--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:06:22 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/12res/yrbE1B/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1178.64 -1185.59 2 -1178.69 -1182.08 -------------------------------------- TOTAL -1178.67 -1184.92 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.894920 0.083277 0.352425 1.473108 0.868756 1370.73 1435.86 1.000 r(A<->C){all} 0.162241 0.020190 0.000024 0.452551 0.120783 219.08 243.26 1.001 r(A<->G){all} 0.151702 0.018117 0.000336 0.428449 0.112129 155.96 204.63 1.000 r(A<->T){all} 0.169382 0.020450 0.000066 0.460797 0.130601 199.58 239.40 1.000 r(C<->G){all} 0.168068 0.019582 0.000043 0.445092 0.134116 220.85 241.69 1.003 r(C<->T){all} 0.182686 0.022926 0.000004 0.481845 0.148375 107.39 191.34 1.000 r(G<->T){all} 0.165920 0.018122 0.000004 0.427007 0.133609 238.67 249.37 1.000 pi(A){all} 0.158843 0.000153 0.132640 0.181802 0.158867 1319.30 1342.32 1.000 pi(C){all} 0.287905 0.000238 0.258293 0.317823 0.287503 1027.57 1142.46 1.000 pi(G){all} 0.308764 0.000249 0.277273 0.339178 0.308835 1156.24 1265.61 1.000 pi(T){all} 0.244487 0.000222 0.216045 0.274771 0.244279 1096.97 1134.20 1.000 alpha{1,2} 0.425112 0.220144 0.000180 1.374521 0.259582 1242.46 1243.19 1.000 alpha{3} 0.461816 0.247694 0.000259 1.448051 0.292578 1234.00 1306.59 1.002 pinvar{all} 0.998264 0.000004 0.994559 1.000000 0.998898 943.49 1021.42 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1118.581586 Model 2: PositiveSelection -1118.581483 Model 0: one-ratio -1118.581483 Model 7: beta -1118.581483 Model 8: beta&w>1 -1118.581642 Model 0 vs 1 2.0600000016202102E-4 Model 2 vs 1 2.0600000016202102E-4 Model 8 vs 7 3.1800000033399556E-4
>C1 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C2 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C3 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C4 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C5 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C6 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=289 C1 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C2 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C3 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C4 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C5 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C6 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL ************************************************** C1 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C2 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C3 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C4 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C5 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C6 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL ************************************************** C1 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C2 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C3 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C4 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C5 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C6 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE ************************************************** C1 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C2 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C3 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C4 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C5 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C6 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY ************************************************** C1 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C2 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C3 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C4 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C5 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C6 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV ************************************************** C1 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C2 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C3 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C4 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C5 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C6 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV *************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] Relaxation Summary: [8670]--->[8670] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.504 Mb, Max= 30.849 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C2 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C3 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C4 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C5 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL C6 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL ************************************************** C1 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C2 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C3 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C4 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C5 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL C6 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL ************************************************** C1 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C2 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C3 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C4 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C5 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE C6 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE ************************************************** C1 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C2 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C3 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C4 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C5 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY C6 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY ************************************************** C1 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C2 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C3 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C4 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C5 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV C6 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV ************************************************** C1 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C2 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C3 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C4 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C5 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV C6 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV *************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA C2 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA C3 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA C4 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA C5 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA C6 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA ************************************************** C1 TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC C2 TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC C3 TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC C4 TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC C5 TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC C6 TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC ************************************************** C1 AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG C2 AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG C3 AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG C4 AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG C5 AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG C6 AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG ************************************************** C1 AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG C2 AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG C3 AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG C4 AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG C5 AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG C6 AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG ************************************************** C1 TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG C2 TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG C3 TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG C4 TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG C5 TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG C6 TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG ************************************************** C1 TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG C2 TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG C3 TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG C4 TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG C5 TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG C6 TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG ************************************************** C1 GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA C2 GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA C3 GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA C4 GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA C5 GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA C6 GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA ************************************************** C1 CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG C2 CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG C3 CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG C4 CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG C5 CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG C6 CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG ************************************************** C1 TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG C2 TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG C3 TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG C4 TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG C5 TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG C6 TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ************************************************** C1 ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC C2 ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC C3 ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC C4 ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC C5 ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC C6 ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC ************************************************** C1 TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG C2 TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG C3 TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG C4 TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG C5 TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG C6 TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG ************************************************** C1 CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC C2 CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC C3 CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC C4 CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC C5 CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC C6 CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC ************************************************** C1 GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC C2 GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC C3 GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC C4 GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC C5 GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC C6 GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC ************************************************** C1 CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG C2 CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG C3 CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG C4 CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG C5 CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG C6 CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG ************************************************** C1 TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC C2 TