) (-1085.525) (-1086.256) * (-1085.362) (-1085.279) (-1083.768) [-1082.801] -- 0:00:46
333000 -- (-1084.855) (-1083.472) (-1082.831) [-1081.840] * [-1084.257] (-1086.388) (-1082.449) (-1082.349) -- 0:00:46
333500 -- (-1082.631) (-1083.960) [-1084.031] (-1081.928) * (-1091.184) [-1084.050] (-1082.738) (-1083.818) -- 0:00:45
334000 -- (-1083.923) (-1086.458) (-1085.679) [-1087.693] * (-1083.040) (-1084.090) [-1087.378] (-1086.081) -- 0:00:45
334500 -- [-1086.852] (-1085.005) (-1086.711) (-1082.716) * (-1082.562) (-1083.998) [-1085.430] (-1086.854) -- 0:00:45
335000 -- (-1083.615) [-1084.076] (-1091.478) (-1086.521) * (-1082.457) [-1084.008] (-1089.498) (-1087.279) -- 0:00:45
Average standard deviation of split frequencies: 0.017976
335500 -- (-1083.841) (-1083.051) [-1084.502] (-1085.277) * [-1083.490] (-1083.821) (-1084.633) (-1085.975) -- 0:00:45
336000 -- (-1084.641) (-1083.443) (-1085.582) [-1083.559] * (-1085.707) [-1083.458] (-1084.714) (-1085.702) -- 0:00:45
336500 -- (-1086.146) (-1083.021) [-1084.402] (-1085.265) * [-1082.152] (-1084.605) (-1086.780) (-1084.797) -- 0:00:47
337000 -- (-1083.576) [-1085.888] (-1083.578) (-1084.736) * (-1084.106) (-1083.372) (-1086.159) [-1084.256] -- 0:00:47
337500 -- (-1082.434) (-1082.726) (-1085.227) [-1085.096] * (-1088.683) (-1085.068) [-1089.994] (-1083.148) -- 0:00:47
338000 -- [-1082.054] (-1084.000) (-1083.841) (-1081.913) * (-1083.715) (-1087.140) (-1086.022) [-1082.082] -- 0:00:47
338500 -- (-1086.976) (-1082.766) [-1083.789] (-1083.807) * [-1086.361] (-1088.484) (-1082.642) (-1084.792) -- 0:00:46
339000 -- (-1086.784) (-1082.728) (-1083.212) [-1082.102] * (-1084.686) (-1087.340) (-1084.619) [-1085.715] -- 0:00:46
339500 -- (-1083.776) (-1084.277) [-1083.646] (-1084.088) * [-1086.817] (-1082.740) (-1084.120) (-1088.892) -- 0:00:46
340000 -- (-1084.433) (-1084.119) [-1083.951] (-1084.909) * (-1084.729) (-1083.374) [-1083.485] (-1084.008) -- 0:00:46
Average standard deviation of split frequencies: 0.016692
340500 -- (-1083.504) (-1087.729) (-1082.749) [-1083.922] * [-1082.737] (-1084.829) (-1081.865) (-1088.787) -- 0:00:46
341000 -- (-1083.012) (-1083.234) (-1084.314) [-1083.541] * (-1084.192) (-1087.937) [-1083.748] (-1086.044) -- 0:00:46
341500 -- (-1085.396) (-1082.811) (-1083.594) [-1083.285] * (-1082.052) (-1089.035) (-1082.656) [-1084.588] -- 0:00:46
342000 -- [-1084.062] (-1083.276) (-1084.103) (-1083.407) * (-1085.016) [-1082.483] (-1084.267) (-1083.961) -- 0:00:46
342500 -- (-1082.749) (-1084.136) (-1082.988) [-1083.271] * [-1084.245] (-1082.130) (-1083.080) (-1081.909) -- 0:00:46
343000 -- (-1083.683) [-1082.948] (-1086.030) (-1088.486) * (-1087.765) [-1081.779] (-1085.119) (-1084.105) -- 0:00:45
343500 -- [-1082.290] (-1084.781) (-1083.815) (-1085.719) * (-1086.034) [-1086.001] (-1082.758) (-1084.390) -- 0:00:45
344000 -- (-1082.959) (-1083.558) [-1082.948] (-1084.628) * (-1085.631) [-1083.642] (-1082.816) (-1086.254) -- 0:00:45
344500 -- (-1083.610) (-1083.048) (-1082.594) [-1082.329] * (-1085.453) (-1084.301) (-1087.124) [-1083.314] -- 0:00:45
345000 -- (-1085.152) (-1085.497) (-1084.556) [-1083.163] * (-1084.746) (-1088.204) [-1090.037] (-1084.243) -- 0:00:45
Average standard deviation of split frequencies: 0.016094
345500 -- [-1085.597] (-1086.458) (-1082.733) (-1084.410) * (-1082.402) (-1085.473) (-1084.210) [-1086.573] -- 0:00:45
346000 -- (-1088.760) [-1083.444] (-1081.877) (-1084.265) * (-1086.401) (-1082.312) (-1083.879) [-1083.755] -- 0:00:45
346500 -- [-1086.687] (-1085.188) (-1082.881) (-1082.362) * [-1084.361] (-1081.938) (-1083.575) (-1084.190) -- 0:00:45
347000 -- (-1084.964) (-1084.478) (-1082.543) [-1082.335] * [-1084.377] (-1084.426) (-1084.172) (-1084.034) -- 0:00:45
347500 -- (-1082.483) [-1086.466] (-1082.156) (-1085.755) * [-1084.516] (-1082.495) (-1089.742) (-1084.154) -- 0:00:45
348000 -- (-1083.796) (-1085.004) [-1087.457] (-1086.527) * (-1086.658) (-1085.447) (-1082.722) [-1085.941] -- 0:00:44
348500 -- [-1082.940] (-1083.643) (-1088.078) (-1083.949) * [-1083.130] (-1083.693) (-1085.617) (-1087.895) -- 0:00:44
349000 -- (-1084.518) [-1083.444] (-1085.733) (-1083.880) * [-1083.891] (-1083.016) (-1083.168) (-1090.598) -- 0:00:44
349500 -- (-1084.945) (-1083.440) (-1082.389) [-1086.184] * (-1083.085) [-1082.278] (-1083.183) (-1084.146) -- 0:00:46
350000 -- (-1087.026) [-1081.882] (-1083.453) (-1082.267) * (-1083.886) (-1083.686) [-1084.140] (-1083.467) -- 0:00:46
Average standard deviation of split frequencies: 0.015039
350500 -- (-1083.751) [-1081.796] (-1083.110) (-1082.095) * [-1083.594] (-1084.929) (-1088.236) (-1083.672) -- 0:00:46
351000 -- (-1084.518) [-1081.559] (-1084.862) (-1083.021) * (-1085.332) (-1082.123) (-1087.626) [-1083.244] -- 0:00:46
351500 -- (-1084.661) (-1082.308) [-1083.557] (-1085.333) * (-1083.719) (-1084.052) (-1085.146) [-1084.164] -- 0:00:46
352000 -- (-1086.251) (-1082.728) [-1083.642] (-1083.526) * (-1086.289) [-1084.762] (-1084.312) (-1083.272) -- 0:00:46
352500 -- (-1086.204) (-1084.176) (-1086.252) [-1082.772] * (-1089.879) [-1081.785] (-1085.928) (-1085.736) -- 0:00:45
353000 -- (-1083.043) (-1082.234) (-1084.031) [-1082.758] * (-1085.918) (-1082.011) [-1082.926] (-1084.688) -- 0:00:45
353500 -- (-1082.011) (-1083.570) (-1085.511) [-1085.945] * (-1082.300) (-1083.806) (-1084.169) [-1083.975] -- 0:00:45
354000 -- (-1085.415) [-1085.918] (-1084.736) (-1087.361) * [-1082.407] (-1086.632) (-1082.811) (-1086.798) -- 0:00:45
354500 -- (-1082.788) (-1082.640) [-1083.007] (-1088.965) * [-1084.865] (-1086.656) (-1082.554) (-1088.534) -- 0:00:45
355000 -- (-1084.582) (-1082.323) [-1084.845] (-1092.322) * (-1086.692) (-1084.133) (-1084.315) [-1086.172] -- 0:00:45
Average standard deviation of split frequencies: 0.015476
355500 -- (-1082.269) (-1083.958) [-1084.459] (-1088.159) * (-1085.225) (-1087.198) (-1083.044) [-1082.816] -- 0:00:45
356000 -- (-1084.722) [-1085.155] (-1083.529) (-1085.926) * (-1084.152) (-1083.051) (-1082.621) [-1084.653] -- 0:00:45
356500 -- (-1087.021) (-1085.501) (-1083.404) [-1082.433] * (-1084.664) (-1085.871) [-1082.762] (-1084.007) -- 0:00:45
357000 -- (-1084.959) [-1082.847] (-1085.127) (-1082.433) * (-1083.366) (-1086.246) [-1084.439] (-1084.985) -- 0:00:45
357500 -- (-1088.759) (-1083.576) [-1085.127] (-1084.396) * (-1083.006) (-1086.614) (-1085.648) [-1082.099] -- 0:00:44
358000 -- (-1084.317) (-1087.914) (-1082.114) [-1083.349] * (-1084.007) (-1085.432) [-1083.563] (-1083.756) -- 0:00:44
358500 -- (-1083.700) (-1084.933) [-1082.559] (-1082.565) * (-1083.872) (-1084.388) (-1082.364) [-1084.000] -- 0:00:44
359000 -- (-1084.193) [-1083.720] (-1082.003) (-1084.270) * (-1083.112) (-1083.275) [-1082.050] (-1087.365) -- 0:00:44
359500 -- [-1083.522] (-1082.767) (-1082.229) (-1087.547) * [-1081.851] (-1083.005) (-1084.287) (-1085.567) -- 0:00:44
360000 -- (-1081.985) [-1085.361] (-1082.985) (-1083.358) * [-1082.848] (-1084.121) (-1085.983) (-1087.234) -- 0:00:44
Average standard deviation of split frequencies: 0.015848
360500 -- (-1083.836) [-1088.167] (-1082.979) (-1084.115) * [-1082.563] (-1084.814) (-1084.439) (-1087.839) -- 0:00:44
361000 -- [-1083.917] (-1087.069) (-1083.051) (-1086.161) * (-1085.161) (-1088.398) [-1083.972] (-1084.801) -- 0:00:44
361500 -- [-1083.001] (-1084.310) (-1083.363) (-1083.205) * [-1082.774] (-1083.418) (-1086.991) (-1083.850) -- 0:00:44
362000 -- (-1085.961) [-1083.816] (-1083.724) (-1082.776) * (-1084.061) (-1084.758) [-1082.927] (-1082.905) -- 0:00:44
362500 -- (-1083.540) [-1083.839] (-1084.613) (-1082.886) * (-1084.660) [-1085.116] (-1084.045) (-1082.140) -- 0:00:45
363000 -- [-1085.496] (-1086.925) (-1082.920) (-1084.504) * (-1085.612) (-1084.477) [-1086.973] (-1087.242) -- 0:00:45
363500 -- (-1083.782) [-1085.942] (-1084.215) (-1083.976) * (-1084.040) (-1082.462) [-1089.165] (-1088.344) -- 0:00:45
364000 -- (-1082.171) [-1087.806] (-1083.037) (-1085.235) * [-1082.088] (-1082.826) (-1084.706) (-1087.025) -- 0:00:45
364500 -- (-1082.625) (-1086.198) [-1083.722] (-1086.447) * (-1083.342) (-1082.536) (-1085.525) [-1083.560] -- 0:00:45
365000 -- (-1083.171) (-1084.052) (-1083.506) [-1083.015] * (-1083.704) [-1083.055] (-1083.211) (-1082.727) -- 0:00:45
Average standard deviation of split frequencies: 0.015778
365500 -- (-1082.424) (-1088.381) [-1085.646] (-1082.882) * (-1082.998) (-1082.343) (-1083.762) [-1084.404] -- 0:00:45
366000 -- (-1084.585) (-1085.400) (-1085.995) [-1082.750] * (-1083.642) [-1083.580] (-1083.382) (-1083.698) -- 0:00:45
366500 -- (-1084.346) (-1082.711) [-1082.526] (-1082.707) * [-1083.635] (-1083.320) (-1088.121) (-1083.935) -- 0:00:44
367000 -- (-1082.732) (-1082.810) (-1082.401) [-1083.192] * (-1083.741) (-1089.348) [-1087.899] (-1084.696) -- 0:00:44
367500 -- (-1082.109) (-1082.810) [-1083.131] (-1083.740) * [-1085.025] (-1085.687) (-1085.305) (-1084.984) -- 0:00:44
368000 -- (-1086.679) [-1082.610] (-1083.434) (-1085.872) * (-1082.586) (-1084.927) [-1083.007] (-1083.757) -- 0:00:44
368500 -- (-1083.693) (-1081.891) (-1083.190) [-1082.727] * [-1087.253] (-1084.193) (-1084.562) (-1084.364) -- 0:00:44
369000 -- (-1086.348) (-1082.293) (-1082.835) [-1084.408] * (-1085.306) (-1084.698) [-1086.942] (-1082.275) -- 0:00:44
369500 -- (-1087.345) (-1083.534) (-1085.239) [-1084.106] * [-1087.187] (-1083.159) (-1083.425) (-1084.605) -- 0:00:44
370000 -- (-1086.740) [-1085.482] (-1086.748) (-1083.526) * (-1086.262) (-1084.503) [-1082.194] (-1081.821) -- 0:00:44
Average standard deviation of split frequencies: 0.015659
370500 -- (-1087.267) [-1083.077] (-1084.961) (-1084.020) * [-1081.639] (-1084.508) (-1082.194) (-1082.138) -- 0:00:44
371000 -- (-1085.733) [-1082.973] (-1083.240) (-1086.665) * (-1085.632) [-1085.377] (-1083.791) (-1082.514) -- 0:00:44
371500 -- (-1082.834) (-1083.037) [-1085.656] (-1084.334) * (-1082.797) (-1084.367) (-1085.035) [-1082.628] -- 0:00:43
372000 -- (-1086.393) (-1086.052) (-1088.104) [-1083.296] * (-1086.376) (-1082.216) [-1084.911] (-1084.223) -- 0:00:43
372500 -- (-1083.157) (-1084.615) [-1086.045] (-1082.900) * (-1085.738) (-1084.289) [-1082.586] (-1083.032) -- 0:00:43
373000 -- (-1085.655) (-1086.664) (-1088.649) [-1082.563] * (-1084.567) (-1084.381) (-1083.610) [-1085.845] -- 0:00:43
373500 -- [-1083.675] (-1082.206) (-1082.660) (-1086.982) * (-1084.436) (-1081.821) [-1085.552] (-1084.831) -- 0:00:43
374000 -- (-1086.835) [-1082.206] (-1086.776) (-1090.430) * (-1083.553) (-1081.821) (-1083.948) [-1084.893] -- 0:00:43
374500 -- (-1083.063) (-1084.565) [-1087.366] (-1083.980) * [-1084.393] (-1082.459) (-1084.516) (-1083.027) -- 0:00:43
375000 -- (-1085.179) (-1082.495) [-1083.862] (-1086.232) * (-1085.311) (-1083.798) (-1083.012) [-1083.275] -- 0:00:43
Average standard deviation of split frequencies: 0.015750
375500 -- (-1086.118) (-1086.272) [-1084.212] (-1084.214) * (-1082.097) [-1083.966] (-1082.958) (-1084.419) -- 0:00:43
376000 -- [-1083.923] (-1082.968) (-1084.828) (-1084.184) * [-1086.342] (-1083.538) (-1083.129) (-1083.945) -- 0:00:43
376500 -- (-1085.755) (-1082.617) [-1084.791] (-1084.211) * (-1089.207) (-1083.335) (-1082.665) [-1084.317] -- 0:00:43
377000 -- (-1083.342) (-1083.721) [-1086.225] (-1083.445) * [-1085.347] (-1083.699) (-1087.567) (-1083.227) -- 0:00:42
377500 -- (-1084.267) [-1082.850] (-1084.404) (-1084.330) * (-1084.524) (-1091.206) (-1085.562) [-1083.281] -- 0:00:42
378000 -- (-1083.731) (-1084.091) (-1085.607) [-1082.682] * [-1083.679] (-1084.416) (-1083.298) (-1085.311) -- 0:00:44
378500 -- (-1083.069) (-1085.728) [-1086.472] (-1085.727) * (-1083.954) (-1083.935) [-1084.832] (-1083.539) -- 0:00:44
379000 -- (-1084.390) (-1083.779) [-1082.685] (-1086.902) * (-1083.258) (-1083.907) [-1084.045] (-1083.079) -- 0:00:44
379500 -- (-1085.072) (-1083.912) [-1083.735] (-1085.171) * (-1086.240) [-1084.263] (-1086.946) (-1082.171) -- 0:00:44
380000 -- [-1083.993] (-1083.736) (-1083.809) (-1084.673) * (-1083.246) (-1082.197) (-1085.472) [-1082.704] -- 0:00:44
Average standard deviation of split frequencies: 0.014938
380500 -- (-1082.567) [-1085.625] (-1084.052) (-1083.268) * (-1084.697) [-1082.694] (-1091.532) (-1085.713) -- 0:00:43
381000 -- (-1082.306) [-1082.669] (-1087.107) (-1083.028) * (-1086.804) (-1085.106) (-1082.254) [-1083.054] -- 0:00:43
381500 -- (-1082.416) (-1086.637) [-1082.588] (-1083.563) * (-1083.872) (-1087.490) (-1090.889) [-1085.773] -- 0:00:43
382000 -- [-1084.462] (-1086.776) (-1082.801) (-1084.883) * (-1084.917) (-1083.379) [-1084.328] (-1082.624) -- 0:00:43
382500 -- (-1082.644) (-1089.924) [-1084.840] (-1084.229) * (-1083.912) [-1084.581] (-1083.509) (-1083.241) -- 0:00:43
383000 -- (-1083.975) [-1083.208] (-1083.787) (-1083.358) * (-1083.807) (-1086.041) (-1086.572) [-1085.373] -- 0:00:43
383500 -- (-1083.970) [-1084.311] (-1086.281) (-1083.931) * (-1084.688) (-1087.316) (-1086.671) [-1083.174] -- 0:00:43
384000 -- (-1089.670) (-1088.254) (-1084.310) [-1082.977] * (-1082.107) (-1088.261) [-1083.082] (-1084.658) -- 0:00:43
384500 -- [-1087.975] (-1084.470) (-1082.756) (-1083.974) * [-1084.415] (-1086.483) (-1082.272) (-1084.915) -- 0:00:43
385000 -- (-1088.383) [-1083.101] (-1082.567) (-1083.620) * (-1084.676) (-1086.642) (-1083.488) [-1084.964] -- 0:00:43
Average standard deviation of split frequencies: 0.014197
385500 -- [-1084.390] (-1089.053) (-1089.046) (-1083.308) * (-1083.340) (-1083.929) (-1083.394) [-1085.175] -- 0:00:43
386000 -- (-1082.256) (-1082.380) [-1082.768] (-1084.749) * (-1082.557) (-1082.047) [-1082.765] (-1083.900) -- 0:00:42
386500 -- (-1082.442) (-1083.548) [-1086.059] (-1086.013) * (-1086.207) (-1084.035) [-1082.935] (-1082.584) -- 0:00:42
387000 -- [-1082.323] (-1083.567) (-1083.486) (-1083.545) * [-1081.886] (-1091.904) (-1083.840) (-1082.560) -- 0:00:42
387500 -- (-1083.609) (-1086.020) (-1086.743) [-1082.736] * [-1082.939] (-1088.682) (-1082.040) (-1086.678) -- 0:00:42
388000 -- [-1083.543] (-1088.014) (-1085.662) (-1082.116) * [-1083.231] (-1088.956) (-1085.410) (-1083.663) -- 0:00:42
388500 -- (-1081.797) (-1086.536) (-1083.852) [-1084.324] * [-1083.442] (-1083.571) (-1085.516) (-1085.480) -- 0:00:42
389000 -- (-1082.726) (-1082.428) (-1085.070) [-1083.973] * (-1083.813) (-1082.056) [-1085.612] (-1088.096) -- 0:00:42
389500 -- (-1085.956) (-1084.122) [-1084.457] (-1084.447) * (-1083.661) [-1082.519] (-1084.223) (-1087.348) -- 0:00:42
390000 -- (-1084.294) (-1083.543) (-1083.172) [-1085.886] * [-1082.056] (-1085.919) (-1085.030) (-1087.538) -- 0:00:42
Average standard deviation of split frequencies: 0.013349
390500 -- (-1088.025) (-1083.146) (-1084.983) [-1083.925] * (-1082.337) (-1082.937) [-1083.574] (-1087.800) -- 0:00:42
391000 -- [-1086.884] (-1084.133) (-1083.022) (-1083.559) * (-1089.437) (-1083.899) [-1084.068] (-1087.607) -- 0:00:42
391500 -- (-1086.625) (-1084.465) (-1083.297) [-1084.020] * (-1088.475) [-1082.542] (-1086.968) (-1084.149) -- 0:00:41
392000 -- (-1085.145) (-1085.736) (-1082.358) [-1083.728] * (-1083.725) (-1082.876) (-1081.806) [-1083.896] -- 0:00:41
392500 -- (-1083.313) (-1085.928) (-1082.763) [-1083.900] * [-1086.777] (-1084.375) (-1084.645) (-1083.102) -- 0:00:41
393000 -- [-1082.049] (-1082.551) (-1081.728) (-1082.850) * (-1085.573) (-1084.343) [-1085.324] (-1085.949) -- 0:00:41
393500 -- (-1083.999) [-1082.570] (-1085.312) (-1084.111) * (-1087.060) (-1083.854) (-1083.224) [-1084.091] -- 0:00:41
394000 -- (-1083.286) [-1082.046] (-1083.476) (-1083.682) * (-1082.562) (-1082.528) (-1085.967) [-1083.484] -- 0:00:43
394500 -- (-1082.089) [-1083.624] (-1082.437) (-1084.528) * [-1082.178] (-1083.399) (-1085.132) (-1086.225) -- 0:00:42
395000 -- (-1086.061) (-1082.965) [-1082.420] (-1083.530) * [-1083.821] (-1083.066) (-1086.246) (-1083.773) -- 0:00:42
Average standard deviation of split frequencies: 0.013095
395500 -- (-1085.458) [-1082.955] (-1083.821) (-1083.994) * (-1086.507) (-1083.990) [-1083.268] (-1083.817) -- 0:00:42
396000 -- (-1084.646) (-1083.364) [-1085.528] (-1084.089) * (-1085.796) [-1083.617] (-1085.698) (-1083.463) -- 0:00:42
396500 -- (-1084.887) (-1082.225) [-1083.301] (-1084.494) * (-1083.322) (-1083.094) [-1083.958] (-1084.857) -- 0:00:42
397000 -- [-1084.160] (-1085.676) (-1084.918) (-1083.029) * (-1082.983) (-1082.625) [-1083.135] (-1085.909) -- 0:00:42
397500 -- (-1083.675) (-1088.500) [-1085.772] (-1087.315) * (-1082.666) (-1084.914) (-1082.818) [-1083.439] -- 0:00:42
398000 -- [-1083.458] (-1085.753) (-1085.224) (-1082.795) * [-1084.263] (-1082.986) (-1083.863) (-1082.944) -- 0:00:42
398500 -- [-1082.761] (-1083.058) (-1086.764) (-1082.849) * (-1085.018) (-1083.396) (-1085.456) [-1083.015] -- 0:00:42
399000 -- (-1083.159) [-1084.393] (-1082.803) (-1083.180) * (-1085.239) (-1084.479) (-1083.075) [-1082.135] -- 0:00:42
399500 -- [-1083.182] (-1083.207) (-1083.438) (-1083.648) * (-1084.294) (-1084.555) (-1082.402) [-1086.054] -- 0:00:42
400000 -- (-1083.730) [-1084.732] (-1083.621) (-1081.968) * (-1085.157) (-1087.342) (-1082.636) [-1087.616] -- 0:00:41
Average standard deviation of split frequencies: 0.013016
400500 -- (-1084.394) (-1084.867) [-1082.563] (-1081.969) * (-1084.382) (-1086.910) (-1082.623) [-1091.318] -- 0:00:41
401000 -- [-1083.240] (-1085.248) (-1084.749) (-1082.584) * (-1085.806) (-1082.783) [-1082.641] (-1086.859) -- 0:00:41
401500 -- (-1083.242) (-1083.294) [-1088.894] (-1082.959) * (-1085.133) (-1086.453) [-1083.671] (-1083.451) -- 0:00:41
402000 -- (-1084.502) (-1083.428) (-1085.303) [-1084.053] * [-1083.037] (-1084.371) (-1085.155) (-1084.015) -- 0:00:41
402500 -- [-1085.999] (-1087.727) (-1085.576) (-1085.126) * [-1082.190] (-1083.576) (-1083.217) (-1086.480) -- 0:00:41
403000 -- (-1084.474) (-1082.555) (-1087.529) [-1083.607] * (-1084.017) (-1086.904) [-1082.576] (-1084.273) -- 0:00:41
403500 -- (-1085.276) (-1082.625) (-1083.938) [-1082.931] * (-1083.481) (-1085.388) [-1084.014] (-1082.844) -- 0:00:41
404000 -- [-1084.366] (-1082.329) (-1084.572) (-1084.767) * [-1082.373] (-1082.610) (-1086.761) (-1082.407) -- 0:00:41
404500 -- (-1084.533) (-1084.939) (-1086.584) [-1084.000] * (-1083.422) [-1082.444] (-1086.587) (-1083.656) -- 0:00:41
405000 -- (-1084.826) [-1083.845] (-1086.064) (-1082.348) * (-1082.515) (-1083.086) (-1085.893) [-1083.932] -- 0:00:41
Average standard deviation of split frequencies: 0.012917
405500 -- (-1087.793) (-1085.807) (-1085.128) [-1084.454] * (-1082.308) (-1084.311) [-1087.631] (-1084.568) -- 0:00:41
406000 -- (-1082.708) [-1084.679] (-1083.718) (-1083.125) * (-1082.308) (-1089.040) [-1082.202] (-1084.570) -- 0:00:40
406500 -- (-1082.724) (-1087.918) [-1084.816] (-1083.529) * (-1084.896) (-1084.365) [-1082.558] (-1083.736) -- 0:00:40
407000 -- (-1084.844) (-1083.671) [-1085.398] (-1085.293) * (-1082.693) (-1083.487) (-1082.065) [-1084.402] -- 0:00:40
407500 -- (-1082.482) (-1083.683) [-1085.406] (-1085.408) * (-1083.294) (-1084.263) (-1082.399) [-1084.504] -- 0:00:40
408000 -- [-1085.064] (-1082.643) (-1083.460) (-1083.117) * (-1084.786) (-1082.419) (-1084.348) [-1083.411] -- 0:00:40
408500 -- (-1084.776) (-1083.213) (-1083.201) [-1085.219] * [-1083.231] (-1083.722) (-1082.284) (-1083.358) -- 0:00:40
409000 -- (-1083.981) (-1083.090) [-1083.114] (-1086.562) * [-1083.238] (-1085.532) (-1082.002) (-1082.852) -- 0:00:40
409500 -- (-1090.273) (-1083.742) [-1082.452] (-1083.268) * (-1087.563) [-1084.704] (-1082.127) (-1082.957) -- 0:00:40
410000 -- [-1085.067] (-1082.302) (-1083.302) (-1082.636) * (-1082.883) (-1082.733) (-1085.685) [-1084.634] -- 0:00:41
Average standard deviation of split frequencies: 0.013488
410500 -- (-1082.589) [-1082.254] (-1084.142) (-1084.257) * [-1083.274] (-1084.679) (-1087.588) (-1084.910) -- 0:00:41
411000 -- (-1084.308) [-1081.828] (-1083.529) (-1083.094) * [-1085.889] (-1083.576) (-1084.478) (-1083.185) -- 0:00:41
411500 -- (-1084.302) (-1082.011) [-1084.389] (-1082.938) * (-1085.228) [-1081.749] (-1089.298) (-1083.824) -- 0:00:41
412000 -- (-1086.820) (-1084.885) [-1084.410] (-1083.542) * [-1085.747] (-1083.685) (-1083.906) (-1084.737) -- 0:00:41
412500 -- (-1084.030) (-1084.797) [-1087.750] (-1084.657) * (-1082.863) (-1081.740) (-1082.962) [-1083.503] -- 0:00:41
413000 -- (-1085.142) (-1084.901) [-1085.846] (-1087.009) * (-1082.620) (-1082.644) (-1083.668) [-1082.857] -- 0:00:41
413500 -- (-1083.884) (-1084.294) [-1085.149] (-1084.781) * (-1084.177) (-1082.652) [-1089.117] (-1083.193) -- 0:00:41
414000 -- (-1082.903) (-1084.957) [-1084.987] (-1083.069) * (-1083.642) (-1082.375) (-1088.293) [-1084.479] -- 0:00:41
414500 -- (-1084.287) (-1083.848) [-1084.231] (-1084.779) * (-1083.773) [-1087.434] (-1088.515) (-1084.646) -- 0:00:40
415000 -- (-1083.165) (-1085.796) (-1084.743) [-1083.958] * [-1083.182] (-1083.430) (-1084.020) (-1085.873) -- 0:00:40
Average standard deviation of split frequencies: 0.013102
415500 -- (-1085.864) (-1083.508) [-1082.800] (-1084.487) * (-1083.053) [-1082.887] (-1086.249) (-1087.000) -- 0:00:40
416000 -- (-1088.179) (-1085.183) [-1082.903] (-1084.001) * (-1085.117) [-1082.887] (-1085.364) (-1085.957) -- 0:00:40
416500 -- (-1085.543) (-1083.656) (-1082.197) [-1085.231] * (-1086.673) (-1088.529) [-1083.252] (-1087.943) -- 0:00:40
417000 -- (-1086.269) [-1083.731] (-1083.619) (-1082.219) * (-1083.286) (-1085.493) [-1085.812] (-1085.885) -- 0:00:40
417500 -- (-1088.604) (-1085.662) (-1083.726) [-1083.647] * (-1081.530) (-1084.330) [-1083.856] (-1083.775) -- 0:00:40
418000 -- (-1087.421) (-1086.127) [-1082.207] (-1086.563) * [-1084.994] (-1084.292) (-1086.553) (-1084.999) -- 0:00:40
418500 -- (-1086.736) [-1083.599] (-1082.564) (-1084.552) * (-1085.268) [-1084.054] (-1088.642) (-1085.421) -- 0:00:40
419000 -- (-1085.194) (-1084.639) [-1085.169] (-1083.284) * (-1081.886) [-1084.254] (-1082.945) (-1086.029) -- 0:00:40
419500 -- (-1082.605) [-1083.236] (-1083.209) (-1085.830) * (-1081.889) (-1083.695) (-1084.617) [-1085.007] -- 0:00:40
420000 -- (-1083.504) (-1083.755) (-1085.313) [-1083.306] * (-1085.809) (-1084.231) (-1085.494) [-1083.868] -- 0:00:40
Average standard deviation of split frequencies: 0.012677
420500 -- [-1085.737] (-1084.127) (-1081.855) (-1084.426) * [-1084.477] (-1081.935) (-1085.187) (-1086.759) -- 0:00:39
421000 -- (-1083.915) (-1084.751) (-1082.118) [-1083.525] * (-1082.624) (-1083.519) [-1084.888] (-1083.088) -- 0:00:39
421500 -- (-1084.721) (-1085.511) (-1083.117) [-1082.875] * (-1083.571) (-1088.504) [-1082.039] (-1086.587) -- 0:00:39
422000 -- (-1087.903) (-1084.447) [-1082.224] (-1088.953) * (-1084.849) (-1083.244) [-1084.215] (-1090.455) -- 0:00:39
422500 -- (-1086.246) (-1088.467) [-1083.098] (-1094.591) * (-1083.184) [-1082.154] (-1082.567) (-1087.148) -- 0:00:39
423000 -- (-1084.045) (-1083.721) (-1084.661) [-1082.155] * (-1081.946) (-1085.026) [-1082.577] (-1084.886) -- 0:00:39
423500 -- (-1083.408) (-1085.800) [-1084.195] (-1083.007) * (-1081.873) (-1084.031) (-1084.651) [-1083.573] -- 0:00:39
424000 -- (-1082.658) (-1086.424) [-1083.925] (-1085.033) * [-1082.610] (-1082.641) (-1084.432) (-1082.862) -- 0:00:39
424500 -- (-1083.449) [-1083.716] (-1083.600) (-1086.059) * (-1083.215) [-1083.233] (-1085.236) (-1083.162) -- 0:00:39
425000 -- (-1083.819) (-1085.855) (-1083.121) [-1083.635] * (-1084.395) [-1083.473] (-1087.160) (-1087.314) -- 0:00:39
Average standard deviation of split frequencies: 0.013002
425500 -- [-1083.226] (-1082.052) (-1084.001) (-1091.189) * (-1084.738) (-1085.021) (-1082.928) [-1086.551] -- 0:00:39
426000 -- (-1083.531) (-1082.057) [-1083.857] (-1082.773) * (-1083.383) (-1085.891) [-1083.688] (-1083.016) -- 0:00:40
426500 -- (-1087.013) [-1083.201] (-1084.290) (-1086.407) * (-1083.443) [-1084.204] (-1084.096) (-1082.478) -- 0:00:40
427000 -- (-1088.542) [-1084.241] (-1085.250) (-1082.964) * (-1085.314) (-1086.418) (-1082.082) [-1083.048] -- 0:00:40
427500 -- (-1085.641) (-1083.671) [-1082.880] (-1083.751) * (-1085.057) (-1085.270) [-1083.829] (-1082.541) -- 0:00:40
428000 -- (-1084.742) [-1087.615] (-1081.977) (-1083.711) * (-1084.136) (-1082.601) (-1082.620) [-1082.718] -- 0:00:40
428500 -- [-1084.704] (-1090.785) (-1083.614) (-1085.492) * (-1085.131) [-1081.903] (-1083.475) (-1083.110) -- 0:00:40
429000 -- (-1088.866) [-1087.442] (-1083.842) (-1086.175) * (-1085.220) (-1082.299) [-1082.365] (-1085.923) -- 0:00:39
429500 -- (-1084.147) (-1084.392) (-1084.557) [-1085.322] * (-1084.976) (-1082.170) [-1082.495] (-1083.895) -- 0:00:39
430000 -- (-1083.564) (-1084.070) [-1082.322] (-1082.351) * (-1084.536) (-1083.104) [-1083.770] (-1084.782) -- 0:00:39
Average standard deviation of split frequencies: 0.012314
430500 -- [-1085.223] (-1085.176) (-1083.683) (-1083.797) * (-1084.411) (-1082.403) [-1084.817] (-1086.815) -- 0:00:39
431000 -- (-1083.692) [-1087.039] (-1084.258) (-1084.767) * [-1082.829] (-1083.264) (-1085.511) (-1088.738) -- 0:00:39
431500 -- [-1082.938] (-1084.831) (-1083.700) (-1082.023) * [-1084.444] (-1091.435) (-1085.861) (-1084.891) -- 0:00:39
432000 -- [-1084.137] (-1085.133) (-1086.706) (-1081.875) * (-1085.529) (-1085.839) [-1088.636] (-1084.133) -- 0:00:39
432500 -- [-1085.902] (-1083.261) (-1084.121) (-1082.312) * (-1082.911) [-1085.906] (-1082.453) (-1083.451) -- 0:00:39
433000 -- (-1086.310) (-1082.501) (-1083.026) [-1085.657] * (-1082.102) (-1086.107) [-1082.366] (-1084.146) -- 0:00:39
433500 -- (-1088.134) [-1083.867] (-1084.403) (-1083.388) * (-1082.872) [-1085.272] (-1083.951) (-1084.283) -- 0:00:39
434000 -- (-1082.799) (-1082.408) [-1087.440] (-1082.328) * [-1083.382] (-1085.338) (-1082.298) (-1083.336) -- 0:00:39
434500 -- [-1082.148] (-1084.030) (-1086.462) (-1083.255) * (-1086.419) (-1083.130) [-1083.659] (-1085.599) -- 0:00:39
435000 -- (-1084.811) [-1082.297] (-1084.035) (-1083.959) * (-1081.998) (-1087.252) (-1083.033) [-1083.198] -- 0:00:38
Average standard deviation of split frequencies: 0.012501
435500 -- (-1086.840) (-1083.028) (-1082.568) [-1088.957] * (-1083.814) [-1087.776] (-1081.898) (-1083.484) -- 0:00:38
436000 -- [-1083.684] (-1082.581) (-1083.692) (-1086.503) * (-1083.150) [-1085.981] (-1082.243) (-1088.029) -- 0:00:38
436500 -- [-1083.305] (-1082.610) (-1084.582) (-1084.196) * (-1085.302) (-1084.565) (-1082.912) [-1091.531] -- 0:00:38
437000 -- (-1087.851) [-1082.301] (-1088.350) (-1084.196) * (-1084.971) (-1082.998) (-1086.330) [-1082.898] -- 0:00:38
437500 -- [-1089.033] (-1082.812) (-1090.057) (-1083.691) * (-1085.403) (-1082.786) (-1083.756) [-1082.254] -- 0:00:38
438000 -- (-1082.880) [-1083.680] (-1092.266) (-1082.413) * (-1086.479) [-1082.686] (-1082.225) (-1083.176) -- 0:00:38
438500 -- [-1084.343] (-1082.260) (-1088.242) (-1084.254) * [-1086.344] (-1082.936) (-1083.617) (-1086.996) -- 0:00:38
439000 -- (-1084.129) (-1084.703) [-1082.549] (-1084.251) * (-1087.048) (-1082.572) (-1085.905) [-1084.967] -- 0:00:38
439500 -- [-1083.296] (-1086.802) (-1084.703) (-1084.565) * (-1086.199) (-1085.871) (-1084.873) [-1082.764] -- 0:00:38
440000 -- (-1088.954) (-1088.301) (-1085.288) [-1082.260] * [-1085.107] (-1086.249) (-1085.882) (-1083.710) -- 0:00:38
Average standard deviation of split frequencies: 0.012035
440500 -- (-1084.205) [-1085.280] (-1083.943) (-1082.404) * [-1082.321] (-1086.477) (-1088.857) (-1084.051) -- 0:00:38
441000 -- (-1083.059) (-1089.296) (-1083.625) [-1082.648] * (-1085.202) (-1085.129) (-1082.597) [-1083.885] -- 0:00:38
441500 -- (-1083.200) (-1084.768) [-1082.642] (-1082.140) * [-1085.166] (-1082.711) (-1082.266) (-1083.964) -- 0:00:37
442000 -- [-1083.327] (-1081.746) (-1084.577) (-1082.967) * (-1082.813) (-1084.410) [-1083.659] (-1084.166) -- 0:00:37
442500 -- (-1087.795) (-1086.488) (-1084.451) [-1083.867] * (-1082.935) (-1086.034) [-1082.465] (-1083.164) -- 0:00:39
443000 -- (-1083.045) (-1084.869) [-1082.918] (-1087.484) * [-1082.597] (-1083.312) (-1082.386) (-1083.278) -- 0:00:38
443500 -- (-1083.392) (-1084.366) (-1083.314) [-1084.080] * [-1084.958] (-1084.500) (-1083.586) (-1085.419) -- 0:00:38
444000 -- (-1083.197) (-1084.834) [-1083.312] (-1084.207) * (-1086.787) [-1084.667] (-1085.872) (-1087.414) -- 0:00:38
444500 -- (-1084.615) (-1088.291) (-1081.879) [-1084.347] * [-1084.702] (-1083.517) (-1093.229) (-1085.724) -- 0:00:38
445000 -- (-1085.607) (-1084.280) (-1082.217) [-1084.583] * (-1084.472) (-1082.435) [-1083.807] (-1085.339) -- 0:00:38
Average standard deviation of split frequencies: 0.011759
445500 -- (-1083.040) [-1083.811] (-1081.813) (-1085.543) * (-1083.294) (-1085.109) [-1082.725] (-1083.314) -- 0:00:38
446000 -- (-1084.707) [-1084.640] (-1086.665) (-1083.878) * (-1082.210) (-1088.351) [-1083.951] (-1084.563) -- 0:00:38
446500 -- (-1081.622) (-1083.934) [-1083.130] (-1083.278) * (-1086.150) (-1086.514) [-1082.963] (-1083.437) -- 0:00:38
447000 -- (-1083.498) [-1085.733] (-1084.579) (-1082.523) * [-1082.788] (-1088.531) (-1084.446) (-1085.984) -- 0:00:38
447500 -- [-1084.650] (-1087.248) (-1082.743) (-1082.417) * [-1081.890] (-1084.009) (-1088.711) (-1088.659) -- 0:00:38
448000 -- (-1084.194) (-1092.577) [-1083.402] (-1085.129) * (-1081.869) (-1082.995) (-1086.229) [-1082.758] -- 0:00:38
448500 -- (-1083.934) (-1089.646) (-1083.038) [-1084.153] * (-1083.431) [-1083.587] (-1087.720) (-1082.308) -- 0:00:38
449000 -- [-1083.202] (-1090.409) (-1081.981) (-1084.486) * (-1082.743) (-1082.938) (-1089.214) [-1086.615] -- 0:00:38
449500 -- [-1084.760] (-1086.217) (-1083.690) (-1086.882) * [-1084.774] (-1083.032) (-1084.364) (-1086.749) -- 0:00:37
450000 -- (-1083.247) (-1085.285) [-1087.647] (-1086.350) * (-1086.339) (-1084.934) [-1084.858] (-1085.295) -- 0:00:37
Average standard deviation of split frequencies: 0.012487
450500 -- [-1085.939] (-1083.682) (-1085.488) (-1083.109) * [-1083.630] (-1084.444) (-1083.009) (-1084.334) -- 0:00:37
451000 -- (-1094.278) (-1082.873) (-1082.154) [-1085.527] * [-1085.018] (-1083.603) (-1084.554) (-1085.870) -- 0:00:37
451500 -- (-1084.111) (-1082.912) (-1083.529) [-1084.001] * [-1086.580] (-1082.386) (-1084.093) (-1082.102) -- 0:00:37
452000 -- (-1084.415) [-1083.572] (-1083.042) (-1084.153) * (-1082.340) [-1085.232] (-1083.895) (-1085.423) -- 0:00:37
452500 -- (-1086.431) (-1084.832) (-1084.223) [-1085.989] * (-1088.785) [-1082.380] (-1085.006) (-1083.326) -- 0:00:37
453000 -- (-1089.229) (-1084.600) [-1085.645] (-1084.100) * [-1086.251] (-1082.146) (-1083.879) (-1083.362) -- 0:00:37
453500 -- (-1085.542) (-1084.454) (-1084.558) [-1083.317] * [-1084.280] (-1082.579) (-1082.659) (-1083.871) -- 0:00:37
454000 -- (-1082.393) (-1084.808) [-1082.754] (-1083.506) * [-1084.501] (-1083.554) (-1083.370) (-1082.775) -- 0:00:37
454500 -- [-1082.748] (-1082.896) (-1083.727) (-1082.565) * (-1084.728) (-1081.990) [-1083.189] (-1085.336) -- 0:00:37
455000 -- (-1086.097) (-1084.520) (-1084.706) [-1083.081] * (-1083.109) (-1084.292) (-1083.752) [-1085.364] -- 0:00:37
Average standard deviation of split frequencies: 0.011858
455500 -- (-1084.527) (-1082.708) (-1085.514) [-1082.634] * [-1082.701] (-1084.418) (-1083.589) (-1088.531) -- 0:00:37
456000 -- (-1086.326) [-1084.472] (-1086.413) (-1082.195) * (-1082.313) [-1082.435] (-1086.105) (-1082.203) -- 0:00:36
456500 -- (-1083.597) [-1083.968] (-1082.155) (-1086.548) * (-1086.311) (-1083.952) [-1085.326] (-1084.573) -- 0:00:36
457000 -- (-1083.018) [-1083.723] (-1082.392) (-1083.877) * (-1088.111) (-1086.257) (-1086.263) [-1082.228] -- 0:00:36
457500 -- [-1085.215] (-1085.704) (-1084.316) (-1084.478) * (-1086.129) (-1083.286) (-1092.964) [-1082.872] -- 0:00:36
458000 -- (-1082.266) (-1089.363) [-1085.139] (-1085.418) * (-1086.045) (-1082.164) [-1082.271] (-1081.981) -- 0:00:36
458500 -- (-1085.214) [-1083.697] (-1084.387) (-1087.874) * [-1082.990] (-1087.172) (-1086.130) (-1085.770) -- 0:00:36
459000 -- (-1085.336) [-1083.769] (-1087.612) (-1090.538) * (-1087.642) [-1090.292] (-1090.192) (-1083.345) -- 0:00:37
459500 -- (-1083.221) (-1082.648) (-1085.370) [-1083.143] * (-1082.403) (-1086.941) [-1084.389] (-1084.011) -- 0:00:37
460000 -- [-1083.180] (-1083.991) (-1087.136) (-1084.280) * [-1083.055] (-1083.928) (-1084.119) (-1082.953) -- 0:00:37
Average standard deviation of split frequencies: 0.011979
460500 -- (-1083.196) (-1083.704) (-1082.975) [-1086.181] * (-1084.350) (-1084.156) [-1083.068] (-1084.029) -- 0:00:37
461000 -- [-1083.502] (-1083.085) (-1084.352) (-1085.005) * (-1085.620) (-1083.225) (-1082.434) [-1082.658] -- 0:00:37
461500 -- (-1083.927) (-1083.273) (-1082.589) [-1084.210] * (-1087.846) (-1082.522) (-1082.214) [-1085.627] -- 0:00:37
462000 -- (-1084.016) (-1082.797) [-1082.506] (-1088.002) * (-1085.420) [-1082.165] (-1084.870) (-1085.771) -- 0:00:37
462500 -- (-1083.251) (-1084.407) [-1082.205] (-1089.778) * (-1083.590) (-1081.793) (-1082.835) [-1086.212] -- 0:00:37
463000 -- (-1083.847) (-1082.160) (-1082.839) [-1088.326] * (-1084.825) (-1081.792) [-1083.562] (-1084.211) -- 0:00:37
463500 -- (-1084.710) (-1082.306) (-1083.145) [-1085.304] * (-1084.770) [-1084.796] (-1087.134) (-1082.779) -- 0:00:37
464000 -- (-1086.858) (-1082.655) [-1083.733] (-1083.350) * (-1082.782) [-1083.412] (-1089.385) (-1083.215) -- 0:00:36
464500 -- [-1086.692] (-1081.770) (-1083.160) (-1082.647) * [-1082.627] (-1083.908) (-1087.267) (-1082.892) -- 0:00:36
465000 -- (-1085.689) (-1086.984) (-1085.053) [-1083.019] * (-1082.551) [-1084.765] (-1083.973) (-1083.091) -- 0:00:36
Average standard deviation of split frequencies: 0.011001
465500 -- (-1083.955) (-1089.078) [-1085.122] (-1083.821) * (-1084.728) (-1084.480) (-1084.910) [-1083.773] -- 0:00:36
466000 -- (-1083.436) [-1089.151] (-1083.940) (-1083.796) * (-1092.657) (-1085.076) [-1087.758] (-1083.963) -- 0:00:36
466500 -- (-1085.162) (-1083.356) (-1085.686) [-1085.536] * (-1083.210) [-1082.580] (-1083.322) (-1083.016) -- 0:00:36
467000 -- (-1082.842) (-1083.031) (-1084.941) [-1083.032] * (-1081.884) (-1082.276) [-1085.750] (-1083.176) -- 0:00:36
467500 -- (-1083.409) (-1086.616) [-1083.994] (-1082.469) * [-1082.730] (-1084.183) (-1086.244) (-1083.058) -- 0:00:36
468000 -- (-1082.356) (-1081.866) (-1087.197) [-1083.972] * (-1087.503) (-1085.086) [-1084.000] (-1082.572) -- 0:00:36
468500 -- (-1084.390) [-1081.686] (-1087.585) (-1084.225) * [-1085.263] (-1082.320) (-1082.306) (-1087.529) -- 0:00:36
469000 -- (-1083.789) (-1085.120) [-1083.213] (-1084.806) * (-1082.563) (-1082.324) [-1082.304] (-1083.854) -- 0:00:36
469500 -- (-1083.789) (-1085.573) (-1083.872) [-1086.143] * [-1083.488] (-1082.853) (-1081.902) (-1083.269) -- 0:00:36
470000 -- [-1083.548] (-1085.414) (-1087.425) (-1084.874) * [-1084.467] (-1083.781) (-1083.194) (-1086.315) -- 0:00:36
Average standard deviation of split frequencies: 0.011393
470500 -- (-1083.052) (-1082.306) [-1082.913] (-1082.737) * (-1084.174) (-1085.750) (-1082.943) [-1084.857] -- 0:00:36
471000 -- (-1083.878) [-1082.643] (-1083.937) (-1082.837) * (-1089.177) (-1089.214) (-1082.114) [-1082.223] -- 0:00:35
471500 -- (-1084.099) [-1082.027] (-1083.235) (-1082.253) * (-1091.250) (-1083.808) [-1081.906] (-1083.818) -- 0:00:35
472000 -- (-1084.391) [-1082.847] (-1083.126) (-1082.229) * (-1085.196) (-1083.389) [-1083.433] (-1082.902) -- 0:00:35
472500 -- [-1084.226] (-1083.409) (-1087.437) (-1089.632) * (-1082.645) (-1085.000) (-1084.865) [-1084.978] -- 0:00:35
473000 -- (-1083.737) [-1084.182] (-1083.656) (-1090.648) * (-1087.732) [-1082.402] (-1084.497) (-1084.320) -- 0:00:35
473500 -- [-1081.863] (-1083.992) (-1083.310) (-1084.673) * (-1089.089) [-1082.789] (-1086.603) (-1086.049) -- 0:00:35
474000 -- [-1084.230] (-1084.213) (-1084.375) (-1086.413) * (-1090.697) (-1082.303) [-1084.509] (-1083.342) -- 0:00:35
474500 -- (-1083.733) (-1082.288) (-1086.252) [-1083.709] * [-1083.275] (-1083.464) (-1087.508) (-1085.965) -- 0:00:35
475000 -- (-1082.790) (-1085.509) (-1083.630) [-1082.276] * [-1084.926] (-1083.674) (-1084.137) (-1083.014) -- 0:00:36
Average standard deviation of split frequencies: 0.011141
475500 -- [-1081.542] (-1084.891) (-1082.928) (-1083.246) * (-1084.969) (-1082.523) [-1084.715] (-1083.014) -- 0:00:36
476000 -- (-1081.679) (-1085.657) [-1082.862] (-1084.878) * (-1083.498) (-1084.609) (-1082.770) [-1082.812] -- 0:00:36
476500 -- [-1081.678] (-1083.928) (-1084.389) (-1081.926) * (-1083.391) [-1082.626] (-1082.913) (-1083.608) -- 0:00:36
477000 -- (-1086.092) (-1085.058) (-1091.047) [-1084.095] * (-1081.630) [-1082.917] (-1085.908) (-1082.191) -- 0:00:36
477500 -- [-1085.755] (-1087.909) (-1082.454) (-1083.985) * [-1086.127] (-1082.935) (-1088.931) (-1082.672) -- 0:00:36
478000 -- [-1086.378] (-1085.228) (-1083.473) (-1085.578) * (-1086.537) (-1084.725) (-1088.204) [-1083.851] -- 0:00:36
478500 -- (-1086.578) (-1085.350) (-1082.960) [-1085.140] * (-1086.783) [-1084.064] (-1087.811) (-1083.613) -- 0:00:35
479000 -- (-1084.206) (-1083.080) [-1083.462] (-1083.024) * (-1086.783) [-1083.451] (-1083.492) (-1082.835) -- 0:00:35
479500 -- [-1083.411] (-1085.394) (-1084.573) (-1083.199) * (-1083.296) (-1087.623) (-1083.979) [-1082.699] -- 0:00:35
480000 -- [-1083.879] (-1086.955) (-1084.708) (-1083.016) * (-1084.601) (-1085.377) [-1083.588] (-1081.724) -- 0:00:35
Average standard deviation of split frequencies: 0.011585
480500 -- (-1082.677) [-1084.886] (-1085.784) (-1087.236) * (-1084.675) (-1086.020) (-1082.665) [-1082.961] -- 0:00:35
481000 -- (-1083.575) [-1083.707] (-1083.693) (-1084.855) * (-1082.243) [-1083.271] (-1082.643) (-1083.923) -- 0:00:35
481500 -- [-1084.273] (-1082.991) (-1082.837) (-1087.466) * [-1082.882] (-1083.827) (-1086.093) (-1085.303) -- 0:00:35
482000 -- [-1084.135] (-1086.886) (-1087.726) (-1082.710) * (-1082.648) [-1084.490] (-1083.772) (-1085.741) -- 0:00:35
482500 -- (-1088.443) [-1084.082] (-1082.643) (-1088.013) * [-1084.357] (-1083.769) (-1086.979) (-1086.794) -- 0:00:35
483000 -- (-1086.420) (-1083.783) (-1083.668) [-1082.629] * (-1083.992) (-1086.858) [-1085.821] (-1084.285) -- 0:00:35
483500 -- [-1085.891] (-1081.850) (-1086.392) (-1083.560) * [-1082.888] (-1085.597) (-1082.537) (-1083.159) -- 0:00:35
484000 -- (-1082.524) (-1083.876) (-1087.108) [-1084.978] * (-1083.938) (-1090.250) (-1085.638) [-1084.035] -- 0:00:35
484500 -- [-1082.535] (-1082.898) (-1086.524) (-1088.199) * (-1082.610) [-1081.635] (-1083.403) (-1083.062) -- 0:00:35
485000 -- [-1083.358] (-1086.924) (-1084.902) (-1087.900) * (-1083.909) (-1084.368) (-1083.336) [-1083.671] -- 0:00:35
Average standard deviation of split frequencies: 0.011397
485500 -- (-1082.398) [-1083.008] (-1084.432) (-1087.303) * (-1082.803) (-1082.857) (-1081.924) [-1081.896] -- 0:00:34
486000 -- (-1084.240) (-1082.917) (-1084.418) [-1086.737] * (-1082.465) (-1082.986) (-1083.808) [-1082.139] -- 0:00:34
486500 -- (-1084.797) (-1082.598) [-1084.120] (-1083.352) * (-1083.515) (-1086.110) (-1082.888) [-1082.139] -- 0:00:34
487000 -- (-1082.061) [-1089.850] (-1081.803) (-1083.235) * [-1085.138] (-1087.005) (-1083.544) (-1082.812) -- 0:00:34
487500 -- [-1083.181] (-1087.334) (-1081.656) (-1083.013) * (-1083.280) (-1084.067) [-1083.865] (-1083.965) -- 0:00:34
488000 -- (-1085.737) (-1085.861) (-1081.936) [-1083.042] * [-1083.521] (-1083.711) (-1087.599) (-1086.088) -- 0:00:34
488500 -- (-1082.873) [-1083.076] (-1081.893) (-1084.041) * (-1083.133) [-1082.571] (-1083.498) (-1084.538) -- 0:00:34
489000 -- (-1085.462) (-1087.059) (-1082.457) [-1085.270] * (-1086.684) (-1083.883) (-1083.391) [-1082.893] -- 0:00:34
489500 -- (-1084.997) [-1084.532] (-1083.632) (-1083.970) * (-1084.874) (-1082.915) [-1083.552] (-1081.969) -- 0:00:34
490000 -- [-1083.464] (-1085.300) (-1083.529) (-1082.510) * [-1084.563] (-1087.061) (-1086.552) (-1083.473) -- 0:00:34
Average standard deviation of split frequencies: 0.011593
490500 -- (-1084.293) (-1084.177) [-1083.973] (-1084.584) * [-1084.029] (-1089.061) (-1084.697) (-1085.428) -- 0:00:34
491000 -- (-1087.765) (-1082.614) (-1082.866) [-1085.166] * [-1085.706] (-1085.448) (-1086.488) (-1084.181) -- 0:00:34
491500 -- (-1083.965) (-1087.059) (-1082.350) [-1085.205] * [-1082.470] (-1083.132) (-1084.325) (-1082.771) -- 0:00:35
492000 -- (-1085.552) (-1085.244) [-1084.545] (-1083.845) * (-1083.235) (-1085.361) (-1082.378) [-1086.137] -- 0:00:35
492500 -- (-1084.161) [-1084.342] (-1088.149) (-1090.060) * [-1084.996] (-1085.291) (-1084.721) (-1083.461) -- 0:00:35
493000 -- (-1084.188) (-1084.334) (-1084.294) [-1084.985] * (-1085.160) (-1083.302) (-1084.570) [-1082.997] -- 0:00:34
493500 -- [-1083.447] (-1087.046) (-1083.030) (-1083.185) * (-1083.999) (-1081.960) (-1084.222) [-1085.756] -- 0:00:34
494000 -- (-1083.793) [-1083.897] (-1082.522) (-1084.583) * (-1084.590) [-1082.273] (-1085.350) (-1083.446) -- 0:00:34
494500 -- [-1087.266] (-1083.813) (-1084.487) (-1082.781) * (-1086.974) (-1084.799) (-1082.866) [-1082.723] -- 0:00:34
495000 -- (-1085.236) (-1083.369) [-1089.336] (-1082.079) * (-1083.918) (-1083.325) [-1082.866] (-1084.704) -- 0:00:34
Average standard deviation of split frequencies: 0.011532
495500 -- (-1085.011) (-1083.297) (-1086.943) [-1082.135] * (-1085.251) (-1083.207) [-1081.966] (-1086.151) -- 0:00:34
496000 -- (-1086.679) (-1084.405) (-1085.751) [-1083.968] * (-1083.381) [-1085.211] (-1085.080) (-1083.792) -- 0:00:34
496500 -- (-1083.583) (-1086.180) [-1082.343] (-1088.162) * (-1083.006) (-1082.574) [-1084.936] (-1084.108) -- 0:00:34
497000 -- [-1085.141] (-1082.964) (-1084.582) (-1083.523) * (-1081.931) (-1084.516) [-1081.996] (-1083.024) -- 0:00:34
497500 -- (-1084.999) (-1083.464) (-1084.039) [-1083.092] * [-1086.987] (-1084.054) (-1082.326) (-1082.268) -- 0:00:34
498000 -- (-1082.436) (-1084.853) [-1084.149] (-1082.906) * (-1087.291) [-1084.108] (-1083.138) (-1082.733) -- 0:00:34
498500 -- [-1082.724] (-1082.241) (-1082.402) (-1083.446) * (-1086.537) (-1091.956) [-1082.992] (-1085.163) -- 0:00:34
499000 -- (-1083.611) (-1091.420) [-1082.179] (-1084.906) * (-1084.988) (-1091.308) [-1083.008] (-1085.619) -- 0:00:34
499500 -- (-1082.338) [-1085.498] (-1084.753) (-1082.562) * (-1084.957) (-1085.502) (-1082.518) [-1082.805] -- 0:00:34
500000 -- (-1081.784) [-1083.273] (-1083.702) (-1083.416) * (-1082.265) [-1084.739] (-1087.570) (-1084.358) -- 0:00:34
Average standard deviation of split frequencies: 0.010828
500500 -- (-1083.131) [-1083.978] (-1086.164) (-1084.389) * (-1082.759) (-1081.700) (-1087.922) [-1083.260] -- 0:00:33
501000 -- (-1082.859) (-1082.342) [-1087.667] (-1084.805) * (-1086.014) (-1084.062) (-1086.301) [-1082.058] -- 0:00:33
501500 -- (-1083.475) (-1082.201) [-1089.972] (-1087.215) * [-1086.988] (-1085.700) (-1087.102) (-1083.430) -- 0:00:33
502000 -- [-1085.341] (-1083.290) (-1085.363) (-1082.940) * (-1083.856) (-1085.164) (-1084.767) [-1082.359] -- 0:00:33
502500 -- (-1092.632) [-1083.788] (-1083.313) (-1081.984) * (-1084.199) [-1085.383] (-1082.892) (-1082.996) -- 0:00:33
503000 -- (-1092.176) (-1086.592) [-1082.736] (-1086.870) * [-1084.573] (-1084.888) (-1084.080) (-1084.322) -- 0:00:33
503500 -- (-1089.054) (-1087.138) [-1082.772] (-1083.225) * (-1084.236) (-1082.563) (-1083.231) [-1082.150] -- 0:00:33
504000 -- (-1086.138) [-1084.398] (-1084.365) (-1083.481) * [-1082.330] (-1083.167) (-1083.325) (-1082.912) -- 0:00:33
504500 -- (-1087.465) (-1084.538) [-1084.038] (-1082.971) * (-1083.388) [-1083.456] (-1085.376) (-1087.718) -- 0:00:33
505000 -- (-1088.780) [-1085.288] (-1084.307) (-1085.924) * (-1085.517) (-1084.647) (-1084.348) [-1084.628] -- 0:00:33
Average standard deviation of split frequencies: 0.010539
505500 -- [-1083.457] (-1085.080) (-1086.915) (-1083.092) * (-1086.087) [-1086.477] (-1082.236) (-1086.012) -- 0:00:33
506000 -- [-1082.134] (-1086.985) (-1086.025) (-1085.920) * (-1085.214) (-1084.203) [-1082.619] (-1084.681) -- 0:00:33
506500 -- (-1082.526) [-1083.481] (-1091.563) (-1082.336) * [-1085.185] (-1083.665) (-1082.769) (-1084.077) -- 0:00:33
507000 -- (-1084.943) (-1085.794) (-1093.681) [-1083.633] * (-1085.091) (-1084.925) [-1084.572] (-1082.431) -- 0:00:33
507500 -- (-1083.982) [-1084.358] (-1086.906) (-1083.840) * (-1083.755) (-1085.495) [-1083.309] (-1082.560) -- 0:00:32
508000 -- (-1085.249) (-1087.275) (-1083.208) [-1090.256] * (-1083.705) (-1082.380) (-1084.123) [-1081.747] -- 0:00:33
508500 -- (-1082.029) (-1086.267) (-1084.615) [-1084.663] * (-1082.832) (-1083.335) (-1086.923) [-1082.133] -- 0:00:33
509000 -- (-1087.793) (-1085.525) [-1083.910] (-1086.066) * (-1084.974) (-1082.556) [-1084.933] (-1084.409) -- 0:00:33
509500 -- (-1083.414) (-1084.174) (-1082.900) [-1084.286] * (-1087.673) [-1088.843] (-1087.878) (-1084.484) -- 0:00:33
510000 -- (-1085.731) (-1083.022) (-1083.327) [-1085.045] * [-1084.951] (-1084.533) (-1085.977) (-1082.665) -- 0:00:33
Average standard deviation of split frequencies: 0.010789
510500 -- (-1082.705) (-1086.021) [-1085.054] (-1084.006) * [-1086.190] (-1081.920) (-1084.533) (-1084.162) -- 0:00:33
511000 -- (-1083.430) [-1083.132] (-1087.030) (-1083.036) * (-1082.401) [-1082.489] (-1085.709) (-1084.351) -- 0:00:33
511500 -- (-1083.925) (-1082.203) [-1083.080] (-1083.844) * [-1083.538] (-1082.395) (-1084.653) (-1083.672) -- 0:00:33
512000 -- (-1086.013) (-1086.269) (-1086.239) [-1084.746] * [-1081.812] (-1085.433) (-1082.712) (-1086.660) -- 0:00:33
512500 -- (-1090.101) (-1086.518) [-1085.038] (-1084.502) * (-1084.745) (-1082.466) (-1083.119) [-1083.661] -- 0:00:33
513000 -- (-1090.514) [-1082.343] (-1082.601) (-1084.158) * (-1086.765) [-1086.386] (-1082.370) (-1092.696) -- 0:00:33
513500 -- (-1083.776) (-1086.668) [-1082.246] (-1086.086) * [-1084.598] (-1082.759) (-1083.563) (-1084.088) -- 0:00:33
514000 -- (-1087.573) [-1083.657] (-1084.546) (-1084.333) * [-1083.761] (-1083.539) (-1085.225) (-1082.857) -- 0:00:33
514500 -- [-1085.790] (-1082.625) (-1083.357) (-1084.205) * (-1083.584) [-1084.879] (-1084.628) (-1084.089) -- 0:00:33
515000 -- (-1086.289) (-1084.822) [-1083.652] (-1086.556) * (-1082.529) [-1084.836] (-1083.229) (-1083.985) -- 0:00:32
Average standard deviation of split frequencies: 0.010906
515500 -- (-1087.781) [-1082.857] (-1083.045) (-1085.426) * [-1083.504] (-1086.401) (-1083.295) (-1086.848) -- 0:00:32
516000 -- (-1084.629) (-1086.809) [-1082.907] (-1083.345) * [-1084.206] (-1082.455) (-1085.255) (-1082.652) -- 0:00:32
516500 -- (-1085.166) [-1089.471] (-1082.860) (-1083.707) * (-1082.283) (-1085.877) (-1083.868) [-1082.057] -- 0:00:32
517000 -- [-1084.479] (-1084.210) (-1083.097) (-1084.646) * [-1083.250] (-1084.550) (-1085.082) (-1083.149) -- 0:00:32
517500 -- (-1083.580) [-1082.896] (-1081.931) (-1083.240) * [-1082.421] (-1084.181) (-1089.402) (-1082.077) -- 0:00:32
518000 -- (-1082.834) [-1082.618] (-1082.793) (-1084.069) * [-1086.345] (-1083.876) (-1083.228) (-1083.788) -- 0:00:32
518500 -- (-1083.677) [-1083.563] (-1082.791) (-1083.346) * (-1083.382) (-1084.026) [-1083.466] (-1086.543) -- 0:00:32
519000 -- [-1085.315] (-1087.194) (-1084.666) (-1082.680) * (-1083.777) (-1087.310) (-1082.976) [-1083.831] -- 0:00:32
519500 -- [-1082.760] (-1089.417) (-1087.452) (-1092.614) * (-1085.138) (-1083.768) [-1081.842] (-1084.528) -- 0:00:32
520000 -- (-1082.924) [-1083.693] (-1090.273) (-1085.905) * (-1085.167) [-1083.067] (-1087.960) (-1085.833) -- 0:00:32
Average standard deviation of split frequencies: 0.011046
520500 -- (-1086.157) [-1083.365] (-1082.755) (-1083.328) * (-1085.230) (-1083.633) [-1087.135] (-1088.484) -- 0:00:32
521000 -- (-1083.237) [-1084.154] (-1084.285) (-1082.327) * (-1083.849) [-1084.143] (-1084.717) (-1082.334) -- 0:00:32
521500 -- (-1083.601) [-1087.169] (-1081.954) (-1082.326) * (-1086.295) (-1083.506) [-1082.893] (-1083.273) -- 0:00:32
522000 -- [-1083.235] (-1085.089) (-1085.978) (-1083.971) * (-1086.920) [-1082.809] (-1084.462) (-1087.297) -- 0:00:32
522500 -- (-1086.710) (-1086.324) (-1083.978) [-1086.287] * [-1089.279] (-1084.616) (-1083.767) (-1088.259) -- 0:00:31
523000 -- [-1082.714] (-1089.087) (-1083.936) (-1085.455) * [-1082.773] (-1083.075) (-1085.953) (-1089.400) -- 0:00:31
523500 -- (-1083.852) (-1082.106) [-1083.385] (-1083.724) * (-1085.466) (-1084.164) [-1083.145] (-1087.050) -- 0:00:31
524000 -- (-1083.178) (-1082.823) [-1085.564] (-1082.862) * (-1086.072) [-1087.772] (-1084.809) (-1081.814) -- 0:00:31
524500 -- [-1083.507] (-1088.121) (-1081.942) (-1083.523) * (-1084.631) [-1084.432] (-1089.258) (-1084.382) -- 0:00:32
525000 -- (-1082.560) [-1084.069] (-1082.616) (-1084.512) * (-1084.135) (-1087.628) [-1087.137] (-1084.640) -- 0:00:32
Average standard deviation of split frequencies: 0.010082
525500 -- (-1084.097) (-1083.738) [-1086.360] (-1083.296) * [-1084.725] (-1082.209) (-1085.091) (-1090.722) -- 0:00:32
526000 -- (-1085.655) [-1083.049] (-1085.802) (-1083.160) * (-1083.357) (-1082.915) (-1084.049) [-1082.650] -- 0:00:32
526500 -- (-1084.615) (-1083.786) (-1085.217) [-1083.227] * (-1082.857) (-1082.923) [-1083.132] (-1085.804) -- 0:00:32
527000 -- (-1087.034) (-1084.747) (-1084.996) [-1084.113] * (-1084.701) (-1082.075) (-1082.002) [-1084.476] -- 0:00:32
527500 -- (-1086.381) [-1083.781] (-1084.738) (-1083.328) * [-1083.498] (-1082.103) (-1082.021) (-1086.398) -- 0:00:32
528000 -- (-1085.958) (-1083.729) (-1084.280) [-1084.580] * (-1083.901) [-1082.201] (-1082.142) (-1086.051) -- 0:00:32
528500 -- [-1083.904] (-1083.227) (-1083.531) (-1084.346) * (-1083.697) (-1085.682) [-1083.643] (-1082.238) -- 0:00:32
529000 -- [-1084.310] (-1083.105) (-1081.837) (-1087.451) * [-1083.014] (-1083.246) (-1085.285) (-1085.159) -- 0:00:32
529500 -- (-1084.298) (-1085.420) [-1085.257] (-1083.304) * (-1086.346) (-1088.539) (-1085.443) [-1083.561] -- 0:00:31
530000 -- [-1082.234] (-1084.498) (-1087.545) (-1082.648) * [-1084.562] (-1083.182) (-1082.252) (-1086.018) -- 0:00:31
Average standard deviation of split frequencies: 0.009827
530500 -- (-1083.309) [-1083.850] (-1088.531) (-1083.666) * (-1084.842) [-1085.941] (-1081.889) (-1084.864) -- 0:00:31
531000 -- (-1083.416) [-1083.412] (-1087.252) (-1083.250) * (-1089.915) (-1083.660) (-1082.267) [-1083.567] -- 0:00:31
531500 -- (-1082.082) (-1088.019) (-1085.496) [-1086.866] * (-1083.249) [-1082.863] (-1083.171) (-1081.749) -- 0:00:31
532000 -- (-1083.565) (-1085.334) [-1084.897] (-1083.100) * (-1086.614) (-1083.026) (-1083.140) [-1085.178] -- 0:00:31
532500 -- [-1084.858] (-1084.493) (-1083.648) (-1082.980) * [-1088.016] (-1083.042) (-1082.991) (-1082.012) -- 0:00:31
533000 -- (-1084.521) [-1082.787] (-1087.371) (-1088.337) * (-1084.600) (-1085.967) (-1087.129) [-1083.759] -- 0:00:31
533500 -- (-1086.980) (-1082.446) (-1083.814) [-1086.118] * (-1082.529) (-1086.054) (-1082.333) [-1084.174] -- 0:00:31
534000 -- [-1083.816] (-1084.228) (-1087.573) (-1082.282) * [-1085.184] (-1089.535) (-1086.830) (-1083.837) -- 0:00:31
534500 -- (-1086.383) (-1088.349) [-1084.565] (-1083.739) * (-1088.385) [-1082.511] (-1086.410) (-1084.761) -- 0:00:31
535000 -- (-1084.296) (-1088.276) [-1083.279] (-1082.921) * [-1085.571] (-1083.332) (-1087.643) (-1084.666) -- 0:00:31
Average standard deviation of split frequencies: 0.009400
535500 -- (-1082.918) [-1084.383] (-1087.183) (-1082.994) * (-1082.453) [-1089.189] (-1085.469) (-1085.167) -- 0:00:31
536000 -- (-1082.390) (-1086.100) [-1083.460] (-1088.339) * (-1082.011) (-1088.654) (-1086.553) [-1085.114] -- 0:00:31
536500 -- (-1084.440) (-1083.585) [-1082.590] (-1082.662) * (-1082.118) (-1088.273) (-1086.178) [-1083.320] -- 0:00:31
537000 -- [-1082.657] (-1085.089) (-1082.411) (-1083.403) * [-1082.790] (-1087.663) (-1083.687) (-1083.149) -- 0:00:31
537500 -- (-1083.216) (-1083.750) [-1086.350] (-1083.402) * (-1084.659) (-1084.860) (-1082.372) [-1087.382] -- 0:00:30
538000 -- (-1082.135) (-1084.890) [-1084.114] (-1083.615) * (-1084.277) [-1084.246] (-1083.467) (-1084.244) -- 0:00:30
538500 -- [-1082.164] (-1086.844) (-1083.162) (-1082.474) * (-1084.045) [-1082.627] (-1083.763) (-1084.408) -- 0:00:30
539000 -- [-1083.991] (-1083.015) (-1082.047) (-1085.507) * (-1084.426) (-1083.184) (-1087.286) [-1082.254] -- 0:00:30
539500 -- (-1083.222) (-1084.220) [-1083.743] (-1083.522) * [-1086.674] (-1083.442) (-1085.731) (-1083.866) -- 0:00:30
540000 -- (-1082.854) [-1084.879] (-1083.732) (-1085.168) * (-1089.584) (-1082.348) [-1084.621] (-1083.441) -- 0:00:30
Average standard deviation of split frequencies: 0.009482
540500 -- [-1082.355] (-1083.295) (-1083.280) (-1084.195) * (-1083.555) (-1083.584) (-1086.195) [-1086.624] -- 0:00:31
541000 -- (-1083.042) [-1082.704] (-1084.802) (-1086.226) * (-1082.854) (-1083.084) [-1084.884] (-1084.167) -- 0:00:31
541500 -- (-1082.693) [-1085.788] (-1084.793) (-1082.195) * [-1082.789] (-1081.769) (-1086.260) (-1082.448) -- 0:00:31
542000 -- (-1082.488) (-1084.925) (-1082.187) [-1081.883] * (-1082.703) (-1081.549) [-1082.468] (-1083.436) -- 0:00:31
542500 -- (-1085.334) [-1083.231] (-1083.630) (-1082.846) * (-1083.858) (-1083.082) [-1082.985] (-1086.830) -- 0:00:31
543000 -- (-1083.894) (-1082.874) [-1085.321] (-1084.787) * (-1082.954) (-1082.668) (-1086.439) [-1083.268] -- 0:00:31
543500 -- (-1083.735) (-1082.840) (-1086.840) [-1083.178] * (-1082.265) (-1082.808) [-1081.960] (-1083.907) -- 0:00:31
544000 -- (-1086.574) (-1083.063) [-1083.230] (-1083.340) * [-1082.808] (-1083.052) (-1086.940) (-1086.154) -- 0:00:31
544500 -- (-1082.543) (-1085.204) (-1084.226) [-1083.767] * (-1083.996) (-1083.304) [-1085.305] (-1084.628) -- 0:00:30
545000 -- (-1081.707) (-1084.981) [-1082.894] (-1091.034) * [-1084.146] (-1084.443) (-1085.858) (-1084.971) -- 0:00:30
Average standard deviation of split frequencies: 0.008958
545500 -- (-1082.366) (-1086.357) (-1085.015) [-1086.028] * (-1084.072) [-1083.188] (-1082.942) (-1083.820) -- 0:00:30
546000 -- (-1084.120) (-1083.910) (-1084.677) [-1082.972] * (-1082.801) (-1082.923) [-1083.609] (-1084.842) -- 0:00:30
546500 -- (-1084.067) (-1085.833) [-1084.695] (-1085.222) * (-1082.345) (-1082.843) [-1084.234] (-1083.536) -- 0:00:30
547000 -- (-1086.149) (-1086.777) (-1088.224) [-1082.196] * (-1082.049) [-1085.349] (-1085.306) (-1084.802) -- 0:00:30
547500 -- (-1082.740) (-1083.644) [-1083.397] (-1082.469) * (-1084.775) [-1084.581] (-1083.362) (-1085.264) -- 0:00:30
548000 -- (-1084.529) (-1087.488) (-1086.427) [-1082.521] * (-1087.683) (-1082.734) (-1081.796) [-1082.388] -- 0:00:30
548500 -- (-1082.287) (-1085.914) [-1087.034] (-1082.875) * [-1085.328] (-1082.856) (-1083.493) (-1088.880) -- 0:00:30
549000 -- (-1081.802) [-1083.104] (-1083.778) (-1086.452) * (-1083.090) (-1084.501) (-1082.320) [-1086.988] -- 0:00:30
549500 -- [-1083.216] (-1084.998) (-1087.661) (-1084.078) * (-1086.760) [-1082.489] (-1082.980) (-1083.627) -- 0:00:30
550000 -- [-1084.240] (-1084.627) (-1087.340) (-1085.539) * (-1086.971) (-1082.260) [-1085.552] (-1085.248) -- 0:00:30
Average standard deviation of split frequencies: 0.008882
550500 -- (-1082.546) (-1084.436) (-1086.423) [-1083.648] * [-1089.512] (-1082.344) (-1085.130) (-1084.807) -- 0:00:30
551000 -- (-1082.300) (-1082.625) [-1084.560] (-1082.439) * [-1085.209] (-1084.772) (-1086.475) (-1084.493) -- 0:00:30
551500 -- [-1083.616] (-1083.108) (-1085.605) (-1083.030) * (-1082.726) (-1083.460) [-1085.061] (-1083.126) -- 0:00:30
552000 -- (-1085.078) [-1084.905] (-1086.587) (-1082.868) * (-1084.871) (-1085.360) (-1084.652) [-1082.252] -- 0:00:30
552500 -- (-1087.116) (-1085.317) [-1085.446] (-1084.764) * (-1084.943) [-1082.721] (-1084.523) (-1082.541) -- 0:00:29
553000 -- (-1082.069) [-1083.290] (-1086.655) (-1083.096) * [-1084.436] (-1083.595) (-1086.224) (-1082.477) -- 0:00:29
553500 -- (-1082.320) (-1084.670) [-1083.237] (-1089.180) * (-1086.698) (-1082.484) (-1093.001) [-1084.552] -- 0:00:29
554000 -- (-1082.462) (-1084.319) [-1084.694] (-1082.348) * (-1082.454) (-1086.053) [-1083.460] (-1082.287) -- 0:00:29
554500 -- (-1082.462) (-1085.278) [-1083.749] (-1084.341) * (-1082.630) (-1083.624) (-1087.093) [-1084.235] -- 0:00:29
555000 -- (-1082.314) (-1084.828) (-1083.219) [-1082.666] * (-1082.326) [-1083.645] (-1083.425) (-1084.579) -- 0:00:29
Average standard deviation of split frequencies: 0.009220
555500 -- (-1083.513) (-1084.025) (-1083.409) [-1083.113] * (-1083.271) (-1084.758) (-1084.849) [-1085.353] -- 0:00:29
556000 -- (-1083.056) (-1090.579) (-1084.241) [-1087.200] * (-1087.095) (-1083.676) [-1086.954] (-1083.975) -- 0:00:29
556500 -- (-1082.211) (-1088.240) (-1086.521) [-1085.334] * (-1084.252) (-1087.262) [-1086.722] (-1083.309) -- 0:00:29
557000 -- (-1084.057) (-1085.826) [-1082.914] (-1085.462) * (-1082.430) [-1083.953] (-1082.554) (-1084.279) -- 0:00:30
557500 -- (-1085.497) (-1084.844) [-1083.682] (-1083.280) * [-1085.537] (-1083.563) (-1081.809) (-1084.752) -- 0:00:30
558000 -- (-1082.433) (-1084.607) [-1085.115] (-1084.669) * (-1084.479) [-1081.760] (-1082.319) (-1083.003) -- 0:00:30
558500 -- (-1082.263) [-1084.007] (-1085.313) (-1084.966) * (-1084.511) (-1081.787) [-1083.147] (-1085.305) -- 0:00:30
559000 -- [-1082.150] (-1083.858) (-1083.672) (-1083.587) * (-1083.966) [-1081.863] (-1083.367) (-1087.236) -- 0:00:29
559500 -- (-1083.697) (-1089.837) (-1082.384) [-1085.292] * (-1086.483) [-1082.162] (-1089.064) (-1086.636) -- 0:00:29
560000 -- (-1085.144) [-1081.872] (-1085.161) (-1084.128) * (-1084.732) (-1082.842) (-1088.755) [-1083.736] -- 0:00:29
Average standard deviation of split frequencies: 0.009091
560500 -- [-1087.413] (-1082.282) (-1086.832) (-1083.038) * [-1082.924] (-1085.618) (-1084.685) (-1083.044) -- 0:00:29
561000 -- (-1087.435) [-1083.744] (-1088.090) (-1082.631) * (-1083.679) (-1084.806) (-1084.520) [-1083.974] -- 0:00:29
561500 -- (-1085.200) (-1082.759) (-1088.419) [-1083.886] * (-1081.938) (-1085.480) (-1087.725) [-1084.278] -- 0:00:29
562000 -- (-1085.493) [-1084.474] (-1088.342) (-1083.054) * [-1085.919] (-1086.003) (-1085.783) (-1084.434) -- 0:00:29
562500 -- (-1087.545) (-1082.373) [-1083.351] (-1082.252) * (-1083.889) (-1083.839) [-1085.238] (-1085.136) -- 0:00:29
563000 -- (-1084.248) [-1082.343] (-1082.734) (-1084.139) * (-1085.130) [-1082.531] (-1084.300) (-1085.324) -- 0:00:29
563500 -- (-1087.396) (-1083.420) (-1082.676) [-1081.710] * [-1083.591] (-1084.763) (-1086.292) (-1085.293) -- 0:00:29
564000 -- (-1085.282) [-1082.427] (-1082.961) (-1082.312) * (-1082.021) (-1083.044) (-1082.929) [-1084.230] -- 0:00:29
564500 -- (-1086.928) [-1084.130] (-1085.792) (-1083.134) * [-1087.610] (-1083.188) (-1083.871) (-1084.892) -- 0:00:29
565000 -- (-1089.933) [-1086.480] (-1083.602) (-1082.974) * (-1084.572) (-1084.664) (-1084.555) [-1083.685] -- 0:00:29
Average standard deviation of split frequencies: 0.009318
565500 -- [-1084.837] (-1085.636) (-1086.587) (-1085.965) * (-1086.339) (-1084.990) (-1088.917) [-1084.252] -- 0:00:29
566000 -- (-1084.227) [-1082.885] (-1084.988) (-1085.385) * (-1086.465) (-1086.054) [-1083.461] (-1084.406) -- 0:00:29
566500 -- (-1084.979) (-1084.174) (-1084.478) [-1084.480] * [-1088.059] (-1084.700) (-1086.096) (-1084.171) -- 0:00:29
567000 -- [-1082.606] (-1085.902) (-1083.872) (-1084.100) * (-1083.296) (-1085.680) [-1083.408] (-1085.198) -- 0:00:29
567500 -- [-1084.284] (-1085.333) (-1083.557) (-1088.144) * (-1083.991) (-1083.997) (-1085.439) [-1082.298] -- 0:00:28
568000 -- (-1083.485) [-1083.047] (-1084.731) (-1085.102) * [-1084.993] (-1084.225) (-1082.387) (-1084.056) -- 0:00:28
568500 -- (-1083.002) [-1082.746] (-1084.557) (-1084.185) * (-1084.182) (-1082.271) (-1083.536) [-1084.307] -- 0:00:28
569000 -- (-1084.634) (-1085.001) (-1082.953) [-1084.396] * (-1082.898) (-1083.194) [-1085.466] (-1084.790) -- 0:00:28
569500 -- (-1083.761) [-1083.226] (-1083.345) (-1089.546) * [-1084.241] (-1083.899) (-1083.712) (-1085.122) -- 0:00:28
570000 -- (-1083.522) (-1084.467) [-1082.232] (-1086.097) * (-1086.196) [-1082.600] (-1083.859) (-1085.092) -- 0:00:28
Average standard deviation of split frequencies: 0.009190
570500 -- (-1082.911) [-1087.943] (-1086.833) (-1082.115) * (-1085.234) (-1083.044) (-1082.374) [-1082.610] -- 0:00:28
571000 -- (-1082.494) (-1084.269) (-1083.640) [-1086.958] * (-1091.234) (-1085.805) [-1082.309] (-1084.239) -- 0:00:28
571500 -- (-1082.806) (-1084.962) (-1084.090) [-1083.298] * [-1083.728] (-1090.654) (-1082.601) (-1083.086) -- 0:00:28
572000 -- (-1082.925) (-1083.695) (-1085.459) [-1081.643] * [-1083.259] (-1083.869) (-1082.734) (-1082.853) -- 0:00:28
572500 -- (-1082.660) [-1082.933] (-1082.529) (-1082.798) * (-1085.217) (-1092.435) [-1082.105] (-1087.296) -- 0:00:28
573000 -- (-1083.199) [-1084.898] (-1083.385) (-1083.656) * [-1083.013] (-1083.769) (-1082.409) (-1084.661) -- 0:00:28
573500 -- (-1088.142) (-1085.833) (-1083.398) [-1084.371] * (-1084.890) (-1090.776) [-1086.444] (-1083.754) -- 0:00:29
574000 -- (-1083.437) [-1082.211] (-1083.530) (-1083.411) * (-1083.068) [-1084.895] (-1087.192) (-1083.702) -- 0:00:28
574500 -- [-1087.233] (-1082.337) (-1083.574) (-1083.937) * (-1083.420) (-1086.830) [-1085.512] (-1083.136) -- 0:00:28
575000 -- (-1085.175) [-1082.380] (-1083.299) (-1083.950) * (-1086.460) (-1087.499) [-1084.164] (-1084.167) -- 0:00:28
Average standard deviation of split frequencies: 0.009361
575500 -- (-1082.265) (-1083.646) [-1082.622] (-1083.815) * (-1087.203) [-1081.995] (-1085.055) (-1082.733) -- 0:00:28
576000 -- [-1087.380] (-1088.389) (-1082.140) (-1084.847) * (-1082.594) [-1082.560] (-1082.990) (-1086.428) -- 0:00:28
576500 -- (-1083.629) (-1088.584) [-1087.636] (-1086.436) * (-1082.219) (-1082.644) [-1086.803] (-1082.611) -- 0:00:28
577000 -- (-1084.381) (-1088.412) [-1084.867] (-1084.958) * [-1083.397] (-1082.874) (-1084.446) (-1086.847) -- 0:00:28
577500 -- [-1083.954] (-1085.347) (-1082.396) (-1086.242) * [-1083.052] (-1083.505) (-1083.818) (-1082.356) -- 0:00:28
578000 -- (-1083.981) (-1085.324) [-1083.311] (-1087.623) * (-1082.206) (-1084.185) (-1084.472) [-1082.199] -- 0:00:28
578500 -- (-1084.414) (-1083.962) [-1083.779] (-1088.954) * (-1083.980) (-1084.136) (-1085.388) [-1082.393] -- 0:00:28
579000 -- (-1085.325) (-1084.314) [-1083.376] (-1084.015) * (-1084.466) (-1082.691) (-1084.635) [-1081.822] -- 0:00:28
579500 -- (-1084.237) (-1084.437) (-1083.172) [-1088.726] * [-1084.074] (-1084.991) (-1082.616) (-1083.511) -- 0:00:28
580000 -- [-1082.203] (-1082.975) (-1081.923) (-1083.917) * (-1084.005) [-1083.652] (-1083.076) (-1086.169) -- 0:00:28
Average standard deviation of split frequencies: 0.009387
580500 -- (-1082.659) [-1083.713] (-1082.847) (-1082.779) * [-1083.969] (-1082.586) (-1086.393) (-1086.289) -- 0:00:28
581000 -- (-1082.780) (-1086.882) [-1083.473] (-1085.112) * (-1084.991) (-1082.346) [-1088.367] (-1085.424) -- 0:00:28
581500 -- (-1083.165) (-1084.868) (-1084.238) [-1084.065] * (-1088.008) (-1084.101) [-1085.098] (-1085.464) -- 0:00:28
582000 -- [-1083.852] (-1085.693) (-1084.527) (-1086.348) * (-1082.352) [-1082.969] (-1083.716) (-1085.401) -- 0:00:28
582500 -- (-1083.257) [-1086.631] (-1082.344) (-1083.401) * (-1087.832) [-1081.901] (-1087.070) (-1083.755) -- 0:00:27
583000 -- (-1085.660) (-1082.646) (-1082.930) [-1084.240] * (-1086.662) (-1083.357) (-1083.837) [-1086.788] -- 0:00:27
583500 -- [-1087.069] (-1088.733) (-1082.634) (-1082.784) * (-1083.603) (-1084.678) [-1083.422] (-1082.036) -- 0:00:27
584000 -- (-1083.698) (-1087.502) [-1084.127] (-1082.073) * [-1082.759] (-1086.227) (-1087.044) (-1082.420) -- 0:00:27
584500 -- (-1085.404) [-1083.237] (-1084.307) (-1082.216) * (-1085.774) (-1092.610) [-1082.620] (-1083.786) -- 0:00:27
585000 -- (-1083.886) (-1082.649) [-1082.116] (-1083.497) * (-1082.473) [-1082.326] (-1085.068) (-1084.465) -- 0:00:27
Average standard deviation of split frequencies: 0.009417
585500 -- (-1083.371) (-1084.974) [-1083.911] (-1081.970) * [-1085.205] (-1082.584) (-1083.242) (-1083.528) -- 0:00:27
586000 -- (-1082.681) (-1083.838) [-1083.906] (-1082.285) * (-1083.785) [-1084.504] (-1084.029) (-1088.536) -- 0:00:27
586500 -- (-1085.189) (-1082.791) [-1082.642] (-1083.623) * (-1083.081) (-1084.019) [-1084.131] (-1082.411) -- 0:00:27
587000 -- [-1083.099] (-1083.998) (-1082.436) (-1082.258) * (-1089.328) (-1083.845) [-1082.706] (-1082.803) -- 0:00:27
587500 -- (-1089.692) (-1086.604) (-1085.793) [-1082.124] * [-1088.111] (-1082.969) (-1081.979) (-1084.207) -- 0:00:27
588000 -- [-1086.225] (-1084.633) (-1085.022) (-1082.551) * [-1086.299] (-1082.462) (-1086.686) (-1082.169) -- 0:00:27
588500 -- (-1082.978) (-1083.269) [-1083.225] (-1082.777) * [-1087.570] (-1081.883) (-1085.636) (-1082.169) -- 0:00:27
589000 -- (-1083.541) [-1083.768] (-1084.268) (-1087.562) * (-1083.979) (-1083.056) (-1084.650) [-1082.972] -- 0:00:27
589500 -- (-1082.581) (-1083.133) (-1086.164) [-1087.760] * [-1083.455] (-1084.507) (-1082.873) (-1083.900) -- 0:00:27
590000 -- (-1083.063) [-1085.392] (-1089.293) (-1082.044) * (-1083.531) (-1086.036) (-1082.996) [-1082.703] -- 0:00:27
Average standard deviation of split frequencies: 0.008967
590500 -- (-1084.030) [-1082.581] (-1083.876) (-1082.011) * (-1086.446) [-1088.819] (-1089.678) (-1083.801) -- 0:00:27
591000 -- (-1083.019) [-1086.159] (-1082.938) (-1082.199) * (-1082.340) [-1082.936] (-1084.130) (-1084.259) -- 0:00:27
591500 -- (-1082.864) (-1086.077) (-1082.881) [-1084.168] * (-1083.837) (-1082.540) [-1084.003] (-1082.723) -- 0:00:27
592000 -- (-1083.218) (-1082.846) (-1083.417) [-1082.843] * (-1083.486) [-1084.783] (-1083.569) (-1085.602) -- 0:00:27
592500 -- [-1082.253] (-1082.203) (-1083.348) (-1083.034) * (-1084.980) (-1084.359) [-1084.724] (-1088.755) -- 0:00:27
593000 -- (-1082.253) [-1085.277] (-1081.644) (-1082.055) * [-1083.674] (-1082.863) (-1085.334) (-1085.980) -- 0:00:27
593500 -- (-1083.785) (-1084.592) (-1083.176) [-1085.975] * (-1086.607) [-1086.158] (-1084.098) (-1087.078) -- 0:00:27
594000 -- (-1092.360) (-1084.896) [-1081.954] (-1086.255) * [-1082.679] (-1084.541) (-1085.594) (-1088.898) -- 0:00:27
594500 -- (-1082.367) [-1083.300] (-1082.306) (-1093.703) * [-1084.494] (-1084.847) (-1083.586) (-1085.252) -- 0:00:27
595000 -- [-1082.516] (-1086.906) (-1082.374) (-1084.600) * (-1081.903) [-1086.549] (-1085.970) (-1086.143) -- 0:00:27
Average standard deviation of split frequencies: 0.008933
595500 -- (-1082.172) [-1086.410] (-1085.940) (-1083.143) * (-1082.328) [-1082.090] (-1084.820) (-1085.984) -- 0:00:27
596000 -- (-1083.972) (-1085.432) (-1089.181) [-1083.807] * [-1083.112] (-1082.345) (-1085.848) (-1083.524) -- 0:00:27
596500 -- (-1084.730) (-1085.683) (-1088.763) [-1084.001] * [-1084.053] (-1082.444) (-1084.351) (-1082.945) -- 0:00:27
597000 -- (-1085.707) [-1085.903] (-1083.851) (-1082.421) * [-1084.772] (-1082.677) (-1083.988) (-1084.005) -- 0:00:27
597500 -- (-1084.491) [-1082.285] (-1088.937) (-1087.001) * (-1084.132) [-1084.041] (-1086.287) (-1082.724) -- 0:00:26
598000 -- (-1086.855) [-1083.490] (-1084.016) (-1082.513) * (-1082.568) (-1085.848) [-1085.440] (-1083.853) -- 0:00:26
598500 -- (-1089.804) [-1082.710] (-1083.894) (-1083.191) * (-1082.146) [-1083.836] (-1084.326) (-1082.823) -- 0:00:26
599000 -- (-1085.446) (-1082.140) [-1084.490] (-1082.456) * (-1081.817) (-1086.907) [-1083.726] (-1085.399) -- 0:00:26
599500 -- (-1085.931) [-1082.586] (-1082.143) (-1083.533) * (-1090.702) (-1084.205) [-1086.369] (-1087.386) -- 0:00:26
600000 -- (-1084.035) (-1083.931) [-1083.242] (-1084.695) * (-1085.915) (-1082.183) (-1083.625) [-1083.534] -- 0:00:26
Average standard deviation of split frequencies: 0.009279
600500 -- (-1083.236) [-1082.408] (-1084.117) (-1084.045) * (-1083.014) [-1083.352] (-1082.877) (-1085.152) -- 0:00:26
601000 -- (-1087.127) [-1084.851] (-1083.168) (-1086.392) * [-1083.094] (-1084.757) (-1084.025) (-1084.513) -- 0:00:26
601500 -- [-1082.256] (-1088.286) (-1082.646) (-1084.435) * (-1083.006) (-1085.557) [-1083.494] (-1084.370) -- 0:00:26
602000 -- (-1082.143) (-1085.243) (-1085.590) [-1084.026] * [-1082.139] (-1087.776) (-1083.907) (-1084.757) -- 0:00:26
602500 -- (-1082.081) (-1081.815) (-1087.211) [-1088.927] * (-1083.166) [-1083.480] (-1084.220) (-1090.647) -- 0:00:26
603000 -- (-1086.668) (-1084.114) (-1085.120) [-1084.936] * [-1084.237] (-1083.788) (-1090.972) (-1084.471) -- 0:00:26
603500 -- [-1082.131] (-1083.326) (-1083.505) (-1083.479) * (-1088.906) (-1086.471) [-1082.986] (-1085.157) -- 0:00:26
604000 -- (-1084.629) [-1083.378] (-1083.250) (-1082.888) * (-1082.658) (-1089.574) (-1086.218) [-1082.174] -- 0:00:26
604500 -- (-1085.796) (-1086.882) (-1082.818) [-1084.092] * [-1082.128] (-1085.096) (-1083.604) (-1084.233) -- 0:00:26
605000 -- (-1083.047) (-1085.872) [-1083.610] (-1086.628) * (-1085.389) (-1083.119) (-1084.594) [-1082.414] -- 0:00:26
Average standard deviation of split frequencies: 0.008923
605500 -- [-1083.615] (-1087.175) (-1085.130) (-1083.210) * [-1084.453] (-1084.851) (-1085.312) (-1082.464) -- 0:00:26
606000 -- [-1082.639] (-1087.042) (-1083.585) (-1083.084) * [-1082.569] (-1083.618) (-1085.072) (-1085.368) -- 0:00:26
606500 -- (-1084.390) (-1085.909) (-1086.477) [-1082.656] * (-1084.438) [-1082.649] (-1082.772) (-1083.769) -- 0:00:26
607000 -- (-1082.534) (-1086.686) (-1083.514) [-1082.211] * [-1087.142] (-1085.543) (-1082.374) (-1087.401) -- 0:00:26
607500 -- (-1087.665) (-1082.134) [-1082.224] (-1082.724) * (-1082.984) (-1085.541) [-1083.730] (-1085.514) -- 0:00:26
608000 -- (-1086.342) (-1082.979) [-1082.866] (-1086.328) * [-1083.264] (-1082.523) (-1087.695) (-1084.705) -- 0:00:26
608500 -- (-1082.710) (-1081.956) [-1087.787] (-1083.331) * (-1082.489) (-1082.256) (-1088.231) [-1086.743] -- 0:00:26
609000 -- (-1085.637) [-1086.713] (-1084.578) (-1088.339) * [-1083.869] (-1085.811) (-1084.839) (-1084.678) -- 0:00:26
609500 -- (-1086.052) [-1083.603] (-1084.603) (-1087.193) * (-1084.537) (-1082.721) [-1083.334] (-1084.402) -- 0:00:26
610000 -- (-1082.719) (-1085.342) [-1084.001] (-1084.578) * [-1086.214] (-1082.623) (-1083.404) (-1084.340) -- 0:00:26
Average standard deviation of split frequencies: 0.008809
610500 -- (-1085.309) (-1086.971) (-1085.033) [-1083.324] * (-1085.741) (-1082.720) (-1084.142) [-1083.383] -- 0:00:26
611000 -- [-1085.165] (-1084.159) (-1084.922) (-1085.358) * (-1082.632) (-1083.119) (-1081.949) [-1082.891] -- 0:00:26
611500 -- [-1083.876] (-1086.182) (-1085.030) (-1083.557) * (-1084.224) [-1082.950] (-1083.193) (-1085.327) -- 0:00:26
612000 -- (-1082.050) (-1084.646) (-1083.138) [-1084.080] * (-1083.675) (-1082.251) [-1083.782] (-1086.568) -- 0:00:25
612500 -- (-1081.873) (-1088.656) [-1083.904] (-1083.361) * (-1084.191) [-1084.094] (-1086.598) (-1085.093) -- 0:00:25
613000 -- (-1082.530) (-1082.772) (-1084.052) [-1083.506] * (-1085.355) [-1085.280] (-1086.045) (-1088.044) -- 0:00:25
613500 -- (-1084.432) (-1082.668) (-1082.252) [-1083.205] * (-1085.766) (-1083.102) (-1083.574) [-1084.416] -- 0:00:25
614000 -- (-1082.033) [-1083.029] (-1082.182) (-1089.516) * (-1084.759) (-1083.596) (-1085.574) [-1083.738] -- 0:00:25
614500 -- [-1084.421] (-1085.116) (-1084.720) (-1087.191) * (-1083.271) (-1086.747) (-1089.437) [-1085.371] -- 0:00:25
615000 -- (-1087.355) (-1087.096) [-1084.373] (-1082.503) * (-1084.210) (-1087.992) [-1085.341] (-1082.538) -- 0:00:25
Average standard deviation of split frequencies: 0.008561
615500 -- (-1084.383) [-1085.851] (-1085.944) (-1085.512) * (-1082.892) (-1084.911) [-1083.066] (-1085.405) -- 0:00:25
616000 -- [-1085.525] (-1084.789) (-1086.916) (-1084.513) * (-1082.178) [-1083.340] (-1081.864) (-1088.343) -- 0:00:25
616500 -- (-1083.372) (-1087.197) [-1084.819] (-1082.863) * (-1082.871) [-1083.010] (-1082.801) (-1085.006) -- 0:00:25
617000 -- (-1083.233) (-1084.968) (-1084.600) [-1083.897] * (-1083.765) [-1084.524] (-1086.613) (-1087.768) -- 0:00:25
617500 -- (-1082.077) (-1083.011) [-1083.428] (-1086.209) * (-1084.652) (-1082.480) (-1083.364) [-1084.744] -- 0:00:25
618000 -- (-1081.815) (-1085.443) (-1082.892) [-1085.396] * (-1085.907) (-1083.118) (-1085.078) [-1083.841] -- 0:00:25
618500 -- (-1082.391) [-1084.668] (-1084.997) (-1088.074) * [-1083.874] (-1081.935) (-1084.882) (-1083.017) -- 0:00:25
619000 -- (-1082.388) [-1083.853] (-1082.762) (-1088.128) * (-1083.987) (-1083.100) (-1085.047) [-1082.445] -- 0:00:25
619500 -- (-1083.079) (-1082.549) [-1081.638] (-1083.676) * (-1083.916) [-1082.270] (-1085.791) (-1084.207) -- 0:00:25
620000 -- (-1084.433) (-1083.385) (-1083.473) [-1082.357] * (-1084.221) (-1083.415) (-1085.936) [-1085.509] -- 0:00:25
Average standard deviation of split frequencies: 0.009257
620500 -- (-1084.570) [-1083.427] (-1084.552) (-1083.116) * (-1082.897) [-1082.586] (-1083.943) (-1083.569) -- 0:00:25
621000 -- [-1082.887] (-1087.818) (-1085.251) (-1086.259) * (-1082.025) [-1085.147] (-1084.464) (-1084.012) -- 0:00:25
621500 -- (-1084.504) (-1087.309) [-1084.118] (-1082.774) * (-1082.194) (-1082.045) (-1083.132) [-1082.345] -- 0:00:24
622000 -- (-1083.802) [-1082.664] (-1084.277) (-1083.666) * (-1083.970) (-1082.134) [-1082.907] (-1082.199) -- 0:00:25
622500 -- [-1086.514] (-1084.098) (-1086.279) (-1083.847) * [-1084.378] (-1082.134) (-1083.701) (-1083.626) -- 0:00:25
623000 -- [-1084.161] (-1085.739) (-1084.468) (-1083.173) * (-1088.833) [-1082.852] (-1086.816) (-1083.491) -- 0:00:25
623500 -- (-1083.355) [-1081.880] (-1086.576) (-1082.436) * [-1085.084] (-1082.954) (-1083.249) (-1085.100) -- 0:00:25
624000 -- (-1083.080) [-1082.538] (-1092.022) (-1082.629) * (-1086.849) [-1090.412] (-1094.024) (-1083.611) -- 0:00:25
624500 -- (-1082.815) [-1082.529] (-1088.482) (-1084.116) * (-1083.010) [-1083.401] (-1084.156) (-1084.005) -- 0:00:25
625000 -- (-1085.021) (-1084.801) (-1085.000) [-1083.979] * [-1083.853] (-1083.323) (-1090.334) (-1082.727) -- 0:00:25
Average standard deviation of split frequencies: 0.008895
625500 -- (-1084.156) [-1085.214] (-1084.329) (-1084.083) * (-1085.522) (-1087.686) [-1082.471] (-1085.310) -- 0:00:25
626000 -- (-1084.469) (-1084.501) (-1082.427) [-1084.439] * (-1083.443) [-1085.995] (-1082.459) (-1084.411) -- 0:00:25
626500 -- (-1084.258) (-1082.458) (-1083.403) [-1084.839] * (-1083.669) [-1084.894] (-1084.173) (-1086.215) -- 0:00:25
627000 -- (-1084.299) [-1084.627] (-1085.593) (-1087.622) * (-1085.512) [-1083.884] (-1082.620) (-1083.915) -- 0:00:24
627500 -- (-1083.271) (-1082.900) (-1081.780) [-1089.403] * [-1085.881] (-1085.061) (-1084.018) (-1088.383) -- 0:00:24
628000 -- [-1085.030] (-1083.551) (-1083.039) (-1085.363) * [-1083.118] (-1085.795) (-1087.840) (-1087.983) -- 0:00:24
628500 -- (-1082.520) [-1086.298] (-1084.509) (-1088.274) * (-1081.936) (-1082.537) (-1085.607) [-1085.225] -- 0:00:24
629000 -- (-1083.727) (-1084.965) [-1084.329] (-1082.448) * (-1082.118) (-1082.921) (-1087.656) [-1083.826] -- 0:00:24
629500 -- (-1086.020) [-1086.242] (-1086.424) (-1084.443) * (-1082.518) [-1083.228] (-1086.372) (-1083.534) -- 0:00:24
630000 -- (-1082.856) [-1084.884] (-1084.374) (-1084.644) * (-1084.726) [-1084.206] (-1085.852) (-1086.540) -- 0:00:24
Average standard deviation of split frequencies: 0.008783
630500 -- (-1082.278) [-1084.280] (-1088.637) (-1083.893) * (-1082.922) (-1083.604) (-1084.173) [-1082.405] -- 0:00:24
631000 -- [-1083.800] (-1083.703) (-1085.342) (-1083.746) * (-1084.248) (-1084.492) (-1085.467) [-1084.056] -- 0:00:24
631500 -- (-1087.625) [-1084.077] (-1082.258) (-1084.533) * (-1082.585) (-1084.891) [-1083.984] (-1085.003) -- 0:00:24
632000 -- (-1087.752) (-1086.471) [-1083.540] (-1082.887) * (-1087.204) (-1082.135) [-1084.064] (-1090.773) -- 0:00:24
632500 -- (-1087.539) (-1086.268) (-1085.969) [-1082.943] * (-1083.614) [-1083.262] (-1084.718) (-1084.768) -- 0:00:24
633000 -- [-1086.758] (-1085.702) (-1083.316) (-1084.321) * (-1083.976) (-1087.149) [-1084.916] (-1082.866) -- 0:00:24
633500 -- (-1086.332) (-1084.132) (-1084.842) [-1082.953] * (-1083.840) [-1082.615] (-1082.188) (-1084.726) -- 0:00:24
634000 -- (-1085.079) (-1087.617) [-1085.025] (-1083.928) * (-1081.742) (-1087.978) [-1083.162] (-1081.992) -- 0:00:24
634500 -- (-1083.419) (-1082.899) [-1083.092] (-1082.351) * (-1086.828) (-1083.792) (-1084.393) [-1083.904] -- 0:00:24
635000 -- [-1082.164] (-1083.088) (-1084.572) (-1082.103) * (-1083.142) (-1085.135) [-1082.470] (-1082.704) -- 0:00:24
Average standard deviation of split frequencies: 0.008431
635500 -- (-1081.933) [-1084.417] (-1083.093) (-1082.625) * (-1086.848) (-1082.326) [-1083.180] (-1082.059) -- 0:00:24
636000 -- (-1081.940) [-1083.358] (-1082.219) (-1083.864) * (-1084.349) (-1083.135) (-1083.669) [-1083.133] -- 0:00:24
636500 -- (-1083.753) [-1082.254] (-1082.246) (-1082.601) * (-1086.832) [-1084.934] (-1082.753) (-1085.210) -- 0:00:23
637000 -- (-1086.807) (-1084.751) [-1085.433] (-1082.975) * (-1083.883) (-1085.391) (-1082.558) [-1083.172] -- 0:00:23
637500 -- (-1085.639) (-1083.833) (-1084.750) [-1082.396] * [-1082.962] (-1088.777) (-1082.949) (-1082.699) -- 0:00:23
638000 -- [-1084.952] (-1083.098) (-1083.800) (-1084.205) * [-1082.296] (-1082.991) (-1082.450) (-1082.127) -- 0:00:23
638500 -- (-1082.155) (-1083.373) [-1086.329] (-1088.668) * [-1085.501] (-1083.385) (-1083.313) (-1088.110) -- 0:00:24
639000 -- [-1083.146] (-1086.066) (-1083.319) (-1084.871) * [-1083.045] (-1083.917) (-1083.764) (-1083.258) -- 0:00:24
639500 -- (-1082.148) (-1082.958) (-1083.669) [-1084.153] * (-1085.751) (-1087.152) (-1082.158) [-1083.270] -- 0:00:24
640000 -- [-1084.329] (-1086.315) (-1084.684) (-1082.481) * [-1082.570] (-1088.226) (-1085.143) (-1082.679) -- 0:00:24
Average standard deviation of split frequencies: 0.008048
640500 -- (-1085.941) (-1086.571) [-1084.589] (-1083.297) * (-1082.404) [-1082.988] (-1085.389) (-1087.312) -- 0:00:24
641000 -- (-1085.014) [-1083.846] (-1083.631) (-1083.640) * (-1083.464) [-1083.245] (-1084.323) (-1084.069) -- 0:00:24
641500 -- (-1083.904) (-1084.192) [-1083.548] (-1081.851) * [-1087.606] (-1082.615) (-1085.722) (-1083.755) -- 0:00:24
642000 -- (-1086.181) (-1086.797) [-1083.177] (-1082.505) * (-1085.282) (-1083.205) (-1084.681) [-1085.988] -- 0:00:23
642500 -- (-1084.513) (-1088.532) (-1082.325) [-1083.352] * (-1086.792) [-1083.561] (-1083.513) (-1083.192) -- 0:00:23
643000 -- [-1082.999] (-1085.047) (-1083.823) (-1082.856) * (-1090.223) (-1082.893) [-1089.116] (-1082.342) -- 0:00:23
643500 -- (-1082.999) (-1089.378) [-1082.970] (-1082.473) * (-1092.057) (-1083.223) (-1085.950) [-1082.122] -- 0:00:23
644000 -- (-1082.653) (-1094.146) (-1083.673) [-1085.245] * (-1083.474) [-1083.808] (-1086.961) (-1082.127) -- 0:00:23
644500 -- (-1086.029) (-1086.973) [-1083.587] (-1083.848) * (-1082.245) [-1084.173] (-1084.964) (-1082.708) -- 0:00:23
645000 -- [-1081.975] (-1085.200) (-1088.746) (-1083.488) * (-1083.080) (-1084.027) [-1085.854] (-1087.803) -- 0:00:23
Average standard deviation of split frequencies: 0.007662
645500 -- [-1082.857] (-1084.988) (-1086.121) (-1086.640) * [-1084.224] (-1083.925) (-1084.590) (-1084.304) -- 0:00:23
646000 -- (-1084.887) (-1086.150) (-1083.199) [-1083.886] * [-1083.611] (-1085.545) (-1087.043) (-1084.058) -- 0:00:23
646500 -- (-1086.467) [-1081.874] (-1083.257) (-1084.506) * (-1082.251) (-1082.066) [-1082.751] (-1085.986) -- 0:00:23
647000 -- (-1082.147) [-1082.396] (-1082.867) (-1083.554) * (-1082.694) [-1088.393] (-1084.273) (-1086.237) -- 0:00:23
647500 -- (-1083.489) [-1083.287] (-1083.437) (-1084.158) * (-1086.422) (-1086.668) [-1083.503] (-1083.602) -- 0:00:23
648000 -- (-1084.526) (-1083.936) (-1084.720) [-1084.443] * (-1082.950) [-1083.490] (-1087.626) (-1086.261) -- 0:00:23
648500 -- [-1083.979] (-1084.350) (-1086.810) (-1084.372) * (-1086.341) [-1083.869] (-1087.934) (-1084.072) -- 0:00:23
649000 -- (-1082.316) (-1083.634) (-1083.565) [-1084.066] * (-1085.250) [-1082.624] (-1084.726) (-1083.253) -- 0:00:23
649500 -- (-1082.525) (-1085.089) [-1085.461] (-1083.412) * [-1086.969] (-1083.249) (-1085.674) (-1084.436) -- 0:00:23
650000 -- (-1084.589) (-1083.916) (-1083.528) [-1083.644] * (-1083.208) (-1083.068) (-1083.592) [-1083.266] -- 0:00:23
Average standard deviation of split frequencies: 0.008196
650500 -- (-1082.867) [-1082.925] (-1085.291) (-1084.888) * [-1084.409] (-1082.283) (-1085.291) (-1082.384) -- 0:00:23
651000 -- (-1086.177) [-1084.205] (-1083.823) (-1085.094) * [-1084.265] (-1081.982) (-1084.487) (-1085.442) -- 0:00:23
651500 -- [-1084.916] (-1094.181) (-1082.518) (-1084.373) * (-1084.683) (-1082.736) (-1086.764) [-1086.425] -- 0:00:23
652000 -- [-1083.937] (-1084.752) (-1082.244) (-1085.254) * (-1083.035) [-1086.406] (-1085.765) (-1086.468) -- 0:00:22
652500 -- [-1085.565] (-1083.935) (-1086.979) (-1085.784) * (-1083.634) (-1087.210) [-1084.865] (-1082.807) -- 0:00:22
653000 -- (-1082.395) (-1084.050) (-1085.188) [-1083.709] * (-1084.529) (-1082.836) (-1088.131) [-1084.457] -- 0:00:22
653500 -- [-1082.639] (-1088.277) (-1084.683) (-1084.601) * (-1083.228) (-1082.408) [-1082.894] (-1087.372) -- 0:00:22
654000 -- (-1082.045) [-1084.923] (-1083.255) (-1086.063) * (-1092.934) [-1083.224] (-1083.074) (-1083.506) -- 0:00:22
654500 -- (-1082.375) (-1084.012) [-1082.769] (-1083.148) * (-1082.445) (-1085.093) (-1084.878) [-1084.553] -- 0:00:22
655000 -- (-1084.833) (-1083.653) (-1087.421) [-1084.227] * (-1085.603) [-1084.355] (-1083.247) (-1084.897) -- 0:00:23
Average standard deviation of split frequencies: 0.008354
655500 -- (-1085.778) (-1082.072) (-1086.367) [-1083.567] * (-1083.060) [-1082.912] (-1082.839) (-1083.109) -- 0:00:23
656000 -- (-1085.346) (-1085.944) (-1085.960) [-1084.762] * (-1084.493) (-1082.900) (-1084.441) [-1084.217] -- 0:00:23
656500 -- (-1086.503) [-1083.048] (-1083.074) (-1086.376) * (-1085.600) (-1082.607) (-1086.341) [-1084.823] -- 0:00:23
657000 -- (-1083.584) (-1083.236) [-1083.192] (-1082.194) * (-1085.212) [-1083.127] (-1083.809) (-1088.104) -- 0:00:22
657500 -- (-1082.062) [-1084.104] (-1086.180) (-1084.691) * [-1084.488] (-1083.029) (-1084.495) (-1094.071) -- 0:00:22
658000 -- [-1084.534] (-1084.344) (-1087.046) (-1082.507) * (-1083.663) (-1084.055) [-1085.956] (-1087.217) -- 0:00:22
658500 -- (-1087.248) [-1088.121] (-1087.797) (-1083.898) * (-1082.778) (-1087.906) [-1084.911] (-1083.328) -- 0:00:22
659000 -- (-1086.605) (-1084.235) (-1082.099) [-1086.340] * (-1082.878) (-1084.239) [-1084.613] (-1084.640) -- 0:00:22
659500 -- (-1083.261) (-1083.478) [-1082.626] (-1085.403) * (-1082.444) (-1087.170) (-1085.509) [-1084.586] -- 0:00:22
660000 -- (-1083.568) [-1082.899] (-1084.038) (-1083.513) * [-1082.316] (-1085.105) (-1084.414) (-1085.731) -- 0:00:22
Average standard deviation of split frequencies: 0.008384
660500 -- [-1087.083] (-1084.836) (-1082.305) (-1083.239) * [-1083.212] (-1084.809) (-1082.580) (-1084.169) -- 0:00:22
661000 -- (-1083.147) (-1084.535) [-1083.466] (-1082.821) * [-1082.499] (-1082.684) (-1082.500) (-1083.750) -- 0:00:22
661500 -- (-1082.668) (-1087.379) (-1087.786) [-1085.503] * (-1083.111) (-1083.464) (-1082.786) [-1084.577] -- 0:00:22
662000 -- (-1084.231) [-1082.971] (-1085.213) (-1084.261) * (-1082.383) (-1082.582) [-1084.762] (-1088.223) -- 0:00:22
662500 -- [-1086.405] (-1083.502) (-1084.227) (-1087.498) * (-1087.775) (-1083.551) [-1088.710] (-1087.470) -- 0:00:22
663000 -- [-1082.438] (-1088.142) (-1083.105) (-1082.504) * (-1082.886) [-1083.646] (-1082.670) (-1086.581) -- 0:00:22
663500 -- (-1085.493) [-1088.381] (-1082.571) (-1082.690) * [-1084.472] (-1083.236) (-1088.009) (-1082.745) -- 0:00:22
664000 -- (-1082.847) (-1081.830) [-1083.021] (-1082.946) * (-1083.236) [-1083.652] (-1087.548) (-1083.497) -- 0:00:22
664500 -- [-1083.013] (-1082.023) (-1089.409) (-1081.961) * [-1084.651] (-1090.190) (-1084.579) (-1085.649) -- 0:00:22
665000 -- (-1082.282) (-1083.218) (-1085.022) [-1083.823] * (-1082.678) (-1084.604) (-1088.892) [-1085.733] -- 0:00:22
Average standard deviation of split frequencies: 0.008538
665500 -- (-1083.662) (-1084.776) (-1083.361) [-1085.191] * (-1085.406) [-1086.143] (-1090.031) (-1086.854) -- 0:00:22
666000 -- [-1083.125] (-1084.999) (-1083.196) (-1086.330) * [-1082.714] (-1084.859) (-1083.911) (-1085.323) -- 0:00:22
666500 -- [-1083.129] (-1088.448) (-1087.191) (-1085.665) * (-1085.240) (-1085.605) [-1084.036] (-1083.924) -- 0:00:22
667000 -- (-1084.042) [-1083.200] (-1084.020) (-1088.475) * [-1084.129] (-1083.740) (-1082.969) (-1082.097) -- 0:00:21
667500 -- (-1084.040) (-1085.215) [-1084.064] (-1085.798) * (-1089.207) (-1085.164) (-1082.862) [-1082.564] -- 0:00:21
668000 -- (-1084.836) (-1086.660) [-1084.414] (-1087.929) * [-1082.578] (-1086.239) (-1083.733) (-1083.711) -- 0:00:21
668500 -- [-1083.225] (-1082.546) (-1087.673) (-1084.981) * [-1082.988] (-1083.745) (-1086.191) (-1086.431) -- 0:00:21
669000 -- [-1084.258] (-1083.246) (-1082.827) (-1082.682) * [-1081.895] (-1083.382) (-1082.878) (-1083.144) -- 0:00:21
669500 -- [-1082.862] (-1086.755) (-1082.692) (-1083.099) * (-1083.672) (-1091.174) (-1082.525) [-1083.587] -- 0:00:21
670000 -- (-1084.982) [-1084.124] (-1083.565) (-1082.994) * [-1082.049] (-1082.652) (-1084.658) (-1084.287) -- 0:00:21
Average standard deviation of split frequencies: 0.008742
670500 -- (-1083.132) (-1085.480) (-1084.328) [-1081.831] * (-1082.435) [-1082.962] (-1082.129) (-1082.444) -- 0:00:21
671000 -- (-1082.879) (-1083.058) [-1082.429] (-1083.396) * [-1082.419] (-1085.406) (-1082.495) (-1085.866) -- 0:00:22
671500 -- (-1082.201) (-1084.907) [-1082.826] (-1082.745) * (-1083.872) (-1083.460) (-1082.106) [-1083.464] -- 0:00:22
672000 -- (-1083.431) (-1084.255) [-1084.773] (-1082.046) * [-1081.926] (-1088.920) (-1083.031) (-1082.304) -- 0:00:21
672500 -- (-1082.426) (-1084.538) [-1083.200] (-1082.715) * (-1082.537) (-1084.417) [-1082.545] (-1085.276) -- 0:00:21
673000 -- (-1082.481) (-1084.523) (-1083.502) [-1086.912] * (-1082.288) (-1083.875) [-1086.442] (-1083.609) -- 0:00:21
673500 -- [-1083.282] (-1082.870) (-1083.332) (-1087.683) * (-1084.800) (-1083.264) [-1090.942] (-1082.813) -- 0:00:21
674000 -- (-1082.856) [-1084.866] (-1085.419) (-1083.649) * (-1085.940) [-1083.166] (-1087.852) (-1083.534) -- 0:00:21
674500 -- (-1085.651) (-1084.534) [-1088.661] (-1082.435) * (-1085.180) (-1082.860) [-1082.724] (-1087.468) -- 0:00:21
675000 -- (-1085.819) (-1084.217) (-1082.724) [-1082.224] * (-1082.206) (-1081.645) [-1083.493] (-1082.625) -- 0:00:21
Average standard deviation of split frequencies: 0.008281
675500 -- (-1084.561) (-1083.518) (-1083.068) [-1083.619] * [-1081.920] (-1082.190) (-1082.324) (-1082.170) -- 0:00:21
676000 -- (-1082.016) [-1082.241] (-1084.168) (-1082.861) * [-1081.877] (-1084.034) (-1083.734) (-1083.265) -- 0:00:21
676500 -- [-1082.850] (-1084.504) (-1089.227) (-1087.130) * [-1082.634] (-1085.223) (-1086.356) (-1085.083) -- 0:00:21
677000 -- [-1082.810] (-1087.519) (-1083.104) (-1083.340) * (-1087.708) [-1081.750] (-1086.717) (-1084.805) -- 0:00:21
677500 -- (-1082.820) [-1085.276] (-1085.455) (-1084.461) * (-1083.913) (-1083.891) [-1084.607] (-1084.844) -- 0:00:21
678000 -- [-1082.592] (-1084.126) (-1085.504) (-1086.398) * (-1083.598) (-1082.894) [-1085.398] (-1083.998) -- 0:00:21
678500 -- [-1084.996] (-1084.446) (-1084.126) (-1086.590) * (-1084.169) [-1086.361] (-1083.721) (-1083.677) -- 0:00:21
679000 -- (-1085.517) (-1086.713) (-1084.984) [-1082.214] * (-1086.823) (-1083.775) (-1082.284) [-1083.627] -- 0:00:21
679500 -- [-1085.573] (-1085.187) (-1085.611) (-1082.255) * (-1083.270) [-1084.187] (-1082.468) (-1085.000) -- 0:00:21
680000 -- [-1083.119] (-1082.793) (-1084.794) (-1089.077) * (-1084.580) [-1082.039] (-1084.418) (-1089.363) -- 0:00:21
Average standard deviation of split frequencies: 0.007964
680500 -- (-1083.786) (-1083.002) [-1086.350] (-1086.291) * (-1081.801) [-1083.491] (-1086.284) (-1085.604) -- 0:00:21
681000 -- (-1084.839) (-1083.084) [-1085.401] (-1084.838) * (-1084.062) (-1084.307) [-1085.688] (-1084.992) -- 0:00:21
681500 -- (-1083.460) (-1089.527) [-1085.055] (-1085.840) * [-1087.088] (-1082.901) (-1084.852) (-1086.434) -- 0:00:21
682000 -- (-1082.931) (-1082.887) [-1082.970] (-1082.487) * (-1083.219) (-1082.265) (-1083.060) [-1083.982] -- 0:00:20
682500 -- (-1083.875) (-1084.128) (-1083.393) [-1082.512] * (-1085.664) (-1083.353) [-1082.136] (-1088.423) -- 0:00:20
683000 -- (-1084.114) [-1084.411] (-1082.863) (-1084.373) * (-1081.977) (-1083.449) (-1082.329) [-1082.136] -- 0:00:20
683500 -- [-1083.764] (-1084.446) (-1082.375) (-1082.635) * (-1082.481) (-1082.313) (-1083.063) [-1082.796] -- 0:00:20
684000 -- [-1084.069] (-1085.186) (-1084.417) (-1083.122) * (-1081.931) (-1083.647) (-1083.955) [-1083.220] -- 0:00:20
684500 -- (-1085.806) (-1085.668) [-1084.261] (-1083.330) * (-1086.268) (-1085.843) (-1084.196) [-1082.596] -- 0:00:20
685000 -- (-1083.642) (-1083.985) (-1082.412) [-1081.694] * [-1084.459] (-1082.796) (-1082.334) (-1082.639) -- 0:00:20
Average standard deviation of split frequencies: 0.007903
685500 -- (-1082.908) (-1087.585) [-1085.597] (-1087.487) * [-1085.338] (-1085.370) (-1089.950) (-1083.331) -- 0:00:20
686000 -- (-1084.192) (-1086.054) [-1083.058] (-1084.989) * [-1084.458] (-1083.347) (-1083.868) (-1087.844) -- 0:00:20
686500 -- (-1084.331) [-1084.011] (-1084.303) (-1084.865) * (-1084.772) (-1082.232) (-1083.362) [-1085.295] -- 0:00:20
687000 -- [-1082.755] (-1083.242) (-1084.150) (-1087.431) * (-1085.368) (-1084.864) (-1085.538) [-1084.743] -- 0:00:20
687500 -- (-1084.141) [-1083.423] (-1083.375) (-1084.581) * (-1082.709) (-1082.258) [-1084.458] (-1083.794) -- 0:00:20
688000 -- (-1082.830) [-1085.792] (-1087.165) (-1084.289) * (-1085.577) (-1083.637) [-1086.983] (-1083.945) -- 0:00:20
688500 -- [-1082.300] (-1089.184) (-1085.190) (-1085.460) * (-1081.776) (-1083.574) (-1083.820) [-1083.511] -- 0:00:20
689000 -- [-1082.458] (-1083.069) (-1083.604) (-1082.517) * (-1083.299) [-1083.571] (-1084.090) (-1086.796) -- 0:00:20
689500 -- [-1084.939] (-1084.613) (-1082.411) (-1082.211) * [-1088.132] (-1082.440) (-1083.922) (-1083.714) -- 0:00:20
690000 -- (-1082.534) (-1083.196) (-1082.659) [-1085.149] * (-1083.003) (-1084.444) [-1085.327] (-1083.604) -- 0:00:20
Average standard deviation of split frequencies: 0.007593
690500 -- [-1084.014] (-1083.250) (-1084.795) (-1082.790) * (-1083.789) [-1085.357] (-1089.429) (-1086.202) -- 0:00:20
691000 -- (-1085.257) (-1082.754) [-1081.699] (-1083.951) * (-1085.807) [-1083.399] (-1086.814) (-1087.039) -- 0:00:20
691500 -- [-1082.431] (-1082.229) (-1088.975) (-1084.824) * (-1083.763) (-1086.699) [-1082.967] (-1084.748) -- 0:00:20
692000 -- (-1082.133) [-1082.065] (-1083.326) (-1086.609) * (-1085.259) (-1085.173) (-1083.593) [-1083.562] -- 0:00:20
692500 -- (-1085.004) (-1089.359) [-1083.617] (-1083.068) * (-1082.777) (-1082.320) (-1082.176) [-1082.626] -- 0:00:20
693000 -- (-1087.040) (-1086.089) (-1084.777) [-1084.404] * [-1085.535] (-1084.559) (-1082.453) (-1083.669) -- 0:00:20
693500 -- (-1084.160) (-1083.858) [-1088.461] (-1083.735) * (-1085.873) (-1082.310) [-1082.794] (-1084.226) -- 0:00:20
694000 -- (-1082.758) (-1086.041) [-1083.590] (-1085.862) * (-1082.451) [-1083.166] (-1083.400) (-1084.230) -- 0:00:20
694500 -- (-1082.744) [-1085.009] (-1084.983) (-1090.310) * [-1082.955] (-1082.572) (-1083.670) (-1084.343) -- 0:00:20
695000 -- (-1083.955) (-1083.454) [-1090.193] (-1086.526) * (-1083.648) [-1084.647] (-1083.304) (-1087.151) -- 0:00:20
Average standard deviation of split frequencies: 0.007027
695500 -- [-1083.812] (-1084.404) (-1082.108) (-1087.106) * [-1083.668] (-1085.148) (-1084.003) (-1086.903) -- 0:00:20
696000 -- (-1084.848) (-1082.523) [-1083.037] (-1083.822) * (-1084.227) (-1083.383) (-1085.929) [-1089.891] -- 0:00:20
696500 -- [-1084.116] (-1083.521) (-1084.220) (-1085.714) * [-1083.271] (-1082.760) (-1084.445) (-1087.938) -- 0:00:20
697000 -- (-1082.815) (-1084.079) [-1084.732] (-1083.512) * (-1082.518) [-1083.869] (-1085.274) (-1095.504) -- 0:00:19
697500 -- [-1082.894] (-1083.420) (-1084.764) (-1083.060) * (-1084.293) (-1084.393) [-1083.832] (-1083.341) -- 0:00:19
698000 -- [-1083.057] (-1083.106) (-1087.820) (-1083.464) * (-1082.991) (-1085.079) [-1084.133] (-1082.472) -- 0:00:19
698500 -- [-1085.514] (-1085.716) (-1086.976) (-1082.345) * [-1084.951] (-1082.416) (-1086.852) (-1082.929) -- 0:00:19
699000 -- (-1086.239) (-1084.017) (-1087.047) [-1083.181] * [-1086.877] (-1084.796) (-1085.484) (-1082.925) -- 0:00:19
699500 -- (-1082.055) (-1084.316) [-1084.832] (-1087.901) * [-1083.143] (-1086.281) (-1084.592) (-1083.229) -- 0:00:19
700000 -- (-1085.658) (-1083.807) (-1084.659) [-1081.678] * [-1087.557] (-1083.559) (-1082.157) (-1083.783) -- 0:00:19
Average standard deviation of split frequencies: 0.007190
700500 -- (-1087.595) (-1084.376) [-1081.995] (-1088.420) * (-1085.552) (-1081.843) [-1083.520] (-1083.419) -- 0:00:19
701000 -- (-1084.286) [-1084.916] (-1082.774) (-1082.110) * (-1083.269) [-1083.932] (-1082.746) (-1084.037) -- 0:00:19
701500 -- (-1084.627) (-1083.759) (-1082.067) [-1083.981] * (-1083.990) [-1085.341] (-1082.003) (-1087.968) -- 0:00:19
702000 -- [-1083.665] (-1084.132) (-1083.879) (-1086.565) * (-1086.969) (-1082.346) (-1085.203) [-1085.085] -- 0:00:19
702500 -- (-1084.205) (-1085.684) (-1084.431) [-1083.618] * (-1085.032) [-1083.110] (-1084.565) (-1083.068) -- 0:00:19
703000 -- (-1084.364) (-1085.262) (-1085.708) [-1085.166] * [-1084.416] (-1084.390) (-1087.845) (-1082.300) -- 0:00:19
703500 -- (-1082.504) (-1083.554) (-1085.232) [-1084.260] * (-1085.538) [-1082.710] (-1082.413) (-1087.916) -- 0:00:19
704000 -- [-1083.092] (-1082.883) (-1086.211) (-1086.923) * (-1084.423) [-1082.395] (-1084.668) (-1086.243) -- 0:00:19
704500 -- (-1083.629) [-1084.163] (-1086.008) (-1087.741) * (-1085.716) [-1082.766] (-1085.714) (-1084.862) -- 0:00:19
705000 -- (-1083.230) (-1082.598) [-1086.156] (-1087.653) * (-1082.459) [-1086.413] (-1085.181) (-1084.543) -- 0:00:19
Average standard deviation of split frequencies: 0.007136
705500 -- [-1083.343] (-1086.357) (-1085.164) (-1082.736) * [-1085.614] (-1085.058) (-1084.010) (-1084.319) -- 0:00:19
706000 -- (-1083.409) [-1084.302] (-1084.641) (-1085.502) * (-1088.115) (-1084.355) (-1088.184) [-1083.968] -- 0:00:19
706500 -- [-1084.354] (-1086.482) (-1085.073) (-1081.771) * (-1086.999) [-1082.340] (-1082.646) (-1082.839) -- 0:00:19
707000 -- (-1085.580) (-1084.974) (-1084.991) [-1081.772] * (-1084.307) (-1085.001) (-1084.441) [-1086.926] -- 0:00:19
707500 -- [-1083.686] (-1082.875) (-1085.640) (-1084.014) * (-1087.965) (-1085.887) [-1083.398] (-1084.428) -- 0:00:19
708000 -- [-1085.700] (-1081.884) (-1085.661) (-1084.402) * (-1087.071) (-1083.156) (-1082.456) [-1083.121] -- 0:00:19
708500 -- [-1084.147] (-1082.427) (-1082.063) (-1083.229) * (-1082.448) [-1082.272] (-1084.052) (-1082.366) -- 0:00:19
709000 -- (-1086.067) [-1086.400] (-1083.253) (-1083.231) * [-1082.312] (-1084.266) (-1085.646) (-1082.720) -- 0:00:19
709500 -- [-1086.000] (-1083.157) (-1086.433) (-1087.276) * (-1082.011) (-1083.740) (-1081.902) [-1083.804] -- 0:00:19
710000 -- [-1083.527] (-1085.068) (-1087.343) (-1082.580) * (-1083.054) [-1085.953] (-1087.102) (-1083.727) -- 0:00:19
Average standard deviation of split frequencies: 0.007214
710500 -- (-1087.153) (-1084.398) [-1083.657] (-1084.597) * (-1083.451) (-1083.906) (-1087.151) [-1084.595] -- 0:00:19
711000 -- [-1086.692] (-1084.282) (-1083.910) (-1090.344) * (-1084.670) [-1082.619] (-1082.795) (-1082.100) -- 0:00:19
711500 -- (-1082.694) [-1083.612] (-1084.641) (-1088.745) * (-1085.199) (-1083.822) (-1082.813) [-1084.787] -- 0:00:19
712000 -- (-1082.799) [-1081.740] (-1085.768) (-1084.907) * (-1088.519) [-1082.822] (-1082.313) (-1085.040) -- 0:00:19
712500 -- (-1083.014) (-1084.763) [-1082.381] (-1086.011) * (-1083.355) [-1084.153] (-1082.314) (-1084.185) -- 0:00:18
713000 -- (-1084.842) [-1082.646] (-1086.288) (-1086.214) * (-1082.644) [-1082.388] (-1082.480) (-1083.327) -- 0:00:18
713500 -- [-1082.806] (-1082.331) (-1082.391) (-1083.951) * (-1085.897) (-1081.813) [-1082.098] (-1083.852) -- 0:00:18
714000 -- (-1085.044) [-1085.300] (-1082.452) (-1082.210) * (-1083.159) (-1085.258) (-1082.143) [-1086.475] -- 0:00:18
714500 -- (-1083.857) (-1084.768) (-1084.645) [-1082.165] * (-1082.630) (-1085.109) [-1084.042] (-1082.790) -- 0:00:18
715000 -- (-1083.833) [-1085.772] (-1089.305) (-1083.329) * (-1086.152) (-1083.261) [-1084.221] (-1084.223) -- 0:00:18
Average standard deviation of split frequencies: 0.007119
715500 -- (-1083.338) [-1084.770] (-1088.156) (-1083.994) * [-1085.646] (-1082.496) (-1088.743) (-1083.031) -- 0:00:18
716000 -- [-1083.529] (-1085.478) (-1087.709) (-1083.786) * (-1087.196) [-1087.650] (-1082.829) (-1083.599) -- 0:00:18
716500 -- (-1084.319) (-1082.591) (-1088.403) [-1084.636] * (-1083.408) (-1085.041) [-1088.012] (-1082.936) -- 0:00:18
717000 -- (-1084.361) (-1083.481) (-1083.702) [-1083.849] * (-1082.172) (-1084.191) (-1087.908) [-1084.154] -- 0:00:18
717500 -- [-1084.533] (-1086.105) (-1082.590) (-1086.220) * [-1081.778] (-1091.781) (-1083.914) (-1085.169) -- 0:00:18
718000 -- (-1085.321) (-1084.074) [-1085.627] (-1086.753) * (-1082.101) (-1085.498) [-1084.111] (-1084.964) -- 0:00:18
718500 -- (-1087.117) (-1085.718) (-1085.544) [-1084.706] * (-1082.370) (-1082.739) [-1085.239] (-1086.760) -- 0:00:18
719000 -- (-1083.230) [-1082.707] (-1082.727) (-1085.292) * (-1083.006) [-1084.483] (-1083.783) (-1087.150) -- 0:00:18
719500 -- [-1082.503] (-1082.298) (-1085.825) (-1082.444) * (-1083.000) [-1084.587] (-1081.915) (-1081.849) -- 0:00:18
720000 -- [-1085.925] (-1082.532) (-1082.121) (-1084.602) * (-1086.919) (-1082.144) (-1082.359) [-1086.621] -- 0:00:18
Average standard deviation of split frequencies: 0.007236
720500 -- (-1082.605) (-1085.722) [-1083.837] (-1090.320) * (-1089.704) [-1084.029] (-1082.820) (-1087.973) -- 0:00:18
721000 -- [-1084.392] (-1091.669) (-1084.717) (-1082.948) * (-1086.945) (-1083.372) (-1085.490) [-1087.372] -- 0:00:18
721500 -- (-1084.086) (-1088.012) (-1085.809) [-1082.940] * (-1082.472) (-1084.177) [-1083.336] (-1083.546) -- 0:00:18
722000 -- [-1083.825] (-1086.981) (-1086.486) (-1089.145) * [-1083.358] (-1083.683) (-1083.696) (-1083.685) -- 0:00:18
722500 -- (-1083.983) (-1088.045) (-1086.647) [-1083.346] * (-1084.942) (-1089.244) [-1084.774] (-1083.627) -- 0:00:18
723000 -- (-1082.251) (-1088.477) [-1082.240] (-1082.630) * (-1083.377) [-1083.757] (-1086.272) (-1083.506) -- 0:00:18
723500 -- (-1082.146) (-1086.672) (-1083.090) [-1082.894] * [-1083.016] (-1084.919) (-1085.649) (-1085.302) -- 0:00:18
724000 -- (-1082.465) (-1083.614) [-1084.002] (-1089.295) * (-1083.141) [-1082.763] (-1082.327) (-1083.410) -- 0:00:18
724500 -- [-1081.916] (-1082.313) (-1086.828) (-1086.089) * (-1083.702) (-1083.094) [-1083.490] (-1083.085) -- 0:00:18
725000 -- (-1083.638) (-1082.440) [-1082.995] (-1084.464) * [-1083.132] (-1082.192) (-1083.833) (-1083.688) -- 0:00:18
Average standard deviation of split frequencies: 0.007467
725500 -- [-1086.663] (-1084.847) (-1090.494) (-1085.594) * (-1082.906) (-1085.608) [-1083.833] (-1085.518) -- 0:00:18
726000 -- [-1082.341] (-1086.774) (-1084.519) (-1085.730) * (-1082.396) (-1089.901) [-1086.909] (-1083.181) -- 0:00:18
726500 -- (-1084.955) (-1084.200) (-1083.574) [-1083.736] * (-1083.062) (-1086.375) (-1084.418) [-1081.918] -- 0:00:18
727000 -- (-1085.433) [-1083.096] (-1085.849) (-1085.273) * [-1083.222] (-1085.826) (-1085.321) (-1083.499) -- 0:00:18
727500 -- (-1083.649) [-1082.999] (-1084.902) (-1082.394) * [-1084.048] (-1083.268) (-1087.143) (-1086.906) -- 0:00:17
728000 -- (-1085.148) (-1081.907) (-1083.822) [-1083.371] * [-1082.925] (-1083.861) (-1085.782) (-1087.867) -- 0:00:17
728500 -- (-1084.524) [-1082.982] (-1084.290) (-1082.447) * (-1083.954) (-1085.087) [-1086.450] (-1090.459) -- 0:00:17
729000 -- (-1085.169) (-1084.123) (-1083.045) [-1082.937] * [-1083.306] (-1084.865) (-1086.742) (-1082.566) -- 0:00:17
729500 -- (-1084.878) (-1083.182) [-1083.353] (-1083.900) * (-1082.776) [-1083.188] (-1083.533) (-1082.830) -- 0:00:17
730000 -- (-1083.617) [-1084.353] (-1084.488) (-1082.386) * (-1083.953) (-1084.487) [-1084.383] (-1084.971) -- 0:00:17
Average standard deviation of split frequencies: 0.007057
730500 -- (-1083.036) (-1085.462) [-1083.762] (-1086.698) * (-1084.117) (-1082.363) (-1083.307) [-1083.187] -- 0:00:17
731000 -- (-1085.442) (-1085.756) (-1082.623) [-1082.168] * [-1086.636] (-1082.617) (-1084.147) (-1083.612) -- 0:00:17
731500 -- (-1083.557) (-1091.673) [-1083.426] (-1082.398) * (-1086.792) [-1082.402] (-1087.582) (-1083.655) -- 0:00:17
732000 -- (-1083.536) (-1085.410) (-1084.253) [-1083.999] * [-1086.328] (-1083.051) (-1083.244) (-1082.306) -- 0:00:17
732500 -- (-1084.447) (-1089.151) [-1086.303] (-1084.843) * (-1083.269) [-1083.936] (-1086.706) (-1085.110) -- 0:00:17
733000 -- (-1085.417) [-1088.669] (-1084.469) (-1088.827) * (-1083.930) (-1083.596) [-1083.593] (-1083.247) -- 0:00:17
733500 -- (-1083.227) (-1087.791) [-1082.519] (-1089.338) * (-1086.662) (-1085.003) (-1086.512) [-1083.780] -- 0:00:17
734000 -- [-1084.029] (-1084.800) (-1083.585) (-1087.941) * (-1084.141) (-1083.464) (-1084.033) [-1085.414] -- 0:00:17
734500 -- (-1084.906) [-1084.482] (-1084.920) (-1085.730) * (-1084.412) (-1082.258) (-1083.842) [-1086.778] -- 0:00:17
735000 -- [-1084.836] (-1090.634) (-1082.852) (-1084.546) * (-1082.299) [-1084.527] (-1089.294) (-1084.337) -- 0:00:17
Average standard deviation of split frequencies: 0.007085
735500 -- [-1084.957] (-1096.273) (-1083.528) (-1084.919) * (-1082.606) (-1082.727) (-1086.789) [-1082.980] -- 0:00:17
736000 -- (-1085.887) (-1082.393) [-1083.759] (-1084.082) * (-1087.935) (-1090.863) [-1081.689] (-1084.079) -- 0:00:17
736500 -- (-1082.856) (-1084.686) (-1085.775) [-1083.920] * (-1082.563) (-1086.796) (-1083.021) [-1081.610] -- 0:00:17
737000 -- (-1084.829) (-1083.710) (-1083.202) [-1085.114] * (-1084.435) [-1085.553] (-1083.785) (-1082.974) -- 0:00:17
737500 -- (-1084.477) (-1084.841) (-1082.767) [-1083.269] * (-1084.318) [-1085.621] (-1085.011) (-1084.388) -- 0:00:17
738000 -- [-1083.403] (-1089.377) (-1082.116) (-1086.909) * (-1083.827) (-1089.448) [-1083.652] (-1086.169) -- 0:00:17
738500 -- (-1089.921) [-1089.011] (-1083.289) (-1088.236) * (-1082.657) [-1083.417] (-1083.801) (-1093.499) -- 0:00:17
739000 -- (-1085.158) [-1082.413] (-1083.473) (-1086.144) * (-1084.235) (-1082.985) [-1081.689] (-1087.402) -- 0:00:17
739500 -- (-1083.732) [-1082.461] (-1086.241) (-1085.663) * [-1083.024] (-1082.969) (-1086.590) (-1084.121) -- 0:00:17
740000 -- [-1088.206] (-1085.715) (-1083.404) (-1087.250) * (-1082.356) (-1084.069) [-1085.738] (-1082.510) -- 0:00:17
Average standard deviation of split frequencies: 0.007001
740500 -- (-1087.128) (-1085.622) [-1082.735] (-1083.589) * (-1083.765) (-1082.723) [-1082.303] (-1084.397) -- 0:00:17
741000 -- [-1083.491] (-1084.720) (-1091.725) (-1082.734) * (-1086.381) (-1083.514) (-1084.079) [-1083.361] -- 0:00:17
741500 -- (-1083.146) [-1085.018] (-1083.310) (-1083.461) * (-1084.449) (-1084.294) [-1084.281] (-1087.410) -- 0:00:17
742000 -- (-1085.904) (-1083.368) (-1082.818) [-1082.372] * (-1083.852) [-1083.875] (-1086.103) (-1082.488) -- 0:00:17
742500 -- [-1084.391] (-1082.766) (-1083.350) (-1087.800) * (-1084.122) (-1086.678) [-1082.259] (-1086.005) -- 0:00:16
743000 -- [-1085.504] (-1082.627) (-1088.561) (-1088.244) * (-1085.596) (-1083.983) [-1087.390] (-1088.412) -- 0:00:16
743500 -- (-1087.182) (-1085.374) (-1084.262) [-1084.418] * (-1082.763) (-1082.321) (-1083.733) [-1083.883] -- 0:00:16
744000 -- (-1084.862) (-1083.714) [-1086.261] (-1082.794) * (-1085.724) (-1083.637) [-1083.125] (-1082.514) -- 0:00:16
744500 -- (-1088.118) [-1083.676] (-1083.237) (-1083.675) * (-1085.263) (-1082.763) (-1083.112) [-1082.198] -- 0:00:16
745000 -- (-1084.218) [-1083.753] (-1086.094) (-1084.862) * (-1085.802) [-1083.530] (-1083.004) (-1082.868) -- 0:00:16
Average standard deviation of split frequencies: 0.006872
745500 -- (-1082.585) [-1084.905] (-1083.652) (-1082.780) * (-1086.617) (-1084.016) [-1081.714] (-1084.586) -- 0:00:16
746000 -- [-1084.907] (-1085.006) (-1083.111) (-1083.220) * [-1087.927] (-1087.956) (-1083.326) (-1085.019) -- 0:00:16
746500 -- (-1085.557) (-1086.717) [-1086.051] (-1085.912) * (-1087.697) [-1087.133] (-1085.453) (-1082.684) -- 0:00:16
747000 -- (-1084.186) [-1083.180] (-1088.225) (-1087.130) * [-1084.251] (-1090.557) (-1082.288) (-1083.403) -- 0:00:16
747500 -- [-1083.944] (-1086.750) (-1085.616) (-1088.693) * (-1083.518) (-1085.591) (-1084.157) [-1083.966] -- 0:00:16
748000 -- (-1085.927) (-1082.776) (-1085.222) [-1084.787] * (-1082.551) (-1082.837) [-1082.637] (-1084.274) -- 0:00:16
748500 -- (-1084.434) (-1081.807) [-1086.632] (-1084.610) * (-1083.403) [-1082.939] (-1082.163) (-1084.994) -- 0:00:16
749000 -- [-1084.194] (-1082.077) (-1087.798) (-1086.538) * (-1082.982) [-1083.824] (-1084.019) (-1086.329) -- 0:00:16
749500 -- (-1082.178) (-1081.987) (-1082.382) [-1083.361] * (-1086.459) (-1084.275) (-1082.416) [-1084.289] -- 0:00:16
750000 -- [-1084.699] (-1083.130) (-1084.868) (-1087.525) * [-1082.327] (-1087.391) (-1086.935) (-1083.423) -- 0:00:16
Average standard deviation of split frequencies: 0.007575
750500 -- (-1082.460) (-1084.698) [-1087.376] (-1083.502) * [-1082.559] (-1084.957) (-1089.556) (-1084.444) -- 0:00:16
751000 -- (-1088.578) [-1085.582] (-1083.149) (-1082.629) * (-1083.016) (-1084.691) [-1082.920] (-1085.203) -- 0:00:16
751500 -- (-1084.517) (-1083.879) (-1083.522) [-1082.187] * [-1084.467] (-1083.651) (-1082.346) (-1083.326) -- 0:00:16
752000 -- (-1086.179) (-1084.845) [-1082.792] (-1082.597) * (-1083.978) [-1084.253] (-1085.411) (-1083.246) -- 0:00:16
752500 -- (-1085.867) (-1084.741) (-1083.333) [-1083.955] * (-1084.223) [-1081.860] (-1085.092) (-1086.437) -- 0:00:16
753000 -- (-1082.652) (-1084.399) (-1083.013) [-1083.464] * (-1082.446) (-1085.225) [-1083.030] (-1083.288) -- 0:00:16
753500 -- [-1082.636] (-1082.343) (-1083.815) (-1082.850) * (-1082.894) [-1085.012] (-1083.315) (-1085.832) -- 0:00:16
754000 -- [-1082.873] (-1084.117) (-1082.822) (-1083.085) * [-1081.957] (-1085.643) (-1084.453) (-1082.521) -- 0:00:16
754500 -- [-1084.487] (-1083.684) (-1083.700) (-1083.219) * [-1084.029] (-1083.418) (-1089.346) (-1085.070) -- 0:00:16
755000 -- [-1086.530] (-1083.898) (-1082.925) (-1083.368) * [-1082.972] (-1084.815) (-1084.174) (-1082.725) -- 0:00:16
Average standard deviation of split frequencies: 0.007677
755500 -- (-1084.934) [-1083.305] (-1082.580) (-1082.119) * (-1085.518) (-1084.792) [-1082.047] (-1084.728) -- 0:00:16
756000 -- (-1086.045) (-1085.658) (-1087.366) [-1083.375] * (-1082.818) [-1085.592] (-1082.676) (-1089.121) -- 0:00:16
756500 -- (-1085.007) (-1087.955) (-1082.403) [-1083.199] * (-1083.755) (-1084.598) (-1082.727) [-1085.115] -- 0:00:16
757000 -- (-1087.021) (-1085.758) (-1083.487) [-1082.821] * [-1084.352] (-1084.676) (-1083.742) (-1084.357) -- 0:00:16
757500 -- (-1083.284) (-1082.759) (-1085.371) [-1082.045] * [-1082.196] (-1081.956) (-1089.937) (-1083.794) -- 0:00:16
758000 -- (-1082.467) [-1082.454] (-1084.856) (-1088.551) * (-1083.757) (-1083.315) [-1084.702] (-1082.959) -- 0:00:15
758500 -- (-1083.848) (-1081.790) [-1084.298] (-1084.529) * [-1086.052] (-1083.976) (-1084.544) (-1082.451) -- 0:00:15
759000 -- (-1088.059) [-1082.764] (-1085.067) (-1084.746) * (-1085.945) (-1082.396) [-1084.352] (-1082.812) -- 0:00:15
759500 -- (-1082.720) (-1084.363) (-1090.551) [-1086.498] * (-1083.521) (-1083.739) (-1083.554) [-1082.870] -- 0:00:15
760000 -- (-1084.400) (-1083.548) [-1082.243] (-1085.605) * (-1082.204) (-1085.852) [-1082.412] (-1082.478) -- 0:00:15
Average standard deviation of split frequencies: 0.008134
760500 -- (-1082.184) (-1084.252) (-1084.015) [-1086.523] * (-1084.977) (-1085.388) (-1084.422) [-1085.173] -- 0:00:15
761000 -- (-1082.614) (-1083.633) (-1083.022) [-1082.028] * (-1084.183) [-1082.299] (-1083.989) (-1087.593) -- 0:00:15
761500 -- (-1082.510) [-1081.639] (-1084.453) (-1082.116) * (-1083.106) (-1083.672) [-1083.938] (-1086.064) -- 0:00:15
762000 -- (-1083.617) [-1083.516] (-1085.698) (-1086.494) * (-1086.928) [-1087.168] (-1083.468) (-1082.896) -- 0:00:15
762500 -- (-1086.387) [-1082.221] (-1090.163) (-1083.237) * (-1088.250) (-1087.640) (-1082.658) [-1085.510] -- 0:00:15
763000 -- [-1085.757] (-1088.315) (-1085.119) (-1083.348) * (-1084.805) (-1084.387) (-1082.397) [-1084.530] -- 0:00:15
763500 -- [-1085.538] (-1084.899) (-1088.269) (-1082.151) * (-1083.941) (-1084.154) (-1082.247) [-1083.577] -- 0:00:15
764000 -- (-1084.420) [-1086.274] (-1082.340) (-1085.068) * [-1083.319] (-1084.979) (-1082.738) (-1085.242) -- 0:00:15
764500 -- [-1084.066] (-1082.215) (-1084.761) (-1088.091) * (-1085.032) (-1085.428) [-1083.847] (-1084.519) -- 0:00:15
765000 -- (-1084.394) [-1084.672] (-1082.283) (-1089.510) * (-1083.897) [-1083.582] (-1084.242) (-1083.262) -- 0:00:15
Average standard deviation of split frequencies: 0.008270
765500 -- [-1085.374] (-1083.432) (-1082.070) (-1084.975) * (-1083.554) (-1085.864) [-1083.851] (-1083.302) -- 0:00:15
766000 -- (-1083.331) [-1083.927] (-1087.632) (-1086.649) * (-1082.000) (-1084.518) [-1083.287] (-1083.562) -- 0:00:15
766500 -- [-1084.795] (-1083.283) (-1085.606) (-1084.312) * (-1082.444) (-1082.507) (-1085.491) [-1083.322] -- 0:00:15
767000 -- (-1083.622) [-1084.154] (-1084.852) (-1082.283) * (-1082.048) (-1084.127) [-1084.097] (-1086.799) -- 0:00:15
767500 -- (-1084.040) (-1082.896) (-1084.936) [-1082.551] * [-1082.186] (-1085.485) (-1082.366) (-1088.148) -- 0:00:15
768000 -- (-1087.372) (-1083.388) (-1086.399) [-1083.347] * [-1084.331] (-1088.788) (-1082.274) (-1082.342) -- 0:00:15
768500 -- (-1084.394) (-1083.168) (-1083.138) [-1083.282] * (-1086.093) (-1085.107) (-1084.877) [-1082.730] -- 0:00:15
769000 -- (-1083.695) (-1083.072) (-1083.232) [-1083.086] * (-1083.803) (-1084.825) (-1084.100) [-1083.474] -- 0:00:15
769500 -- (-1083.073) [-1081.891] (-1082.405) (-1084.002) * [-1086.954] (-1085.736) (-1085.308) (-1082.781) -- 0:00:15
770000 -- (-1084.042) [-1085.504] (-1087.176) (-1084.873) * (-1085.508) (-1084.626) (-1084.138) [-1083.831] -- 0:00:15
Average standard deviation of split frequencies: 0.008181
770500 -- [-1085.150] (-1082.525) (-1084.629) (-1086.226) * (-1083.418) (-1086.865) (-1084.477) [-1084.022] -- 0:00:15
771000 -- (-1083.512) (-1085.189) [-1083.462] (-1084.924) * [-1085.108] (-1082.601) (-1084.513) (-1083.983) -- 0:00:15
771500 -- (-1083.508) (-1082.315) (-1082.464) [-1083.509] * (-1084.767) (-1085.042) [-1084.618] (-1087.985) -- 0:00:15
772000 -- (-1083.487) (-1084.271) [-1084.082] (-1083.331) * (-1084.833) [-1082.990] (-1083.766) (-1086.954) -- 0:00:15
772500 -- (-1083.383) (-1083.390) [-1084.271] (-1086.554) * [-1084.421] (-1084.004) (-1084.816) (-1087.187) -- 0:00:15
773000 -- [-1082.048] (-1083.313) (-1084.342) (-1082.408) * (-1087.960) [-1084.978] (-1083.660) (-1085.655) -- 0:00:14
773500 -- (-1082.611) [-1082.832] (-1084.395) (-1083.661) * (-1084.506) [-1084.278] (-1082.719) (-1083.554) -- 0:00:14
774000 -- (-1081.946) (-1087.364) (-1082.243) [-1083.712] * (-1088.372) (-1084.245) [-1083.565] (-1082.302) -- 0:00:14
774500 -- (-1085.888) [-1083.581] (-1086.260) (-1086.155) * (-1086.793) [-1083.266] (-1083.483) (-1082.517) -- 0:00:14
775000 -- (-1085.839) (-1086.278) [-1084.650] (-1082.551) * (-1086.513) [-1083.689] (-1087.927) (-1083.484) -- 0:00:14
Average standard deviation of split frequencies: 0.008543
775500 -- (-1083.440) [-1081.772] (-1085.562) (-1085.553) * (-1084.894) (-1083.237) [-1082.995] (-1083.471) -- 0:00:14
776000 -- (-1081.915) [-1084.589] (-1084.274) (-1085.227) * (-1085.643) (-1082.946) [-1082.508] (-1084.202) -- 0:00:14
776500 -- [-1082.574] (-1083.876) (-1085.409) (-1083.952) * (-1083.586) (-1083.006) [-1082.727] (-1083.648) -- 0:00:14
777000 -- (-1086.728) [-1083.957] (-1083.929) (-1082.300) * (-1082.690) (-1083.195) (-1082.740) [-1086.236] -- 0:00:14
777500 -- (-1082.484) (-1085.540) (-1082.704) [-1082.676] * [-1086.401] (-1083.304) (-1082.606) (-1083.934) -- 0:00:14
778000 -- [-1081.682] (-1084.970) (-1085.162) (-1083.677) * [-1086.457] (-1083.537) (-1082.438) (-1085.649) -- 0:00:14
778500 -- (-1082.277) [-1083.306] (-1083.081) (-1083.851) * [-1085.970] (-1082.955) (-1083.551) (-1083.672) -- 0:00:14
779000 -- (-1082.586) (-1083.437) (-1087.186) [-1083.690] * [-1088.573] (-1084.202) (-1083.215) (-1084.388) -- 0:00:14
779500 -- (-1082.586) (-1084.137) [-1084.319] (-1082.019) * (-1089.877) (-1086.880) [-1084.626] (-1084.965) -- 0:00:14
780000 -- (-1082.211) (-1086.198) (-1082.444) [-1084.206] * [-1087.369] (-1082.187) (-1085.513) (-1084.621) -- 0:00:14
Average standard deviation of split frequencies: 0.008378
780500 -- (-1084.420) [-1086.966] (-1084.133) (-1082.647) * (-1085.233) (-1083.107) [-1085.973] (-1083.926) -- 0:00:14
781000 -- (-1082.540) (-1087.597) (-1083.390) [-1083.476] * (-1086.044) [-1082.928] (-1084.034) (-1086.033) -- 0:00:14
781500 -- (-1086.256) (-1084.222) [-1082.933] (-1088.144) * [-1085.305] (-1082.758) (-1084.541) (-1086.657) -- 0:00:14
782000 -- (-1083.751) (-1084.780) (-1083.523) [-1084.630] * [-1083.556] (-1082.031) (-1084.159) (-1083.695) -- 0:00:14
782500 -- (-1084.282) [-1085.263] (-1082.988) (-1082.030) * [-1088.757] (-1085.369) (-1083.568) (-1086.196) -- 0:00:14
783000 -- (-1090.080) (-1085.001) (-1083.767) [-1082.580] * (-1083.321) [-1082.154] (-1083.660) (-1088.843) -- 0:00:14
783500 -- (-1084.330) [-1083.846] (-1084.063) (-1082.578) * [-1082.993] (-1082.094) (-1083.616) (-1087.242) -- 0:00:14
784000 -- (-1084.825) [-1082.672] (-1084.189) (-1082.350) * (-1082.406) [-1083.407] (-1084.195) (-1084.288) -- 0:00:14
784500 -- [-1082.052] (-1083.267) (-1086.892) (-1083.553) * (-1083.355) [-1084.987] (-1084.074) (-1085.496) -- 0:00:14
785000 -- (-1084.991) [-1084.085] (-1088.653) (-1083.762) * (-1082.097) [-1082.624] (-1085.053) (-1082.920) -- 0:00:14
Average standard deviation of split frequencies: 0.008247
785500 -- (-1083.361) (-1083.622) (-1084.102) [-1084.316] * (-1081.790) [-1085.552] (-1085.701) (-1087.138) -- 0:00:14
786000 -- (-1083.099) [-1086.645] (-1083.821) (-1084.409) * [-1081.945] (-1082.991) (-1083.050) (-1086.642) -- 0:00:14
786500 -- (-1081.699) (-1083.150) [-1083.338] (-1083.860) * [-1084.389] (-1083.809) (-1084.898) (-1084.289) -- 0:00:14
787000 -- [-1082.240] (-1082.191) (-1082.618) (-1082.304) * (-1083.789) [-1083.661] (-1086.366) (-1084.463) -- 0:00:14
787500 -- (-1083.044) (-1092.440) (-1082.519) [-1082.615] * [-1084.101] (-1083.794) (-1089.341) (-1083.296) -- 0:00:14
788000 -- (-1084.189) (-1083.826) (-1083.379) [-1083.458] * (-1083.281) [-1083.196] (-1085.477) (-1082.914) -- 0:00:13
788500 -- (-1082.769) [-1086.199] (-1089.279) (-1083.924) * (-1088.124) (-1084.209) (-1086.105) [-1084.791] -- 0:00:13
789000 -- (-1083.120) (-1087.467) [-1086.645] (-1086.288) * [-1082.933] (-1088.116) (-1087.696) (-1084.292) -- 0:00:13
789500 -- (-1084.077) (-1085.685) (-1086.239) [-1088.452] * [-1085.428] (-1086.021) (-1082.056) (-1084.017) -- 0:00:13
790000 -- [-1081.634] (-1085.872) (-1088.262) (-1086.636) * (-1085.944) [-1086.435] (-1085.258) (-1084.019) -- 0:00:13
Average standard deviation of split frequencies: 0.008049
790500 -- (-1083.650) [-1082.440] (-1088.329) (-1085.835) * (-1082.719) (-1083.662) [-1088.278] (-1084.457) -- 0:00:13
791000 -- (-1090.916) (-1085.467) [-1083.054] (-1084.562) * (-1083.628) (-1085.784) [-1083.697] (-1083.783) -- 0:00:13
791500 -- (-1085.358) [-1085.934] (-1083.777) (-1084.182) * (-1082.534) (-1083.928) [-1082.863] (-1082.773) -- 0:00:13
792000 -- (-1085.704) [-1084.178] (-1083.316) (-1085.879) * [-1082.324] (-1085.382) (-1088.960) (-1082.931) -- 0:00:13
792500 -- [-1082.618] (-1082.887) (-1083.620) (-1082.838) * [-1084.118] (-1083.794) (-1089.392) (-1082.561) -- 0:00:13
793000 -- (-1083.172) (-1081.817) [-1084.205] (-1082.744) * (-1084.686) [-1082.399] (-1084.125) (-1085.899) -- 0:00:13
793500 -- (-1083.095) [-1083.062] (-1082.626) (-1086.411) * (-1083.746) (-1086.530) (-1082.968) [-1086.777] -- 0:00:13
794000 -- (-1083.845) [-1083.814] (-1083.185) (-1087.097) * (-1083.705) (-1085.577) (-1082.682) [-1085.008] -- 0:00:13
794500 -- (-1084.665) (-1085.276) [-1085.199] (-1087.994) * [-1082.791] (-1084.323) (-1087.524) (-1086.646) -- 0:00:13
795000 -- (-1085.278) [-1084.392] (-1085.671) (-1085.931) * (-1082.460) (-1086.597) (-1085.579) [-1083.120] -- 0:00:13
Average standard deviation of split frequencies: 0.007847
795500 -- (-1084.323) (-1083.482) [-1084.105] (-1085.595) * [-1083.188] (-1087.479) (-1085.797) (-1087.633) -- 0:00:13
796000 -- (-1083.342) [-1083.057] (-1082.845) (-1083.144) * [-1084.819] (-1085.108) (-1082.482) (-1081.956) -- 0:00:13
796500 -- [-1086.814] (-1086.700) (-1083.129) (-1087.320) * (-1083.056) [-1082.737] (-1086.426) (-1087.210) -- 0:00:13
797000 -- (-1085.271) [-1083.956] (-1086.291) (-1086.389) * (-1084.264) (-1083.077) [-1083.651] (-1083.747) -- 0:00:13
797500 -- (-1086.953) (-1085.069) [-1081.786] (-1087.181) * (-1086.413) (-1083.985) [-1081.923] (-1083.764) -- 0:00:13
798000 -- (-1082.200) [-1084.100] (-1085.377) (-1088.178) * (-1084.556) (-1083.924) [-1082.770] (-1084.912) -- 0:00:13
798500 -- (-1086.353) [-1081.954] (-1082.796) (-1085.793) * [-1083.077] (-1082.368) (-1084.248) (-1083.258) -- 0:00:13
799000 -- [-1083.023] (-1083.374) (-1084.599) (-1084.089) * (-1085.786) (-1081.670) [-1089.735] (-1084.665) -- 0:00:13
799500 -- [-1081.700] (-1082.720) (-1083.301) (-1085.456) * (-1085.338) (-1083.211) [-1082.917] (-1083.319) -- 0:00:13
800000 -- (-1082.608) (-1085.143) (-1082.462) [-1085.034] * (-1085.424) [-1085.158] (-1082.466) (-1083.482) -- 0:00:13
Average standard deviation of split frequencies: 0.007654
800500 -- [-1084.800] (-1083.361) (-1083.899) (-1084.197) * (-1084.445) [-1084.823] (-1084.261) (-1085.216) -- 0:00:13
801000 -- (-1086.096) (-1083.102) (-1085.288) [-1083.108] * (-1082.842) (-1082.696) (-1089.698) [-1087.829] -- 0:00:13
801500 -- (-1089.242) (-1085.017) [-1082.443] (-1085.926) * (-1083.440) (-1084.616) [-1085.182] (-1083.148) -- 0:00:13
802000 -- (-1088.917) [-1081.773] (-1083.423) (-1083.263) * (-1082.394) (-1083.665) (-1082.252) [-1083.110] -- 0:00:13
802500 -- (-1084.741) (-1086.242) [-1082.462] (-1082.514) * [-1082.029] (-1084.164) (-1084.381) (-1084.292) -- 0:00:13
803000 -- (-1084.251) (-1082.739) (-1090.562) [-1084.597] * (-1082.174) (-1086.307) [-1083.403] (-1084.181) -- 0:00:13
803500 -- (-1083.611) [-1083.478] (-1085.302) (-1084.092) * [-1082.536] (-1084.485) (-1083.909) (-1082.840) -- 0:00:12
804000 -- (-1084.772) [-1083.537] (-1084.420) (-1083.314) * (-1082.315) [-1084.035] (-1086.850) (-1082.306) -- 0:00:12
804500 -- (-1085.177) [-1082.434] (-1084.341) (-1082.220) * (-1082.222) [-1084.307] (-1084.464) (-1085.137) -- 0:00:12
805000 -- (-1085.903) (-1088.966) [-1084.763] (-1082.208) * (-1083.319) (-1083.414) [-1082.547] (-1083.187) -- 0:00:12
Average standard deviation of split frequencies: 0.007567
805500 -- [-1081.821] (-1082.108) (-1085.242) (-1082.277) * [-1084.082] (-1093.124) (-1084.089) (-1082.553) -- 0:00:12
806000 -- (-1083.257) [-1083.984] (-1083.643) (-1082.640) * (-1082.843) (-1083.209) (-1084.473) [-1084.700] -- 0:00:12
806500 -- [-1082.926] (-1084.343) (-1083.827) (-1084.700) * (-1083.040) (-1082.638) (-1086.168) [-1083.801] -- 0:00:12
807000 -- [-1082.812] (-1083.868) (-1083.697) (-1082.969) * (-1089.747) (-1082.168) (-1082.101) [-1082.532] -- 0:00:12
807500 -- (-1083.737) (-1082.993) (-1083.978) [-1082.900] * (-1082.701) (-1082.929) (-1083.049) [-1083.480] -- 0:00:12
808000 -- [-1082.866] (-1085.079) (-1082.069) (-1088.181) * (-1086.202) (-1082.887) [-1085.110] (-1083.264) -- 0:00:12
808500 -- (-1082.800) (-1082.653) [-1084.105] (-1086.409) * [-1083.586] (-1085.185) (-1082.231) (-1083.694) -- 0:00:12
809000 -- (-1084.564) (-1083.319) [-1085.176] (-1085.523) * (-1082.691) [-1084.802] (-1085.520) (-1083.530) -- 0:00:12
809500 -- (-1083.434) (-1084.960) [-1084.920] (-1082.581) * [-1092.147] (-1084.708) (-1082.573) (-1082.599) -- 0:00:12
810000 -- [-1083.325] (-1084.497) (-1085.729) (-1084.326) * (-1084.809) (-1082.744) (-1083.728) [-1085.541] -- 0:00:12
Average standard deviation of split frequencies: 0.007341
810500 -- (-1087.391) (-1085.583) (-1086.178) [-1083.458] * (-1083.077) [-1082.246] (-1085.205) (-1084.721) -- 0:00:12
811000 -- [-1086.231] (-1086.320) (-1085.484) (-1084.299) * (-1084.994) (-1085.549) [-1082.968] (-1083.711) -- 0:00:12
811500 -- (-1085.610) (-1084.199) (-1085.037) [-1083.576] * [-1082.564] (-1083.572) (-1082.472) (-1086.059) -- 0:00:12
812000 -- [-1083.484] (-1082.194) (-1085.128) (-1085.129) * (-1087.991) (-1083.244) (-1083.134) [-1083.312] -- 0:00:12
812500 -- [-1085.991] (-1082.598) (-1086.247) (-1085.352) * (-1082.788) [-1085.426] (-1083.392) (-1082.245) -- 0:00:12
813000 -- (-1085.174) (-1085.260) (-1083.136) [-1083.236] * (-1083.724) (-1082.424) [-1082.025] (-1083.978) -- 0:00:12
813500 -- (-1086.766) (-1083.077) [-1082.367] (-1084.504) * (-1084.216) (-1086.474) (-1082.037) [-1083.076] -- 0:00:12
814000 -- (-1084.147) (-1085.492) (-1085.082) [-1082.704] * (-1084.929) (-1084.602) [-1085.195] (-1082.619) -- 0:00:12
814500 -- (-1085.004) (-1083.060) (-1088.265) [-1082.794] * (-1084.830) [-1082.605] (-1087.597) (-1081.690) -- 0:00:12
815000 -- [-1082.939] (-1083.194) (-1084.580) (-1082.036) * (-1084.112) [-1081.824] (-1084.392) (-1084.504) -- 0:00:12
Average standard deviation of split frequencies: 0.007474
815500 -- (-1084.288) (-1085.257) [-1084.588] (-1083.803) * (-1087.234) [-1083.051] (-1081.600) (-1083.020) -- 0:00:11
816000 -- (-1085.420) (-1084.436) [-1083.432] (-1084.778) * [-1081.915] (-1084.214) (-1085.195) (-1082.706) -- 0:00:12
816500 -- [-1082.748] (-1083.103) (-1084.158) (-1085.493) * (-1083.108) (-1087.862) [-1083.210] (-1087.887) -- 0:00:12
817000 -- [-1082.430] (-1086.146) (-1082.552) (-1085.495) * (-1083.906) (-1084.405) (-1084.038) [-1084.436] -- 0:00:12
817500 -- (-1082.976) (-1083.412) (-1082.499) [-1083.094] * (-1083.186) (-1090.942) (-1082.884) [-1086.270] -- 0:00:12
818000 -- (-1083.353) (-1082.861) [-1085.377] (-1086.385) * (-1083.622) [-1088.718] (-1088.894) (-1084.179) -- 0:00:12
818500 -- (-1084.272) [-1084.961] (-1082.808) (-1085.690) * (-1084.052) (-1088.828) (-1082.991) [-1083.006] -- 0:00:11
819000 -- [-1082.542] (-1082.745) (-1086.985) (-1082.791) * [-1085.278] (-1083.139) (-1087.827) (-1084.204) -- 0:00:11
819500 -- [-1082.820] (-1083.590) (-1086.944) (-1083.398) * (-1084.217) (-1088.100) [-1088.105] (-1083.013) -- 0:00:11
820000 -- [-1086.699] (-1083.677) (-1082.177) (-1082.207) * (-1084.109) (-1085.214) (-1083.630) [-1086.468] -- 0:00:11
Average standard deviation of split frequencies: 0.007288
820500 -- [-1085.986] (-1082.985) (-1083.337) (-1083.224) * (-1083.766) [-1082.370] (-1082.876) (-1084.437) -- 0:00:11
821000 -- [-1084.327] (-1084.134) (-1082.472) (-1084.059) * (-1084.376) (-1086.561) [-1082.901] (-1083.195) -- 0:00:11
821500 -- (-1084.243) [-1082.472] (-1086.023) (-1086.324) * [-1086.356] (-1085.325) (-1084.432) (-1082.509) -- 0:00:11
822000 -- [-1085.911] (-1083.651) (-1084.968) (-1086.009) * [-1087.097] (-1085.973) (-1082.888) (-1085.706) -- 0:00:11
822500 -- (-1089.649) (-1082.755) [-1083.325] (-1084.626) * [-1085.933] (-1084.077) (-1082.409) (-1087.770) -- 0:00:11
823000 -- (-1084.171) [-1082.670] (-1082.699) (-1083.998) * (-1087.624) (-1083.886) [-1083.436] (-1083.074) -- 0:00:11
823500 -- (-1084.785) (-1087.665) (-1083.174) [-1082.058] * (-1087.981) (-1083.514) [-1084.901] (-1084.406) -- 0:00:11
824000 -- (-1085.520) (-1086.121) [-1084.711] (-1082.485) * (-1086.443) (-1084.888) [-1082.588] (-1083.120) -- 0:00:11
824500 -- (-1083.050) [-1085.773] (-1084.076) (-1082.954) * (-1086.008) (-1082.276) [-1083.737] (-1082.659) -- 0:00:11
825000 -- [-1084.560] (-1083.595) (-1087.018) (-1083.206) * (-1084.028) (-1085.477) [-1087.847] (-1082.078) -- 0:00:11
Average standard deviation of split frequencies: 0.007419
825500 -- (-1085.263) (-1087.290) (-1084.536) [-1083.611] * (-1084.400) (-1084.806) (-1086.278) [-1081.603] -- 0:00:11
826000 -- [-1082.950] (-1085.653) (-1083.504) (-1084.538) * (-1084.249) [-1083.835] (-1082.691) (-1082.096) -- 0:00:11
826500 -- [-1082.417] (-1090.150) (-1087.364) (-1087.236) * (-1083.634) [-1082.822] (-1084.218) (-1085.629) -- 0:00:11
827000 -- (-1085.001) [-1084.834] (-1083.119) (-1083.076) * (-1086.094) [-1081.827] (-1086.083) (-1086.811) -- 0:00:11
827500 -- (-1084.645) (-1083.226) (-1083.406) [-1084.790] * (-1084.451) (-1083.422) [-1083.263] (-1084.850) -- 0:00:11
828000 -- (-1085.872) (-1082.301) [-1083.459] (-1086.580) * (-1086.013) [-1084.075] (-1087.567) (-1086.110) -- 0:00:11
828500 -- (-1083.979) (-1082.916) (-1084.757) [-1085.037] * (-1084.278) [-1083.150] (-1082.920) (-1087.070) -- 0:00:11
829000 -- (-1083.995) (-1084.024) [-1084.744] (-1087.197) * [-1083.851] (-1082.828) (-1082.655) (-1083.436) -- 0:00:11
829500 -- (-1085.887) (-1083.091) (-1083.754) [-1086.383] * (-1085.846) [-1085.574] (-1083.113) (-1087.518) -- 0:00:11
830000 -- (-1088.229) (-1082.365) [-1082.392] (-1089.447) * (-1082.298) (-1084.739) (-1084.779) [-1084.654] -- 0:00:11
Average standard deviation of split frequencies: 0.007271
830500 -- [-1088.908] (-1082.594) (-1084.133) (-1085.583) * (-1084.153) (-1085.375) (-1082.607) [-1083.567] -- 0:00:11
831000 -- (-1085.897) (-1082.571) (-1083.173) [-1085.226] * (-1085.789) (-1082.603) (-1086.925) [-1083.442] -- 0:00:10
831500 -- (-1083.102) (-1083.450) (-1084.956) [-1084.569] * (-1085.070) (-1084.993) (-1085.965) [-1086.720] -- 0:00:10
832000 -- (-1083.644) (-1082.262) [-1084.941] (-1086.958) * (-1083.504) (-1082.874) (-1086.224) [-1084.693] -- 0:00:11
832500 -- (-1085.568) (-1082.085) (-1087.912) [-1084.189] * (-1085.713) (-1084.930) [-1083.428] (-1084.153) -- 0:00:11
833000 -- (-1085.352) (-1082.677) (-1086.913) [-1082.224] * (-1083.764) [-1082.780] (-1085.315) (-1083.194) -- 0:00:11
833500 -- (-1088.154) (-1086.784) (-1082.683) [-1084.113] * (-1084.729) [-1082.812] (-1083.521) (-1083.136) -- 0:00:10
834000 -- (-1082.426) (-1082.840) (-1082.820) [-1084.593] * (-1084.949) [-1082.007] (-1082.596) (-1083.191) -- 0:00:10
834500 -- (-1083.531) (-1083.536) (-1086.757) [-1086.112] * (-1086.737) [-1082.104] (-1084.305) (-1086.118) -- 0:00:10
835000 -- (-1082.121) (-1085.040) [-1088.488] (-1084.153) * [-1083.470] (-1082.523) (-1083.763) (-1085.267) -- 0:00:10
Average standard deviation of split frequencies: 0.007436
835500 -- (-1082.766) [-1085.288] (-1087.457) (-1082.546) * (-1085.352) (-1083.523) (-1082.808) [-1083.196] -- 0:00:10
836000 -- (-1084.107) (-1084.535) [-1084.321] (-1085.628) * (-1085.635) [-1082.888] (-1082.748) (-1089.069) -- 0:00:10
836500 -- (-1082.554) [-1083.376] (-1085.392) (-1083.409) * [-1083.075] (-1083.764) (-1082.785) (-1089.560) -- 0:00:10
837000 -- (-1083.062) [-1085.348] (-1084.054) (-1084.471) * (-1083.278) (-1083.692) [-1082.329] (-1084.891) -- 0:00:10
837500 -- (-1085.124) (-1085.477) (-1087.513) [-1084.556] * (-1083.944) (-1083.194) (-1085.567) [-1082.388] -- 0:00:10
838000 -- (-1085.346) (-1085.328) [-1084.021] (-1084.924) * [-1083.435] (-1083.841) (-1085.374) (-1082.749) -- 0:00:10
838500 -- (-1084.429) (-1082.248) [-1084.294] (-1092.921) * (-1084.208) (-1083.099) (-1084.086) [-1086.976] -- 0:00:10
839000 -- (-1089.243) [-1086.120] (-1083.149) (-1082.707) * (-1085.338) (-1083.355) [-1083.375] (-1086.051) -- 0:00:10
839500 -- [-1083.014] (-1086.212) (-1082.493) (-1083.274) * (-1084.533) (-1083.701) (-1082.698) [-1084.672] -- 0:00:10
840000 -- (-1084.648) [-1088.271] (-1083.219) (-1082.528) * (-1082.508) [-1084.927] (-1082.818) (-1081.808) -- 0:00:10
Average standard deviation of split frequencies: 0.007886
840500 -- (-1083.186) [-1085.812] (-1082.845) (-1082.789) * (-1082.874) (-1084.054) [-1083.476] (-1081.975) -- 0:00:10
841000 -- [-1082.550] (-1083.450) (-1084.427) (-1082.280) * (-1082.873) (-1086.770) [-1085.176] (-1083.052) -- 0:00:10
841500 -- [-1083.058] (-1082.647) (-1084.347) (-1083.892) * (-1084.938) (-1085.909) (-1084.583) [-1083.820] -- 0:00:10
842000 -- [-1083.320] (-1087.292) (-1083.559) (-1085.373) * (-1085.916) (-1082.188) [-1084.433] (-1083.703) -- 0:00:10
842500 -- (-1082.454) [-1082.358] (-1085.739) (-1083.880) * (-1083.236) (-1083.222) (-1082.939) [-1083.697] -- 0:00:10
843000 -- [-1083.116] (-1083.620) (-1085.182) (-1084.428) * (-1086.662) (-1083.407) [-1083.985] (-1083.876) -- 0:00:10
843500 -- (-1082.603) (-1088.228) (-1084.510) [-1083.307] * (-1091.108) (-1086.587) [-1085.062] (-1085.135) -- 0:00:10
844000 -- (-1084.352) [-1088.574] (-1088.606) (-1084.566) * (-1085.275) (-1086.719) (-1082.263) [-1084.289] -- 0:00:10
844500 -- (-1084.750) (-1084.306) (-1088.347) [-1082.678] * [-1082.903] (-1085.094) (-1082.481) (-1083.711) -- 0:00:10
845000 -- [-1083.136] (-1085.491) (-1086.781) (-1082.359) * (-1082.697) (-1086.187) [-1083.649] (-1086.316) -- 0:00:10
Average standard deviation of split frequencies: 0.007697
845500 -- (-1083.320) [-1081.803] (-1082.874) (-1085.423) * (-1082.160) (-1092.872) (-1085.430) [-1083.298] -- 0:00:10
846000 -- (-1083.496) [-1083.830] (-1085.500) (-1085.203) * [-1082.220] (-1085.587) (-1084.104) (-1083.222) -- 0:00:10
846500 -- [-1083.771] (-1084.861) (-1086.163) (-1082.439) * (-1086.236) (-1092.290) (-1084.894) [-1081.724] -- 0:00:09
847000 -- [-1082.607] (-1082.957) (-1084.807) (-1085.274) * (-1084.896) (-1086.205) (-1086.921) [-1083.118] -- 0:00:09
847500 -- (-1084.599) (-1083.509) [-1082.927] (-1083.875) * (-1085.943) [-1084.990] (-1086.267) (-1083.073) -- 0:00:09
848000 -- (-1085.234) (-1085.954) [-1082.787] (-1086.901) * (-1082.632) [-1084.681] (-1084.011) (-1082.759) -- 0:00:09
848500 -- [-1084.020] (-1083.882) (-1086.300) (-1087.130) * (-1084.317) (-1084.777) [-1084.252] (-1082.853) -- 0:00:09
849000 -- (-1085.929) [-1082.302] (-1083.092) (-1083.343) * (-1083.078) (-1084.528) (-1088.548) [-1082.218] -- 0:00:09
849500 -- [-1083.933] (-1082.368) (-1083.750) (-1085.054) * [-1084.103] (-1084.774) (-1088.952) (-1082.312) -- 0:00:09
850000 -- (-1084.146) (-1084.122) (-1083.656) [-1084.256] * (-1084.630) (-1085.451) (-1085.593) [-1083.266] -- 0:00:09
Average standard deviation of split frequencies: 0.007620
850500 -- (-1084.412) (-1083.633) [-1082.418] (-1082.992) * (-1086.247) (-1086.705) (-1088.614) [-1083.505] -- 0:00:09
851000 -- (-1084.831) (-1085.529) [-1082.884] (-1088.427) * (-1086.838) (-1088.750) [-1087.529] (-1086.476) -- 0:00:09
851500 -- (-1084.805) [-1086.603] (-1083.471) (-1092.520) * (-1084.340) [-1082.173] (-1083.814) (-1082.133) -- 0:00:09
852000 -- (-1089.907) [-1085.337] (-1084.087) (-1089.567) * (-1082.373) [-1081.835] (-1085.407) (-1083.318) -- 0:00:09
852500 -- [-1087.742] (-1084.359) (-1085.302) (-1082.131) * [-1084.605] (-1081.833) (-1085.432) (-1085.837) -- 0:00:09
853000 -- [-1085.593] (-1085.800) (-1084.112) (-1082.295) * (-1084.020) (-1087.348) [-1084.076] (-1085.854) -- 0:00:09
853500 -- [-1083.259] (-1084.350) (-1082.498) (-1083.417) * [-1084.266] (-1085.976) (-1086.448) (-1082.580) -- 0:00:09
854000 -- (-1083.834) [-1086.340] (-1082.794) (-1081.652) * [-1091.473] (-1083.529) (-1086.454) (-1083.315) -- 0:00:09
854500 -- (-1082.390) (-1083.104) [-1083.293] (-1083.954) * (-1085.084) [-1085.040] (-1082.636) (-1082.958) -- 0:00:09
855000 -- (-1091.055) (-1082.863) [-1084.573] (-1085.499) * (-1084.319) (-1082.756) [-1083.683] (-1088.434) -- 0:00:09
Average standard deviation of split frequencies: 0.008157
855500 -- (-1089.070) (-1082.982) [-1086.036] (-1083.875) * [-1087.668] (-1081.829) (-1082.279) (-1086.066) -- 0:00:09
856000 -- (-1088.109) (-1088.717) (-1082.760) [-1082.652] * (-1085.603) [-1082.613] (-1085.261) (-1087.039) -- 0:00:09
856500 -- [-1086.807] (-1083.041) (-1085.016) (-1083.482) * (-1085.114) (-1084.969) (-1082.010) [-1082.211] -- 0:00:09
857000 -- (-1085.190) (-1083.891) [-1082.920] (-1082.970) * (-1083.274) (-1085.879) [-1082.757] (-1082.530) -- 0:00:09
857500 -- (-1087.860) (-1083.752) [-1083.129] (-1085.584) * (-1082.198) [-1085.162] (-1082.112) (-1083.781) -- 0:00:09
858000 -- (-1088.103) [-1082.560] (-1084.670) (-1083.322) * (-1083.073) (-1083.467) (-1085.646) [-1083.397] -- 0:00:09
858500 -- (-1083.365) [-1082.064] (-1082.401) (-1088.792) * (-1084.006) (-1084.831) (-1083.596) [-1082.501] -- 0:00:09
859000 -- [-1086.488] (-1084.358) (-1082.564) (-1084.664) * (-1082.955) (-1084.382) [-1087.560] (-1084.251) -- 0:00:09
859500 -- (-1084.813) (-1083.603) (-1082.166) [-1085.108] * (-1083.321) [-1086.228] (-1086.345) (-1086.847) -- 0:00:09
860000 -- [-1083.437] (-1083.471) (-1083.326) (-1089.156) * (-1082.522) (-1085.311) (-1083.271) [-1083.317] -- 0:00:09
Average standard deviation of split frequencies: 0.007873
860500 -- (-1084.451) (-1081.966) [-1084.124] (-1086.237) * (-1085.749) (-1082.875) (-1083.005) [-1082.554] -- 0:00:09
861000 -- (-1085.176) (-1085.245) (-1083.407) [-1088.505] * [-1082.648] (-1082.793) (-1083.981) (-1083.418) -- 0:00:09
861500 -- (-1086.158) (-1083.494) (-1086.379) [-1083.349] * (-1084.691) (-1083.953) [-1082.589] (-1084.026) -- 0:00:09
862000 -- (-1085.612) (-1082.887) (-1082.292) [-1086.042] * (-1085.814) (-1082.353) (-1082.289) [-1082.972] -- 0:00:08
862500 -- (-1083.968) [-1083.747] (-1083.641) (-1083.097) * (-1088.095) [-1082.390] (-1083.198) (-1084.110) -- 0:00:08
863000 -- (-1084.345) (-1083.380) [-1085.426] (-1087.730) * (-1085.191) (-1082.040) [-1083.356] (-1084.943) -- 0:00:08
863500 -- (-1083.463) [-1082.923] (-1086.023) (-1082.711) * (-1084.529) [-1082.041] (-1089.283) (-1084.846) -- 0:00:08
864000 -- [-1082.538] (-1087.511) (-1083.743) (-1084.363) * (-1083.481) [-1082.071] (-1085.395) (-1083.221) -- 0:00:08
864500 -- (-1084.047) [-1082.389] (-1087.397) (-1091.521) * (-1088.156) [-1084.497] (-1082.592) (-1084.500) -- 0:00:08
865000 -- (-1085.497) [-1084.338] (-1085.515) (-1092.495) * (-1088.759) (-1085.090) (-1083.668) [-1082.887] -- 0:00:08
Average standard deviation of split frequencies: 0.008097
865500 -- (-1083.154) [-1084.009] (-1083.168) (-1090.211) * (-1082.493) (-1083.314) (-1083.612) [-1082.712] -- 0:00:08
866000 -- (-1082.630) (-1083.816) [-1083.106] (-1088.807) * [-1086.480] (-1083.397) (-1086.176) (-1085.635) -- 0:00:08
866500 -- (-1082.702) (-1086.004) [-1083.303] (-1085.301) * (-1083.917) [-1083.585] (-1085.176) (-1085.203) -- 0:00:08
867000 -- (-1084.008) (-1086.098) (-1083.140) [-1084.279] * (-1085.228) [-1084.815] (-1085.030) (-1083.732) -- 0:00:08
867500 -- (-1084.667) (-1083.254) [-1084.910] (-1083.665) * (-1085.246) (-1085.989) (-1087.260) [-1083.012] -- 0:00:08
868000 -- [-1082.889] (-1090.131) (-1084.013) (-1084.279) * [-1082.439] (-1084.756) (-1084.700) (-1084.426) -- 0:00:08
868500 -- (-1083.960) (-1085.613) [-1083.622] (-1083.648) * (-1088.319) (-1085.114) (-1086.174) [-1083.251] -- 0:00:08
869000 -- (-1085.909) (-1085.025) (-1083.584) [-1081.966] * (-1083.776) (-1087.013) [-1082.041] (-1082.905) -- 0:00:08
869500 -- (-1085.321) (-1085.601) (-1085.987) [-1082.049] * (-1086.886) (-1082.641) (-1083.763) [-1085.933] -- 0:00:08
870000 -- [-1082.962] (-1084.666) (-1088.002) (-1082.504) * [-1083.082] (-1083.024) (-1086.460) (-1083.647) -- 0:00:08
Average standard deviation of split frequencies: 0.008249
870500 -- (-1084.104) (-1084.654) (-1082.999) [-1082.779] * (-1082.868) (-1083.942) [-1081.733] (-1082.682) -- 0:00:08
871000 -- (-1082.475) (-1082.794) [-1083.039] (-1087.695) * (-1084.016) (-1082.626) (-1083.956) [-1084.000] -- 0:00:08
871500 -- (-1082.322) (-1083.692) [-1085.255] (-1089.516) * [-1085.804] (-1082.907) (-1083.292) (-1083.789) -- 0:00:08
872000 -- (-1087.132) (-1084.151) [-1084.015] (-1083.915) * [-1091.757] (-1083.093) (-1084.018) (-1082.590) -- 0:00:08
872500 -- (-1082.806) (-1087.862) [-1082.091] (-1083.630) * [-1088.104] (-1083.692) (-1085.111) (-1084.783) -- 0:00:08
873000 -- (-1082.747) (-1088.323) [-1084.125] (-1085.625) * (-1090.122) (-1083.918) [-1082.982] (-1085.683) -- 0:00:08
873500 -- (-1083.712) [-1089.665] (-1084.185) (-1083.169) * (-1085.886) (-1085.074) (-1084.157) [-1088.283] -- 0:00:08
874000 -- (-1084.360) (-1083.208) [-1086.133] (-1082.477) * (-1086.970) [-1082.905] (-1086.560) (-1082.337) -- 0:00:08
874500 -- [-1082.008] (-1084.536) (-1086.525) (-1084.378) * (-1085.186) (-1085.168) (-1084.432) [-1082.254] -- 0:00:08
875000 -- [-1084.455] (-1082.193) (-1085.808) (-1082.807) * [-1083.648] (-1082.770) (-1084.850) (-1084.518) -- 0:00:08
Average standard deviation of split frequencies: 0.008005
875500 -- (-1084.296) (-1087.772) [-1083.873] (-1084.323) * [-1085.101] (-1083.918) (-1082.722) (-1082.730) -- 0:00:08
876000 -- (-1087.328) (-1082.917) [-1082.008] (-1083.126) * (-1084.510) (-1083.233) (-1083.195) [-1082.673] -- 0:00:08
876500 -- (-1083.151) [-1082.731] (-1082.803) (-1082.434) * (-1085.948) (-1085.779) [-1085.298] (-1084.552) -- 0:00:08
877000 -- (-1082.880) [-1082.102] (-1084.874) (-1084.439) * (-1086.766) (-1086.366) (-1083.747) [-1086.106] -- 0:00:07
877500 -- (-1088.939) (-1082.433) [-1086.670] (-1084.354) * (-1082.932) (-1082.264) [-1082.112] (-1084.420) -- 0:00:07
878000 -- (-1083.485) [-1083.085] (-1087.495) (-1083.966) * (-1084.390) (-1083.184) (-1081.557) [-1086.776] -- 0:00:07
878500 -- (-1083.659) [-1085.087] (-1082.924) (-1084.137) * [-1084.158] (-1083.604) (-1082.832) (-1084.338) -- 0:00:07
879000 -- (-1082.337) [-1083.227] (-1082.739) (-1085.551) * (-1083.430) [-1083.727] (-1082.877) (-1086.904) -- 0:00:07
879500 -- (-1082.796) (-1085.320) [-1083.168] (-1083.561) * [-1084.531] (-1086.881) (-1082.266) (-1084.062) -- 0:00:07
880000 -- [-1084.850] (-1089.836) (-1084.535) (-1086.334) * [-1085.304] (-1087.395) (-1081.849) (-1087.714) -- 0:00:07
Average standard deviation of split frequencies: 0.008063
880500 -- (-1082.579) (-1088.779) [-1084.337] (-1083.428) * (-1085.561) (-1085.359) [-1081.752] (-1086.778) -- 0:00:07
881000 -- (-1082.610) (-1084.486) (-1083.309) [-1086.915] * (-1082.629) [-1084.451] (-1084.647) (-1086.475) -- 0:00:07
881500 -- [-1083.053] (-1084.592) (-1084.569) (-1084.987) * (-1084.664) (-1085.170) (-1086.733) [-1086.060] -- 0:00:07
882000 -- (-1086.774) (-1082.444) [-1084.498] (-1086.362) * (-1082.378) (-1082.861) (-1084.854) [-1086.665] -- 0:00:07
882500 -- (-1086.699) (-1083.652) (-1082.626) [-1084.007] * [-1083.338] (-1086.958) (-1082.469) (-1086.560) -- 0:00:07
883000 -- (-1081.941) (-1089.636) [-1083.340] (-1084.344) * (-1082.391) (-1084.520) [-1084.221] (-1085.144) -- 0:00:07
883500 -- (-1082.042) (-1085.725) (-1082.175) [-1084.925] * (-1082.668) (-1083.920) [-1084.098] (-1085.926) -- 0:00:07
884000 -- (-1082.693) [-1084.297] (-1083.009) (-1083.191) * (-1082.432) (-1082.913) (-1085.486) [-1086.920] -- 0:00:07
884500 -- (-1084.285) (-1086.597) (-1087.596) [-1082.403] * (-1083.167) (-1084.134) (-1083.531) [-1083.130] -- 0:00:07
885000 -- (-1084.687) (-1087.869) [-1083.678] (-1082.663) * (-1083.331) [-1082.897] (-1084.302) (-1083.092) -- 0:00:07
Average standard deviation of split frequencies: 0.008280
885500 -- (-1086.763) (-1085.508) (-1083.196) [-1083.924] * (-1083.367) (-1083.841) [-1083.036] (-1084.702) -- 0:00:07
886000 -- (-1084.418) (-1086.177) (-1082.169) [-1082.871] * (-1083.603) [-1082.604] (-1082.421) (-1084.695) -- 0:00:07
886500 -- (-1086.047) (-1085.899) [-1082.179] (-1083.053) * [-1083.871] (-1085.464) (-1085.570) (-1082.543) -- 0:00:07
887000 -- (-1084.910) (-1086.890) [-1084.971] (-1084.131) * (-1085.394) (-1083.264) (-1085.711) [-1086.173] -- 0:00:07
887500 -- (-1087.542) (-1085.635) [-1083.368] (-1084.511) * [-1083.964] (-1083.570) (-1083.623) (-1082.179) -- 0:00:07
888000 -- (-1085.751) (-1086.615) (-1083.240) [-1083.175] * (-1082.618) (-1084.361) (-1085.757) [-1084.366] -- 0:00:07
888500 -- (-1084.982) [-1082.881] (-1082.469) (-1084.498) * [-1082.447] (-1084.393) (-1086.016) (-1087.522) -- 0:00:07
889000 -- [-1082.610] (-1083.918) (-1083.122) (-1086.783) * (-1088.113) (-1084.275) [-1082.989] (-1084.708) -- 0:00:07
889500 -- (-1083.860) [-1082.212] (-1082.902) (-1085.588) * [-1084.869] (-1089.114) (-1082.288) (-1082.394) -- 0:00:07
890000 -- (-1082.464) (-1082.071) (-1085.209) [-1084.608] * (-1082.156) [-1084.379] (-1083.659) (-1082.970) -- 0:00:07
Average standard deviation of split frequencies: 0.008303
890500 -- (-1081.863) (-1082.476) (-1084.264) [-1084.405] * (-1083.102) (-1088.030) (-1086.002) [-1082.430] -- 0:00:07
891000 -- (-1083.134) [-1082.720] (-1082.505) (-1086.257) * (-1082.882) [-1082.094] (-1083.123) (-1081.867) -- 0:00:07
891500 -- (-1083.724) [-1082.287] (-1082.669) (-1084.096) * (-1082.482) (-1083.498) [-1083.651] (-1083.864) -- 0:00:07
892000 -- [-1082.449] (-1085.668) (-1082.986) (-1083.697) * [-1082.056] (-1082.537) (-1084.090) (-1088.859) -- 0:00:07
892500 -- (-1081.675) (-1083.903) (-1083.244) [-1082.602] * (-1084.238) [-1083.937] (-1083.265) (-1086.289) -- 0:00:06
893000 -- (-1084.247) (-1082.935) (-1085.270) [-1082.537] * (-1083.438) (-1086.499) [-1082.498] (-1084.130) -- 0:00:06
893500 -- [-1084.047] (-1086.668) (-1087.129) (-1082.562) * (-1083.261) [-1085.003] (-1082.959) (-1084.278) -- 0:00:06
894000 -- [-1084.250] (-1085.526) (-1084.339) (-1082.116) * [-1082.417] (-1083.704) (-1087.635) (-1083.657) -- 0:00:06
894500 -- (-1082.140) [-1085.896] (-1085.925) (-1082.057) * [-1084.992] (-1083.250) (-1088.121) (-1081.987) -- 0:00:06
895000 -- (-1083.718) [-1082.692] (-1082.672) (-1081.718) * (-1086.365) (-1082.740) (-1085.242) [-1083.135] -- 0:00:06
Average standard deviation of split frequencies: 0.008449
895500 -- (-1083.679) [-1083.596] (-1082.673) (-1086.290) * (-1084.391) (-1081.820) (-1084.151) [-1085.106] -- 0:00:06
896000 -- (-1083.860) [-1083.214] (-1083.116) (-1085.488) * (-1083.286) [-1083.849] (-1085.199) (-1082.437) -- 0:00:06
896500 -- (-1082.167) (-1084.791) [-1083.801] (-1086.219) * (-1086.470) (-1083.406) (-1083.398) [-1082.351] -- 0:00:06
897000 -- (-1087.698) [-1082.396] (-1082.633) (-1083.410) * [-1084.203] (-1087.062) (-1085.223) (-1083.798) -- 0:00:06
897500 -- [-1083.859] (-1082.320) (-1082.294) (-1083.888) * [-1083.811] (-1084.611) (-1088.787) (-1084.846) -- 0:00:06
898000 -- (-1083.027) (-1082.937) [-1082.246] (-1084.162) * (-1082.225) [-1083.853] (-1085.753) (-1084.615) -- 0:00:06
898500 -- (-1083.114) (-1083.760) (-1082.170) [-1082.324] * [-1082.214] (-1083.252) (-1081.873) (-1084.452) -- 0:00:06
899000 -- (-1083.277) [-1083.893] (-1082.151) (-1082.569) * [-1085.023] (-1083.185) (-1089.674) (-1086.271) -- 0:00:06
899500 -- [-1084.043] (-1083.783) (-1082.510) (-1083.758) * [-1082.872] (-1082.905) (-1090.620) (-1085.793) -- 0:00:06
900000 -- (-1084.386) [-1082.542] (-1089.255) (-1085.623) * (-1084.249) [-1081.535] (-1085.628) (-1086.920) -- 0:00:06
Average standard deviation of split frequencies: 0.008440
900500 -- (-1082.586) [-1083.897] (-1087.775) (-1084.200) * [-1083.449] (-1082.408) (-1091.274) (-1083.242) -- 0:00:06
901000 -- [-1082.283] (-1083.982) (-1083.382) (-1085.353) * [-1082.249] (-1082.356) (-1085.178) (-1087.738) -- 0:00:06
901500 -- (-1081.951) (-1082.615) (-1085.323) [-1082.832] * (-1082.453) (-1081.915) [-1085.910] (-1084.288) -- 0:00:06
902000 -- (-1082.851) (-1087.769) [-1082.523] (-1084.951) * (-1082.200) [-1083.490] (-1082.786) (-1084.075) -- 0:00:06
902500 -- (-1084.548) [-1083.540] (-1081.707) (-1087.940) * (-1082.168) [-1084.590] (-1082.875) (-1083.981) -- 0:00:06
903000 -- (-1083.171) (-1082.582) (-1081.758) [-1085.908] * (-1084.606) (-1084.913) (-1083.136) [-1082.388] -- 0:00:06
903500 -- [-1085.186] (-1083.477) (-1084.091) (-1085.999) * [-1084.109] (-1084.653) (-1087.075) (-1082.554) -- 0:00:06
904000 -- [-1083.198] (-1082.575) (-1084.109) (-1086.216) * (-1082.929) (-1085.808) (-1086.779) [-1082.629] -- 0:00:06
904500 -- (-1089.959) (-1083.653) (-1082.279) [-1085.841] * [-1082.936] (-1083.123) (-1088.523) (-1086.044) -- 0:00:06
905000 -- (-1082.931) (-1085.109) [-1082.106] (-1085.255) * (-1085.316) (-1084.753) (-1082.882) [-1085.948] -- 0:00:06
Average standard deviation of split frequencies: 0.008162
905500 -- (-1090.139) (-1085.382) (-1088.066) [-1084.715] * (-1088.557) [-1083.153] (-1084.574) (-1082.266) -- 0:00:06
906000 -- (-1082.957) [-1086.178] (-1084.725) (-1084.668) * (-1083.471) (-1085.848) (-1083.907) [-1082.079] -- 0:00:06
906500 -- (-1084.729) [-1083.536] (-1086.824) (-1082.641) * (-1087.056) [-1083.799] (-1092.125) (-1085.908) -- 0:00:06
907000 -- (-1083.255) (-1084.508) [-1083.123] (-1083.973) * (-1085.887) [-1082.404] (-1084.530) (-1085.212) -- 0:00:06
907500 -- (-1083.292) (-1083.502) [-1086.394] (-1082.797) * (-1085.592) (-1082.426) [-1083.401] (-1084.221) -- 0:00:06
908000 -- [-1084.486] (-1084.186) (-1082.543) (-1084.919) * [-1084.229] (-1083.174) (-1083.408) (-1084.343) -- 0:00:05
908500 -- (-1083.330) [-1084.009] (-1082.195) (-1088.371) * [-1083.800] (-1083.467) (-1084.326) (-1082.044) -- 0:00:05
909000 -- [-1083.464] (-1085.135) (-1084.390) (-1086.901) * [-1085.260] (-1084.124) (-1082.129) (-1084.938) -- 0:00:05
909500 -- [-1084.578] (-1085.740) (-1083.351) (-1083.491) * (-1085.482) [-1084.120] (-1082.705) (-1084.839) -- 0:00:05
910000 -- [-1082.001] (-1086.072) (-1082.783) (-1083.456) * (-1084.263) (-1084.694) [-1081.942] (-1084.215) -- 0:00:05
Average standard deviation of split frequencies: 0.008343
910500 -- (-1084.232) [-1084.836] (-1083.370) (-1082.235) * (-1083.335) (-1083.505) (-1084.572) [-1084.183] -- 0:00:05
911000 -- (-1085.001) (-1084.648) [-1081.867] (-1083.409) * [-1085.007] (-1083.086) (-1083.359) (-1085.364) -- 0:00:05
911500 -- (-1083.083) (-1083.328) [-1081.806] (-1081.990) * [-1082.949] (-1083.891) (-1082.705) (-1086.809) -- 0:00:05
912000 -- [-1083.936] (-1084.033) (-1081.894) (-1082.846) * (-1082.666) (-1082.598) [-1081.967] (-1083.981) -- 0:00:05
912500 -- (-1084.771) (-1083.673) (-1083.530) [-1084.100] * (-1083.746) (-1085.158) [-1081.741] (-1084.206) -- 0:00:05
913000 -- (-1083.796) (-1085.951) (-1084.307) [-1082.326] * (-1084.871) [-1084.862] (-1084.092) (-1084.813) -- 0:00:05
913500 -- (-1082.567) [-1082.825] (-1083.813) (-1082.722) * [-1083.140] (-1082.919) (-1084.324) (-1082.740) -- 0:00:05
914000 -- (-1082.567) [-1083.238] (-1082.156) (-1085.422) * (-1088.341) (-1084.613) (-1084.635) [-1082.886] -- 0:00:05
914500 -- [-1084.910] (-1084.008) (-1084.704) (-1086.589) * (-1084.869) (-1086.675) (-1084.206) [-1084.821] -- 0:00:05
915000 -- [-1082.971] (-1083.339) (-1086.625) (-1083.519) * (-1083.656) [-1084.696] (-1085.062) (-1083.746) -- 0:00:05
Average standard deviation of split frequencies: 0.008355
915500 -- (-1082.652) (-1086.626) [-1083.367] (-1084.837) * [-1088.191] (-1086.217) (-1086.078) (-1087.295) -- 0:00:05
916000 -- (-1086.702) [-1084.790] (-1082.886) (-1084.274) * (-1084.416) [-1085.529] (-1082.189) (-1084.839) -- 0:00:05
916500 -- [-1082.264] (-1084.635) (-1086.234) (-1082.255) * (-1083.703) (-1088.931) [-1081.772] (-1083.589) -- 0:00:05
917000 -- (-1082.774) (-1082.328) [-1085.386] (-1082.336) * (-1085.951) (-1085.310) (-1084.324) [-1085.885] -- 0:00:05
917500 -- (-1081.983) (-1082.748) (-1082.445) [-1084.825] * (-1088.091) [-1083.207] (-1083.234) (-1091.552) -- 0:00:05
918000 -- (-1085.281) (-1082.352) [-1083.270] (-1085.108) * (-1084.957) (-1083.534) [-1082.302] (-1089.883) -- 0:00:05
918500 -- (-1082.513) (-1082.490) [-1083.370] (-1083.620) * (-1082.430) (-1087.935) [-1087.410] (-1087.835) -- 0:00:05
919000 -- (-1082.894) (-1086.939) (-1084.204) [-1084.464] * (-1084.016) [-1092.372] (-1085.328) (-1084.826) -- 0:00:05
919500 -- (-1083.036) (-1085.804) [-1083.286] (-1084.762) * (-1082.348) [-1084.097] (-1082.603) (-1082.820) -- 0:00:05
920000 -- (-1089.443) (-1086.989) (-1082.937) [-1083.977] * (-1082.639) (-1082.122) (-1081.937) [-1083.212] -- 0:00:05
Average standard deviation of split frequencies: 0.008512
920500 -- (-1083.657) (-1085.466) [-1084.443] (-1082.872) * (-1082.877) [-1083.157] (-1082.828) (-1083.307) -- 0:00:05
921000 -- (-1083.493) [-1083.750] (-1083.218) (-1083.513) * (-1083.318) (-1082.920) [-1082.604] (-1084.323) -- 0:00:05
921500 -- [-1083.663] (-1083.571) (-1084.230) (-1082.972) * (-1084.959) (-1084.414) (-1081.993) [-1084.211] -- 0:00:05
922000 -- (-1087.013) (-1082.156) (-1085.770) [-1083.547] * (-1086.185) (-1082.624) (-1083.315) [-1083.142] -- 0:00:05
922500 -- (-1084.136) [-1084.097] (-1082.898) (-1087.330) * (-1082.388) (-1085.221) [-1082.662] (-1085.255) -- 0:00:05
923000 -- (-1082.381) [-1082.229] (-1085.264) (-1082.725) * [-1082.372] (-1089.242) (-1082.140) (-1083.086) -- 0:00:05
923500 -- (-1082.833) (-1082.568) [-1082.482] (-1083.508) * [-1082.701] (-1088.152) (-1084.486) (-1083.802) -- 0:00:04
924000 -- (-1083.743) [-1083.441] (-1083.379) (-1084.190) * (-1083.396) (-1082.766) (-1085.265) [-1083.742] -- 0:00:04
924500 -- [-1082.401] (-1083.705) (-1085.187) (-1084.109) * (-1083.460) (-1082.168) (-1083.677) [-1082.276] -- 0:00:04
925000 -- [-1084.390] (-1086.796) (-1082.596) (-1082.523) * (-1089.329) (-1085.491) (-1081.894) [-1082.127] -- 0:00:04
Average standard deviation of split frequencies: 0.008272
925500 -- (-1083.552) [-1082.239] (-1082.695) (-1084.682) * (-1082.328) (-1082.501) (-1083.409) [-1083.249] -- 0:00:04
926000 -- (-1084.663) (-1082.503) [-1081.667] (-1085.598) * (-1082.296) (-1083.149) (-1082.046) [-1082.820] -- 0:00:04
926500 -- (-1084.444) [-1084.818] (-1084.451) (-1083.791) * [-1082.599] (-1084.749) (-1086.153) (-1083.942) -- 0:00:04
927000 -- (-1084.064) [-1084.502] (-1081.956) (-1083.491) * (-1083.201) (-1084.465) (-1083.686) [-1082.435] -- 0:00:04
927500 -- (-1083.033) (-1084.430) (-1085.012) [-1084.004] * [-1081.735] (-1085.637) (-1086.195) (-1085.105) -- 0:00:04
928000 -- (-1084.972) (-1083.393) (-1084.587) [-1084.482] * (-1082.369) (-1086.917) [-1084.479] (-1087.893) -- 0:00:04
928500 -- [-1083.992] (-1081.827) (-1086.207) (-1082.510) * (-1083.402) (-1086.382) [-1082.419] (-1084.902) -- 0:00:04
929000 -- (-1083.982) (-1085.581) (-1083.913) [-1082.463] * [-1082.813] (-1087.857) (-1083.242) (-1083.956) -- 0:00:04
929500 -- [-1084.355] (-1085.342) (-1086.094) (-1083.328) * (-1088.191) [-1087.903] (-1083.234) (-1083.411) -- 0:00:04
930000 -- (-1083.838) [-1083.449] (-1083.923) (-1082.917) * (-1082.654) [-1084.288] (-1083.149) (-1083.547) -- 0:00:04
Average standard deviation of split frequencies: 0.008358
930500 -- (-1083.467) (-1082.511) (-1085.107) [-1085.612] * (-1083.617) [-1082.905] (-1087.081) (-1085.719) -- 0:00:04
931000 -- (-1088.546) (-1083.302) (-1084.001) [-1083.238] * [-1082.972] (-1087.053) (-1086.125) (-1084.736) -- 0:00:04
931500 -- (-1084.759) (-1084.612) [-1082.395] (-1082.728) * (-1083.380) (-1091.694) [-1084.816] (-1082.601) -- 0:00:04
932000 -- (-1085.924) (-1085.159) [-1083.838] (-1082.787) * [-1085.152] (-1087.756) (-1082.243) (-1084.123) -- 0:00:04
932500 -- (-1082.446) (-1084.751) [-1082.100] (-1082.517) * (-1084.843) [-1087.272] (-1083.032) (-1085.590) -- 0:00:04
933000 -- (-1082.171) (-1084.955) [-1084.203] (-1085.215) * (-1084.131) (-1082.459) (-1082.734) [-1084.253] -- 0:00:04
933500 -- (-1085.894) (-1083.415) (-1082.930) [-1083.351] * (-1085.219) (-1083.274) (-1084.019) [-1082.869] -- 0:00:04
934000 -- [-1084.342] (-1082.870) (-1084.859) (-1083.326) * (-1085.632) (-1082.442) [-1084.705] (-1082.811) -- 0:00:04
934500 -- [-1083.907] (-1085.421) (-1083.524) (-1085.956) * (-1085.772) (-1082.509) [-1082.715] (-1082.186) -- 0:00:04
935000 -- (-1087.186) (-1083.161) (-1085.122) [-1085.897] * [-1085.538] (-1083.231) (-1087.736) (-1085.706) -- 0:00:04
Average standard deviation of split frequencies: 0.008436
935500 -- [-1084.836] (-1083.422) (-1086.272) (-1082.610) * (-1088.593) (-1089.535) (-1089.904) [-1086.458] -- 0:00:04
936000 -- (-1084.455) (-1082.974) [-1087.198] (-1083.634) * (-1084.785) (-1083.930) [-1088.175] (-1083.002) -- 0:00:04
936500 -- (-1085.659) (-1082.388) [-1082.794] (-1083.991) * (-1082.390) (-1084.033) [-1083.264] (-1084.381) -- 0:00:04
937000 -- (-1083.070) (-1088.994) [-1083.368] (-1084.248) * (-1082.232) [-1083.876] (-1084.154) (-1085.288) -- 0:00:04
937500 -- (-1084.439) (-1087.786) (-1085.573) [-1083.532] * (-1084.086) (-1084.222) (-1083.268) [-1083.145] -- 0:00:04
938000 -- (-1082.409) [-1083.910] (-1084.671) (-1083.195) * (-1084.287) [-1084.257] (-1085.783) (-1085.502) -- 0:00:04
938500 -- (-1085.359) [-1083.104] (-1088.640) (-1084.818) * (-1083.190) (-1083.409) [-1083.017] (-1089.049) -- 0:00:03
939000 -- (-1083.833) (-1083.582) [-1086.883] (-1084.576) * (-1083.795) [-1082.997] (-1083.666) (-1082.942) -- 0:00:03
939500 -- [-1084.923] (-1089.620) (-1086.098) (-1083.855) * [-1082.638] (-1082.227) (-1088.684) (-1082.609) -- 0:00:03
940000 -- [-1081.892] (-1087.328) (-1084.458) (-1084.914) * (-1083.077) [-1084.364] (-1087.550) (-1084.854) -- 0:00:03
Average standard deviation of split frequencies: 0.008488
940500 -- (-1082.330) (-1083.270) [-1083.845] (-1083.725) * [-1082.931] (-1086.761) (-1084.119) (-1085.342) -- 0:00:03
941000 -- (-1085.276) [-1087.865] (-1083.416) (-1085.858) * (-1084.059) (-1083.516) [-1082.355] (-1086.983) -- 0:00:03
941500 -- [-1083.091] (-1086.357) (-1083.611) (-1087.334) * (-1082.229) (-1087.340) [-1083.510] (-1083.961) -- 0:00:03
942000 -- (-1085.034) (-1082.742) (-1083.600) [-1086.236] * (-1083.736) (-1086.365) [-1083.223] (-1083.013) -- 0:00:03
942500 -- (-1083.876) (-1082.712) (-1086.953) [-1084.093] * (-1082.027) (-1092.026) (-1083.983) [-1083.691] -- 0:00:03
943000 -- (-1083.015) [-1086.017] (-1084.510) (-1083.994) * (-1084.693) (-1086.698) [-1082.109] (-1085.724) -- 0:00:03
943500 -- (-1084.833) (-1085.088) (-1083.147) [-1086.239] * (-1083.260) (-1087.828) (-1087.163) [-1084.149] -- 0:00:03
944000 -- (-1086.127) [-1083.303] (-1084.119) (-1087.592) * (-1084.618) (-1084.484) [-1082.324] (-1083.342) -- 0:00:03
944500 -- (-1087.870) [-1084.887] (-1084.449) (-1083.165) * (-1085.608) (-1085.242) [-1082.320] (-1083.039) -- 0:00:03
945000 -- (-1084.147) [-1086.107] (-1088.200) (-1083.194) * (-1082.378) (-1083.518) (-1083.571) [-1082.445] -- 0:00:03
Average standard deviation of split frequencies: 0.008378
945500 -- (-1084.537) [-1083.211] (-1083.324) (-1085.953) * [-1088.680] (-1085.273) (-1083.728) (-1083.282) -- 0:00:03
946000 -- [-1082.807] (-1083.620) (-1083.851) (-1084.625) * (-1084.450) [-1087.121] (-1082.590) (-1083.558) -- 0:00:03
946500 -- (-1083.570) (-1083.239) (-1085.230) [-1082.945] * (-1084.996) (-1083.291) (-1083.590) [-1082.648] -- 0:00:03
947000 -- (-1083.648) [-1081.981] (-1083.283) (-1082.613) * [-1084.833] (-1085.402) (-1082.504) (-1083.039) -- 0:00:03
947500 -- (-1085.375) (-1081.656) [-1082.740] (-1082.960) * (-1084.304) (-1085.354) [-1082.578] (-1084.720) -- 0:00:03
948000 -- (-1085.244) [-1083.741] (-1083.287) (-1084.455) * (-1085.530) (-1084.467) (-1083.558) [-1083.662] -- 0:00:03
948500 -- (-1083.048) (-1084.001) (-1085.530) [-1083.845] * (-1085.249) [-1082.446] (-1082.899) (-1083.609) -- 0:00:03
949000 -- (-1084.914) (-1086.482) [-1083.699] (-1082.363) * (-1084.508) (-1083.947) [-1084.114] (-1084.312) -- 0:00:03
949500 -- [-1084.966] (-1087.668) (-1085.335) (-1084.384) * [-1083.268] (-1084.559) (-1081.613) (-1082.552) -- 0:00:03
950000 -- (-1085.345) (-1085.608) [-1085.486] (-1084.082) * (-1082.390) [-1083.530] (-1082.377) (-1082.858) -- 0:00:03
Average standard deviation of split frequencies: 0.008585
950500 -- [-1085.899] (-1083.487) (-1089.843) (-1083.295) * (-1088.745) [-1084.168] (-1081.727) (-1082.523) -- 0:00:03
951000 -- [-1083.574] (-1084.871) (-1089.458) (-1086.358) * (-1084.561) (-1084.313) [-1083.870] (-1081.857) -- 0:00:03
951500 -- [-1086.910] (-1083.590) (-1086.924) (-1084.969) * [-1083.277] (-1083.944) (-1088.431) (-1084.758) -- 0:00:03
952000 -- (-1085.894) (-1089.004) (-1084.361) [-1086.257] * (-1084.429) [-1082.761] (-1085.468) (-1084.965) -- 0:00:03
952500 -- (-1082.414) (-1082.022) (-1083.701) [-1084.775] * (-1085.017) (-1082.827) [-1083.951] (-1086.989) -- 0:00:03
953000 -- (-1084.141) (-1084.040) (-1085.211) [-1086.691] * [-1084.985] (-1087.659) (-1083.579) (-1083.573) -- 0:00:03
953500 -- (-1084.137) (-1082.378) (-1082.469) [-1082.459] * (-1086.898) (-1085.968) (-1081.876) [-1083.044] -- 0:00:03
954000 -- (-1087.309) [-1085.623] (-1082.773) (-1082.599) * [-1082.690] (-1084.142) (-1081.916) (-1085.239) -- 0:00:02
954500 -- (-1082.978) [-1084.127] (-1086.199) (-1084.122) * [-1082.564] (-1083.674) (-1083.955) (-1086.787) -- 0:00:02
955000 -- (-1083.855) (-1086.322) (-1085.440) [-1082.056] * (-1082.559) [-1082.492] (-1085.002) (-1084.296) -- 0:00:02
Average standard deviation of split frequencies: 0.008414
955500 -- [-1082.336] (-1088.204) (-1082.422) (-1083.901) * (-1083.030) (-1084.822) (-1084.413) [-1082.325] -- 0:00:02
956000 -- (-1084.611) [-1083.486] (-1085.409) (-1082.862) * (-1082.530) (-1084.104) (-1083.650) [-1083.482] -- 0:00:02
956500 -- (-1083.858) (-1083.285) [-1085.273] (-1082.859) * (-1086.422) (-1084.505) (-1085.435) [-1083.255] -- 0:00:02
957000 -- (-1086.204) (-1083.863) [-1087.480] (-1085.175) * (-1082.825) [-1083.855] (-1082.596) (-1086.725) -- 0:00:02
957500 -- [-1084.054] (-1085.647) (-1087.026) (-1084.986) * (-1083.486) (-1083.124) [-1083.152] (-1087.119) -- 0:00:02
958000 -- (-1083.453) [-1082.585] (-1084.335) (-1085.444) * [-1087.315] (-1083.614) (-1083.475) (-1083.903) -- 0:00:02
958500 -- [-1084.754] (-1083.698) (-1082.899) (-1083.409) * (-1096.369) (-1082.808) (-1082.261) [-1086.471] -- 0:00:02
959000 -- (-1084.995) (-1084.260) [-1082.594] (-1084.266) * (-1093.311) (-1084.280) [-1082.288] (-1085.635) -- 0:00:02
959500 -- (-1083.599) (-1083.266) (-1083.008) [-1083.533] * (-1084.677) [-1083.160] (-1084.984) (-1085.240) -- 0:00:02
960000 -- (-1084.060) [-1084.820] (-1089.596) (-1084.612) * (-1082.471) [-1083.711] (-1083.073) (-1082.958) -- 0:00:02
Average standard deviation of split frequencies: 0.008863
960500 -- [-1082.659] (-1084.421) (-1091.895) (-1083.164) * (-1082.253) (-1084.014) [-1083.211] (-1083.605) -- 0:00:02
961000 -- (-1084.857) (-1084.458) [-1082.181] (-1087.201) * (-1081.765) [-1082.335] (-1083.034) (-1086.242) -- 0:00:02
961500 -- (-1083.370) [-1090.448] (-1084.444) (-1086.599) * (-1085.849) (-1083.458) [-1083.507] (-1087.920) -- 0:00:02
962000 -- (-1082.078) (-1087.195) [-1081.924] (-1082.174) * (-1086.549) [-1083.189] (-1082.736) (-1083.694) -- 0:00:02
962500 -- (-1082.693) (-1086.705) [-1082.584] (-1083.652) * [-1083.374] (-1083.993) (-1082.579) (-1087.784) -- 0:00:02
963000 -- (-1082.892) [-1084.031] (-1082.584) (-1083.890) * (-1086.097) (-1085.709) [-1084.361] (-1082.182) -- 0:00:02
963500 -- [-1081.744] (-1083.275) (-1085.457) (-1083.286) * [-1082.969] (-1082.737) (-1086.203) (-1083.687) -- 0:00:02
964000 -- (-1083.186) (-1083.862) (-1085.140) [-1085.547] * (-1084.149) (-1084.468) (-1084.418) [-1085.313] -- 0:00:02
964500 -- (-1084.831) (-1083.512) [-1086.331] (-1082.239) * (-1082.444) (-1086.349) [-1083.415] (-1082.531) -- 0:00:02
965000 -- (-1084.200) [-1085.436] (-1083.660) (-1083.023) * (-1085.042) [-1085.146] (-1085.838) (-1084.458) -- 0:00:02
Average standard deviation of split frequencies: 0.008753
965500 -- (-1083.866) [-1083.618] (-1084.321) (-1084.884) * (-1083.942) (-1087.860) (-1083.153) [-1087.425] -- 0:00:02
966000 -- (-1083.716) (-1088.974) [-1084.490] (-1083.075) * (-1084.746) (-1084.149) (-1084.614) [-1082.633] -- 0:00:02
966500 -- (-1085.048) (-1085.403) [-1083.628] (-1084.354) * [-1083.243] (-1084.649) (-1085.999) (-1082.861) -- 0:00:02
967000 -- (-1083.736) (-1084.577) (-1084.083) [-1082.965] * (-1083.784) (-1086.526) (-1086.423) [-1082.792] -- 0:00:02
967500 -- (-1082.511) (-1083.830) (-1083.608) [-1082.671] * [-1083.431] (-1086.486) (-1084.833) (-1082.699) -- 0:00:02
968000 -- (-1084.644) (-1082.652) [-1084.611] (-1083.857) * (-1083.985) (-1091.175) (-1084.954) [-1083.493] -- 0:00:02
968500 -- (-1085.572) (-1085.332) [-1084.362] (-1085.495) * (-1085.668) (-1083.807) [-1086.993] (-1082.544) -- 0:00:02
969000 -- (-1081.913) [-1082.690] (-1084.070) (-1084.291) * [-1082.544] (-1082.100) (-1087.602) (-1082.602) -- 0:00:02
969500 -- (-1082.711) (-1083.804) [-1083.808] (-1084.526) * [-1082.810] (-1082.441) (-1085.011) (-1082.580) -- 0:00:01
970000 -- [-1082.832] (-1083.760) (-1082.080) (-1084.921) * (-1083.370) [-1085.472] (-1087.695) (-1082.620) -- 0:00:01
Average standard deviation of split frequencies: 0.008711
970500 -- (-1084.082) (-1084.552) (-1081.921) [-1085.193] * (-1088.197) [-1085.365] (-1086.135) (-1083.703) -- 0:00:01
971000 -- (-1083.697) [-1084.090] (-1083.139) (-1086.104) * [-1087.469] (-1087.328) (-1082.434) (-1085.392) -- 0:00:01
971500 -- (-1085.141) (-1085.750) [-1082.127] (-1084.215) * (-1083.884) (-1082.219) [-1083.196] (-1086.288) -- 0:00:01
972000 -- (-1089.017) [-1084.641] (-1085.310) (-1085.896) * [-1083.660] (-1082.030) (-1084.700) (-1085.586) -- 0:00:01
972500 -- (-1085.456) (-1087.548) (-1083.250) [-1090.866] * [-1083.142] (-1083.321) (-1085.571) (-1084.703) -- 0:00:01
973000 -- [-1085.125] (-1085.611) (-1083.477) (-1085.386) * [-1084.504] (-1084.495) (-1083.850) (-1086.516) -- 0:00:01
973500 -- [-1082.439] (-1086.868) (-1082.340) (-1085.839) * (-1084.500) (-1083.996) [-1083.089] (-1087.818) -- 0:00:01
974000 -- (-1081.963) (-1082.692) (-1083.186) [-1084.356] * (-1084.861) [-1083.519] (-1085.853) (-1083.571) -- 0:00:01
974500 -- [-1083.791] (-1083.794) (-1082.690) (-1085.043) * (-1086.348) (-1083.668) (-1083.836) [-1082.988] -- 0:00:01
975000 -- (-1082.545) (-1085.065) (-1083.355) [-1084.051] * (-1085.533) (-1086.921) [-1083.244] (-1084.008) -- 0:00:01
Average standard deviation of split frequencies: 0.008483
975500 -- (-1083.984) [-1084.742] (-1084.243) (-1085.076) * (-1083.786) (-1086.502) [-1086.806] (-1081.865) -- 0:00:01
976000 -- (-1083.223) (-1082.976) [-1082.825] (-1082.271) * (-1083.166) (-1092.401) (-1085.875) [-1085.590] -- 0:00:01
976500 -- [-1082.592] (-1082.614) (-1083.360) (-1082.489) * (-1082.112) (-1085.543) (-1084.229) [-1082.582] -- 0:00:01
977000 -- [-1085.848] (-1084.931) (-1088.205) (-1084.292) * (-1082.869) [-1084.784] (-1084.662) (-1082.734) -- 0:00:01
977500 -- (-1082.877) [-1086.443] (-1084.676) (-1083.325) * (-1082.793) (-1083.330) (-1084.059) [-1083.804] -- 0:00:01
978000 -- (-1082.717) [-1085.083] (-1082.300) (-1083.230) * (-1082.044) (-1087.215) [-1083.909] (-1083.341) -- 0:00:01
978500 -- (-1082.313) [-1085.251] (-1086.749) (-1086.442) * (-1083.084) (-1083.806) [-1084.670] (-1082.498) -- 0:00:01
979000 -- [-1082.603] (-1082.360) (-1088.856) (-1084.451) * (-1082.987) [-1083.514] (-1083.637) (-1083.598) -- 0:00:01
979500 -- (-1083.944) (-1084.853) (-1084.478) [-1085.293] * (-1085.282) (-1085.111) [-1083.731] (-1083.630) -- 0:00:01
980000 -- [-1082.519] (-1086.386) (-1082.531) (-1082.254) * [-1082.748] (-1085.353) (-1087.111) (-1084.154) -- 0:00:01
Average standard deviation of split frequencies: 0.008382
980500 -- (-1084.253) (-1087.151) (-1083.598) [-1082.547] * (-1083.773) [-1084.289] (-1084.463) (-1084.807) -- 0:00:01
981000 -- [-1082.039] (-1085.996) (-1085.924) (-1086.081) * (-1082.391) [-1083.413] (-1082.712) (-1082.984) -- 0:00:01
981500 -- [-1083.051] (-1084.679) (-1084.811) (-1083.630) * [-1085.291] (-1085.397) (-1083.259) (-1085.900) -- 0:00:01
982000 -- [-1082.787] (-1083.505) (-1085.774) (-1086.437) * (-1084.459) [-1085.556] (-1083.316) (-1090.218) -- 0:00:01
982500 -- (-1084.728) [-1082.882] (-1086.444) (-1090.971) * (-1082.727) [-1084.840] (-1086.126) (-1082.611) -- 0:00:01
983000 -- (-1084.816) [-1084.855] (-1090.622) (-1084.397) * (-1084.958) [-1085.912] (-1086.081) (-1082.995) -- 0:00:01
983500 -- (-1094.781) (-1083.240) (-1082.882) [-1083.955] * (-1083.460) (-1083.204) [-1086.606] (-1082.142) -- 0:00:01
984000 -- [-1086.325] (-1086.961) (-1082.824) (-1084.528) * (-1082.985) (-1083.043) (-1092.982) [-1084.167] -- 0:00:01
984500 -- (-1082.846) (-1089.270) (-1083.019) [-1085.775] * (-1083.847) (-1084.072) (-1085.859) [-1083.720] -- 0:00:01
985000 -- [-1083.664] (-1083.194) (-1082.678) (-1082.782) * (-1082.434) [-1087.561] (-1084.343) (-1082.520) -- 0:00:00
Average standard deviation of split frequencies: 0.007889
985500 -- [-1082.667] (-1085.358) (-1084.179) (-1082.440) * (-1082.192) [-1083.902] (-1082.694) (-1082.445) -- 0:00:00
986000 -- (-1083.228) (-1083.698) [-1083.154] (-1082.478) * (-1082.883) (-1083.370) (-1083.990) [-1082.813] -- 0:00:00
986500 -- (-1084.659) [-1083.412] (-1083.213) (-1084.716) * (-1087.145) [-1085.402] (-1083.389) (-1085.783) -- 0:00:00
987000 -- (-1083.241) (-1082.811) [-1083.496] (-1087.094) * (-1081.895) (-1084.729) [-1083.750] (-1085.151) -- 0:00:00
987500 -- (-1085.492) (-1083.423) (-1082.121) [-1086.984] * (-1083.759) (-1083.170) (-1083.586) [-1083.877] -- 0:00:00
988000 -- (-1085.734) (-1087.993) (-1085.408) [-1082.796] * [-1083.467] (-1085.328) (-1087.881) (-1081.990) -- 0:00:00
988500 -- [-1083.887] (-1092.321) (-1087.181) (-1086.124) * [-1082.262] (-1084.165) (-1085.304) (-1084.508) -- 0:00:00
989000 -- (-1082.833) (-1082.800) [-1084.928] (-1082.639) * [-1082.384] (-1086.985) (-1085.619) (-1083.713) -- 0:00:00
989500 -- (-1081.774) [-1083.247] (-1084.373) (-1082.807) * [-1083.532] (-1087.592) (-1090.239) (-1084.049) -- 0:00:00
990000 -- (-1084.167) (-1083.332) (-1084.689) [-1083.698] * [-1086.098] (-1085.434) (-1083.061) (-1082.467) -- 0:00:00
Average standard deviation of split frequencies: 0.007792
990500 -- (-1084.106) (-1082.558) [-1083.379] (-1083.367) * (-1085.121) (-1083.277) [-1082.122] (-1094.093) -- 0:00:00
991000 -- (-1084.626) (-1083.941) [-1083.385] (-1083.509) * (-1083.939) (-1085.523) (-1082.037) [-1085.643] -- 0:00:00
991500 -- (-1085.130) (-1083.434) [-1083.926] (-1082.292) * (-1083.907) (-1087.169) (-1083.548) [-1083.042] -- 0:00:00
992000 -- (-1084.100) (-1082.625) [-1083.409] (-1083.032) * (-1085.855) (-1086.553) (-1084.031) [-1084.695] -- 0:00:00
992500 -- (-1086.560) (-1082.779) (-1082.770) [-1084.590] * (-1083.864) (-1082.798) [-1083.755] (-1088.610) -- 0:00:00
993000 -- (-1082.768) (-1082.056) (-1082.904) [-1081.904] * (-1083.110) (-1084.891) (-1083.467) [-1082.551] -- 0:00:00
993500 -- [-1082.719] (-1084.669) (-1085.119) (-1084.337) * (-1087.626) (-1084.154) (-1081.826) [-1081.712] -- 0:00:00
994000 -- [-1082.650] (-1084.211) (-1083.528) (-1084.172) * (-1083.086) [-1083.936] (-1082.137) (-1081.712) -- 0:00:00
994500 -- [-1083.037] (-1083.795) (-1086.206) (-1087.080) * (-1083.405) (-1086.449) (-1082.724) [-1082.544] -- 0:00:00
995000 -- (-1084.294) [-1084.670] (-1083.455) (-1093.535) * (-1081.946) (-1083.822) (-1085.393) [-1084.523] -- 0:00:00
Average standard deviation of split frequencies: 0.007188
995500 -- (-1081.613) (-1089.335) (-1084.874) [-1083.306] * (-1082.312) [-1083.479] (-1081.754) (-1083.697) -- 0:00:00
996000 -- (-1082.514) (-1087.567) (-1085.634) [-1081.802] * (-1082.361) (-1084.498) [-1081.841] (-1083.698) -- 0:00:00
996500 -- (-1082.415) (-1085.577) (-1087.892) [-1084.073] * (-1084.289) (-1084.170) (-1085.410) [-1081.935] -- 0:00:00
997000 -- (-1086.210) [-1082.733] (-1088.720) (-1085.558) * (-1086.387) [-1083.419] (-1085.020) (-1082.335) -- 0:00:00
997500 -- (-1087.854) [-1082.806] (-1089.254) (-1084.500) * [-1083.748] (-1082.891) (-1086.263) (-1083.208) -- 0:00:00
998000 -- (-1088.634) (-1084.870) (-1086.823) [-1085.417] * [-1085.168] (-1084.200) (-1085.857) (-1088.194) -- 0:00:00
998500 -- (-1084.436) (-1085.124) (-1083.396) [-1082.926] * (-1082.657) (-1085.665) (-1082.099) [-1082.252] -- 0:00:00
999000 -- (-1084.369) [-1085.595] (-1083.543) (-1084.819) * [-1084.074] (-1086.210) (-1084.049) (-1085.442) -- 0:00:00
999500 -- (-1083.690) [-1085.899] (-1084.807) (-1088.944) * (-1083.060) (-1088.973) (-1083.000) [-1085.993] -- 0:00:00
1000000 -- [-1084.774] (-1084.559) (-1083.251) (-1085.230) * (-1083.559) (-1090.796) [-1082.031] (-1087.311) -- 0:00:00
Average standard deviation of split frequencies: 0.007420
Analysis completed in 1 mins 5 seconds
Analysis used 63.36 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1081.54
Likelihood of best state for "cold" chain of run 2 was -1081.54
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.5 % ( 26 %) Dirichlet(Pi{all})
28.8 % ( 37 %) Slider(Pi{all})
78.5 % ( 51 %) Multiplier(Alpha{1,2})
77.9 % ( 48 %) Multiplier(Alpha{3})
20.1 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.9 % ( 19 %) Dirichlet(Pi{all})
29.1 % ( 21 %) Slider(Pi{all})
78.4 % ( 51 %) Multiplier(Alpha{1,2})
78.1 % ( 56 %) Multiplier(Alpha{3})
20.7 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166135 0.82 0.67
3 | 166200 167166 0.84
4 | 167331 166953 166215
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166807 0.82 0.66
3 | 166404 166547 0.84
4 | 166847 166954 166441
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1083.22
| 2 1 |
| 2 |
| 2 2|
| 1 2 2 2 1 2 2 1 22 |
| 1 1 2 2 1 1 |
| 1 1 2 2 1 1 * 1 * 1 1 1|
| 2 11 2 1 2 2 1 * 1 1 1 |
| 1 2 1 1 2 1 2 1 * 1 |
|1222 11 22 21 112 1 1 * 2 2 2 22 2 |
| 1 11 12 2 1 1 2 2 1 1 |
| 1 2 1 22 |
|2 2 2 2 2 2 |
| 1 1 1 2 2 1 1 2 |
| 2 1 2 1 |
| 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1084.76
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1083.26 -1086.04
2 -1083.22 -1087.03
--------------------------------------
TOTAL -1083.24 -1086.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888996 0.087648 0.370666 1.501671 0.858143 1496.06 1498.53 1.000
r(A<->C){all} 0.158995 0.018021 0.000056 0.427117 0.122339 305.94 345.88 1.000
r(A<->G){all} 0.159815 0.019690 0.000046 0.448766 0.119584 208.79 241.80 1.007
r(A<->T){all} 0.162229 0.019107 0.000229 0.441530 0.125961 179.84 182.23 1.000
r(C<->G){all} 0.179926 0.022836 0.000053 0.501303 0.143250 291.47 302.76 1.002
r(C<->T){all} 0.169622 0.019480 0.000109 0.445135 0.134385 210.09 219.00 1.000
r(G<->T){all} 0.169412 0.021420 0.000090 0.465162 0.127890 182.29 247.97 1.000
pi(A){all} 0.152990 0.000159 0.129242 0.177935 0.152602 1305.89 1344.60 1.000
pi(C){all} 0.303112 0.000260 0.271101 0.334417 0.302783 1001.46 1054.14 1.000
pi(G){all} 0.314333 0.000260 0.281421 0.343883 0.314295 1196.62 1196.86 1.000
pi(T){all} 0.229565 0.000220 0.200046 0.257370 0.229425 1010.01 1091.81 1.000
alpha{1,2} 0.417514 0.241410 0.000154 1.424288 0.248177 1023.06 1172.76 1.000
alpha{3} 0.432431 0.231431 0.000107 1.416047 0.264225 874.86 1159.56 1.000
pinvar{all} 0.998032 0.000006 0.993730 0.999998 0.998777 1211.46 1278.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ..*.*.
9 -- ....**
10 -- .*...*
11 -- .**.**
12 -- .****.
13 -- .***.*
14 -- .**...
15 -- ..****
16 -- ..*..*
17 -- ...*.*
18 -- .*.*..
19 -- ...**.
20 -- .*..*.
21 -- .*.***
22 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.006595 0.147901 0.157229 2
8 448 0.149234 0.008480 0.143238 0.155230 2
9 445 0.148235 0.008951 0.141905 0.154564 2
10 443 0.147568 0.010835 0.139907 0.155230 2
11 443 0.147568 0.002355 0.145903 0.149234 2
12 436 0.145237 0.005653 0.141239 0.149234 2
13 428 0.142572 0.012248 0.133911 0.151233 2
14 428 0.142572 0.007537 0.137242 0.147901 2
15 424 0.141239 0.002827 0.139241 0.143238 2
16 421 0.140240 0.000471 0.139907 0.140573 2
17 418 0.139241 0.005653 0.135243 0.143238 2
18 417 0.138907 0.009893 0.131912 0.145903 2
19 414 0.137908 0.010364 0.130580 0.145237 2
20 405 0.134910 0.005182 0.131246 0.138574 2
21 393 0.130913 0.006124 0.126582 0.135243 2
22 287 0.095603 0.015546 0.084610 0.106596 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/yrbE1A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097924 0.008979 0.000001 0.290084 0.067812 1.000 2
length{all}[2] 0.095739 0.009126 0.000001 0.290337 0.067266 1.000 2
length{all}[3] 0.101480 0.010335 0.000013 0.302487 0.070404 1.000 2
length{all}[4] 0.099236 0.009653 0.000011 0.289174 0.069044 1.000 2
length{all}[5] 0.101245 0.010611 0.000012 0.308701 0.068290 1.000 2
length{all}[6] 0.099648 0.010052 0.000041 0.296385 0.070792 1.000 2
length{all}[7] 0.090497 0.007620 0.000508 0.253139 0.063698 1.001 2
length{all}[8] 0.097903 0.010681 0.000083 0.309407 0.066474 1.001 2
length{all}[9] 0.097505 0.009138 0.000088 0.272949 0.070905 0.999 2
length{all}[10] 0.095034 0.008091 0.000451 0.282782 0.065315 0.998 2
length{all}[11] 0.090960 0.007472 0.000320 0.272986 0.065800 0.998 2
length{all}[12] 0.099812 0.010273 0.000327 0.313364 0.061732 0.999 2
length{all}[13] 0.100700 0.010170 0.000034 0.317072 0.068504 1.000 2
length{all}[14] 0.091547 0.008716 0.000262 0.275502 0.059779 0.998 2
length{all}[15] 0.104145 0.011203 0.000138 0.315774 0.069500 1.001 2
length{all}[16] 0.103247 0.009260 0.000921 0.298291 0.071815 1.001 2
length{all}[17] 0.097138 0.007559 0.000038 0.256383 0.070471 1.013 2
length{all}[18] 0.101995 0.012091 0.000504 0.293455 0.068760 0.998 2
length{all}[19] 0.093541 0.008153 0.000155 0.271733 0.066018 1.000 2
length{all}[20] 0.097917 0.010528 0.000090 0.303017 0.064974 0.998 2
length{all}[21] 0.093527 0.008132 0.000258 0.264050 0.068358 0.999 2
length{all}[22] 0.101780 0.011099 0.000873 0.313558 0.065840 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007420
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 801
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 267 / 267 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 267 / 267 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069488 0.016366 0.016802 0.049148 0.010443 0.029896 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1076.455141
Iterating by ming2
Initial: fx= 1076.455141
x= 0.06949 0.01637 0.01680 0.04915 0.01044 0.02990 0.30000 1.30000
1 h-m-p 0.0000 0.0000 645.6714 ++ 1059.998171 m 0.0000 13 | 1/8
2 h-m-p 0.0159 7.9311 30.9896 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 590.1267 ++ 1052.192829 m 0.0000 46 | 2/8
4 h-m-p 0.0160 8.0000 27.1363 -------------.. | 2/8
5 h-m-p 0.0000 0.0000 527.9199 ++ 1051.732936 m 0.0000 79 | 3/8
6 h-m-p 0.0160 8.0000 21.5287 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 456.4863 ++ 1041.373168 m 0.0000 112 | 4/8
8 h-m-p 0.0160 8.0000 16.1009 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 372.9587 ++ 1031.159581 m 0.0001 145 | 5/8
10 h-m-p 0.0160 8.0000 11.5906 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 264.1964 ++ 1025.721736 m 0.0001 178 | 6/8
12 h-m-p 0.4929 8.0000 0.0000 ++C 1025.721736 0 7.8869 191 | 6/8
13 h-m-p 0.2732 8.0000 0.0001 ---Y 1025.721736 0 0.0005 207 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1025.721736 m 8.0000 223 | 6/8
15 h-m-p 0.0160 8.0000 0.0194 +++++ 1025.721736 m 8.0000 239 | 6/8
16 h-m-p 1.6000 8.0000 0.0086 Y 1025.721736 0 0.9931 252 | 6/8
17 h-m-p 1.6000 8.0000 0.0002 ---Y 1025.721736 0 0.0063 268 | 6/8
18 h-m-p 0.1571 8.0000 0.0000 -Y 1025.721736 0 0.0098 282 | 6/8
19 h-m-p 1.0972 8.0000 0.0000 ----------Y 1025.721736 0 0.0000 305
Out..
lnL = -1025.721736
306 lfun, 306 eigenQcodon, 1836 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093061 0.064995 0.035746 0.068273 0.097116 0.106212 0.404408 0.758138 0.260602
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.037871
np = 9
lnL0 = -1143.943104
Iterating by ming2
Initial: fx= 1143.943104
x= 0.09306 0.06499 0.03575 0.06827 0.09712 0.10621 0.40441 0.75814 0.26060
1 h-m-p 0.0000 0.0001 595.7198 ++ 1091.357992 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 490.5193 ++ 1053.484784 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 2696.0088 ++ 1049.787033 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1361.2664 ++ 1031.859828 m 0.0001 50 | 4/9
5 h-m-p 0.0024 0.0118 7.6283 ------------.. | 4/9
6 h-m-p 0.0000 0.0000 456.0024 ++ 1029.760118 m 0.0000 84 | 5/9
7 h-m-p 0.0025 0.5537 1.5285 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 373.8909 ++ 1027.864025 m 0.0000 118 | 6/9
9 h-m-p 0.0011 0.2180 3.1848 -----------.. | 6/9
10 h-m-p 0.0000 0.0000 265.3256 ++ 1025.721785 m 0.0000 151 | 7/9
11 h-m-p 0.1369 8.0000 0.0000 +++ 1025.721785 m 8.0000 164 | 6/9
12 h-m-p 0.0250 8.0000 0.0022 ----Y 1025.721785 0 0.0000 182 | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 1025.721784 m 8.0000 200 | 6/9
14 h-m-p 0.0002 0.0009 1.2749 ------C 1025.721784 0 0.0000 221 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1025.721784 m 8.0000 236 | 6/9
16 h-m-p 0.0160 8.0000 0.0039 +++++ 1025.721783 m 8.0000 254 | 6/9
17 h-m-p 0.0492 0.6784 0.6265 ++ 1025.721774 m 0.6784 269 | 6/9
18 h-m-p -0.0000 -0.0000 0.2157
h-m-p: -1.16991116e-17 -5.84955580e-17 2.15728259e-01 1025.721774
.. | 6/9
19 h-m-p 0.0160 8.0000 0.0001 +++++ 1025.721774 m 8.0000 299 | 6/9
20 h-m-p 0.0056 2.8165 0.3327 +++++ 1025.721748 m 2.8165 317 | 7/9
21 h-m-p 0.3756 1.8780 0.0882 ++ 1025.721747 m 1.8780 332 | 7/9
22 h-m-p 0.0000 0.0000 5.0688
h-m-p: 0.00000000e+00 0.00000000e+00 5.06881195e+00 1025.721747
.. | 7/9
23 h-m-p 0.0160 8.0000 0.0000 +++++ 1025.721747 m 8.0000 358 | 7/9
24 h-m-p 0.0545 8.0000 0.0041 ++++ 1025.721746 m 8.0000 374 | 8/9
25 h-m-p 0.0303 8.0000 1.0922 +++++ 1025.721701 m 8.0000 391 | 8/9
26 h-m-p 1.6000 8.0000 0.3946 ++ 1025.721699 m 8.0000 403 | 8/9
27 h-m-p 0.7741 8.0000 4.0778 ++ 1025.721692 m 8.0000 416 | 8/9
28 h-m-p 1.6000 8.0000 3.1342 ++ 1025.721691 m 8.0000 428 | 8/9
29 h-m-p 1.6000 8.0000 0.0000 N 1025.721691 0 1.6000 440
Out..
lnL = -1025.721691
441 lfun, 1323 eigenQcodon, 5292 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027236 0.017121 0.023293 0.075195 0.071255 0.036340 69.791731 0.816452 0.248697 0.388283 1.320013
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.262325
np = 11
lnL0 = -1089.662611
Iterating by ming2
Initial: fx= 1089.662611
x= 0.02724 0.01712 0.02329 0.07520 0.07126 0.03634 69.79173 0.81645 0.24870 0.38828 1.32001
1 h-m-p 0.0000 0.0001 608.8419 ++ 1064.158769 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 124.4181 ++ 1054.184910 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0000 12517.4702 ++ 1049.339009 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 4209.9492 ++ 1041.114649 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 26232748.2602 ++ 1032.556456 m 0.0000 72 | 5/11
6 h-m-p 0.0160 8.0000 4.4441 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 365.6963 ++ 1026.415796 m 0.0000 111 | 6/11
8 h-m-p 0.0160 8.0000 2.8568 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 264.1450 ++ 1025.721732 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1025.721732 m 8.0000 167 | 6/11
11 h-m-p 0.0160 8.0000 0.0046 +++++ 1025.721731 m 8.0000 188 | 6/11
12 h-m-p 0.0581 0.9212 0.6380 ++ 1025.721729 m 0.9212 207 | 6/11
13 h-m-p -0.0000 -0.0000 0.1575
h-m-p: -0.00000000e+00 -0.00000000e+00 1.57494786e-01 1025.721729
.. | 6/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 1025.721729 m 8.0000 245 | 6/11
15 h-m-p 0.0040 2.0170 0.6656 +++++ 1025.721682 m 2.0170 267 | 7/11
16 h-m-p 1.6000 8.0000 0.1911 ++ 1025.721674 m 8.0000 286 | 7/11
17 h-m-p 1.6000 8.0000 0.5354 C 1025.721673 0 1.6000 304 | 7/11
18 h-m-p 1.6000 8.0000 0.0018 ++ 1025.721673 m 8.0000 322 | 7/11
19 h-m-p 0.3672 8.0000 0.0392 +Y 1025.721673 0 2.6547 341 | 7/11
20 h-m-p 1.6000 8.0000 0.0011 ++ 1025.721673 m 8.0000 359 | 7/11
21 h-m-p 0.0039 1.3738 2.3717 --------C 1025.721673 0 0.0000 385 | 7/11
22 h-m-p 0.0001 0.0708 1982.4095 +++++ 1025.721599 m 0.0708 402 | 7/11
23 h-m-p -0.0000 -0.0000 0.2595
h-m-p: -0.00000000e+00 -0.00000000e+00 2.59544102e-01 1025.721599
.. | 7/11
24 h-m-p 0.0160 8.0000 0.0000 +C 1025.721599 0 0.0640 432 | 7/11
25 h-m-p 0.0160 8.0000 0.0000 -C 1025.721599 0 0.0011 451
Out..
lnL = -1025.721599
452 lfun, 1808 eigenQcodon, 8136 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1025.715555 S = -1025.715397 -0.000060
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101244 0.053444 0.060481 0.090885 0.034966 0.061475 70.084560 0.600251 1.913046
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.498666
np = 9
lnL0 = -1127.323674
Iterating by ming2
Initial: fx= 1127.323674
x= 0.10124 0.05344 0.06048 0.09088 0.03497 0.06148 70.08456 0.60025 1.91305
1 h-m-p 0.0000 0.0001 585.3293 ++ 1076.973614 m 0.0001 14 | 1/9
2 h-m-p 0.0038 0.0439 19.8489 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 563.3414 ++ 1053.093564 m 0.0001 48 | 2/9
4 h-m-p 0.0041 0.0810 9.0291 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 517.0775 ++ 1045.583590 m 0.0000 82 | 3/9
6 h-m-p 0.0019 0.1720 6.6730 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 450.3474 ++ 1044.785931 m 0.0000 116 | 4/9
8 h-m-p 0.0009 0.4375 4.9254 -----------.. | 4/9
9 h-m-p 0.0000 0.0001 364.7660 ++ 1028.687796 m 0.0001 149 | 5/9
10 h-m-p 0.0073 0.6988 4.1713 -------------.. | 5/9
11 h-m-p 0.0000 0.0000 265.7557 ++ 1025.721815 m 0.0000 184 | 6/9
12 h-m-p 0.4289 8.0000 0.0000 +++ 1025.721815 m 8.0000 197 | 6/9
13 h-m-p 0.0546 8.0000 0.0007 ++++ 1025.721815 m 8.0000 214 | 6/9
14 h-m-p 0.0160 8.0000 0.9259 +++++ 1025.721807 m 8.0000 232 | 6/9
15 h-m-p 1.6000 8.0000 0.4011 ++ 1025.721807 m 8.0000 247 | 6/9
16 h-m-p 0.7577 8.0000 4.2352 ++ 1025.721806 m 8.0000 262 | 6/9
17 h-m-p 0.6707 3.3536 17.4705 ++ 1025.721805 m 3.3536 274 | 6/9
18 h-m-p 0.0000 0.0000 64.5718
h-m-p: 0.00000000e+00 0.00000000e+00 6.45718217e+01 1025.721805
.. | 6/9
19 h-m-p 0.0160 8.0000 0.0000 Y 1025.721805 0 0.0160 295 | 6/9
20 h-m-p 0.0160 8.0000 0.0000 N 1025.721805 0 0.0040 310
Out..
lnL = -1025.721805
311 lfun, 3421 eigenQcodon, 18660 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028574 0.101994 0.023524 0.100878 0.072060 0.028612 69.548850 0.900000 0.260107 1.549114 1.196577
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.494218
np = 11
lnL0 = -1111.563794
Iterating by ming2
Initial: fx= 1111.563794
x= 0.02857 0.10199 0.02352 0.10088 0.07206 0.02861 69.54885 0.90000 0.26011 1.54911 1.19658
1 h-m-p 0.0000 0.0001 546.7507 ++ 1080.027254 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0001 275.4236 ++ 1073.419417 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0000 353.1785 ++ 1073.375864 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0013 199.6231 ++++ 1041.591965 m 0.0013 60 | 4/11
5 h-m-p 0.0000 0.0000 117773.9539 ++ 1031.813356 m 0.0000 74 | 5/11
6 h-m-p 0.0137 0.1293 6.6358 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 364.8895 ++ 1026.029580 m 0.0000 113 | 6/11
8 h-m-p 0.0021 0.1808 5.2107 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 265.6420 ++ 1025.721759 m 0.0000 151 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 1025.721759 m 8.0000 168 | 7/11
11 h-m-p 0.0310 8.0000 0.0014 +++++ 1025.721759 m 8.0000 189 | 7/11
12 h-m-p 0.2488 8.0000 0.0446 +C 1025.721759 0 1.0028 208 | 7/11
13 h-m-p 1.6000 8.0000 0.0001 C 1025.721759 0 1.6000 226 | 7/11
14 h-m-p 1.6000 8.0000 0.0000 ++ 1025.721759 m 8.0000 244 | 7/11
15 h-m-p 0.0160 8.0000 0.0021 +++++ 1025.721759 m 8.0000 265 | 7/11
16 h-m-p 1.6000 8.0000 0.0036 +Y 1025.721759 0 5.1995 284 | 7/11
17 h-m-p 1.6000 8.0000 0.0004 ++ 1025.721759 m 8.0000 302 | 7/11
18 h-m-p 0.0052 2.5809 2.0355 +++
QuantileBeta(0.15, 0.00500, 2.86981) = 8.624925e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
+ 1025.721625 m 2.5809 323
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.897192e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10274) = 5.698264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.10273) = 5.698267e-161 2000 rounds
| 8/11
19 h-m-p 1.6000 8.0000 0.5366
QuantileBeta(0.15, 0.00500, 4.51881) = 5.111824e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.76703) = 3.905090e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
+ 1025.721616 m 8.0000 337
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.746448e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18331) = 3.619939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18289) = 3.620205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.18310) = 3.620072e-161 2000 rounds
| 8/11
20 h-m-p 1.3951 8.0000 3.0774
QuantileBeta(0.15, 0.00500, 8.26316) = 2.651996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.50334) = 1.471123e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
+ 1025.721605 m 8.0000 354
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.210718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11126) = 1.169877e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.11125) = 1.169878e-161 2000 rounds
| 8/11
21 h-m-p 1.6000 8.0000 2.2737
QuantileBeta(0.15, 0.00500, 19.87291) = 1.063534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 25.15791) = 8.356425e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 26.91957) = 7.799337e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
Y 1025.721605 0 4.8508 369
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 9.290701e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45213) = 8.977301e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.45212) = 8.977306e-162 2000 rounds
| 8/11
22 h-m-p 1.6000 8.0000 1.8109
QuantileBeta(0.15, 0.00500, 22.04774) = 9.562236e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.10103) = 9.116726e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.36435) = 9.011759e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
C 1025.721605 0 0.0804 384
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.319356e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38154) = 9.004990e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.38153) = 9.004994e-162 2000 rounds
| 8/11
23 h-m-p 1.6000 8.0000 0.0513
QuantileBeta(0.15, 0.00500, 23.42051) = 8.989685e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.53744) = 8.944067e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
+ 1025.721605 m 8.0000 398
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 9.240672e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57690) = 8.928779e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57594) = 8.929149e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.57642) = 8.928964e-162 2000 rounds
| 8/11
24 h-m-p 1.6000 8.0000 0.1330
QuantileBeta(0.15, 0.00500, 23.67630) = 8.890494e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.97594) = 8.777049e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 24.07582) = 8.739874e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
C 1025.721605 0 5.9293 416
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 9.094834e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94703) = 8.787865e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94607) = 8.788227e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.94655) = 8.788046e-162 2000 rounds
| 8/11
25 h-m-p 1.6000 8.0000 0.0038
QuantileBeta(0.15, 0.00500, 23.94324) = 8.789286e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93332) = 8.793007e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
+ 1025.721605 m 8.0000 433
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 9.101253e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93050) = 8.794067e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.92953) = 8.794429e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
| 8/11
26 h-m-p 0.0160 8.0000 4.8233
QuantileBeta(0.15, 0.00500, 23.96606) = 8.780743e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93902) = 8.790868e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93227) = 8.793403e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93058) = 8.794037e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93015) = 8.794195e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93005) = 8.794235e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93002) = 8.794245e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794247e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
Y 1025.721605 0 0.0000 457
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 9.101253e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93002) = 8.794244e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.93001) = 8.794248e-162 2000 rounds
| 8/11
27 h-m-p 0.0160 8.0000 2.0556
QuantileBeta(0.15, 0.00500, 23.94439) = 8.788858e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.98751) = 8.772727e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 24.15998) = 8.708791e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 24.84989) = 8.462104e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 27.60953) = 7.600879e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
C 1025.721605 0 1.0740 474
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.741391e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89483) = 8.446521e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.89481) = 8.446525e-162 2000 rounds
| 8/11
28 h-m-p 0.8455 8.0000 2.6112
QuantileBeta(0.15, 0.00500, 23.93002) = 8.794245e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.65362) = 8.530852e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.83451) = 8.467450e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.87974) = 8.451747e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
Y 1025.721605 0 0.0099 490
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.745458e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88348) = 8.450451e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88347) = 8.450455e-162 2000 rounds
| 8/11
29 h-m-p 0.5698 8.0000 0.0456
QuantileBeta(0.15, 0.00500, 24.87213) = 8.454387e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88063) = 8.451437e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88203) = 8.450953e-162 2000 rounds
Y 1025.721605 0 0.0356 505
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.745712e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88325) = 8.450529e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88226) = 8.450872e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
| 8/11
30 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 24.88278) = 8.450694e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450699e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
Y 1025.721605 0 0.0000 529
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
Out..
lnL = -1025.721605
530 lfun, 6360 eigenQcodon, 34980 P(t)
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1025.716165 S = -1025.715462 -0.000308
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:19
did 20 / 54 patterns 0:20
did 30 / 54 patterns 0:20
did 40 / 54 patterns 0:20
did 50 / 54 patterns 0:20
did 54 / 54 patterns 0:20
QuantileBeta(0.15, 0.00500, 24.88276) = 8.450700e-162 2000 rounds
Time used: 0:20
CodeML output code: -1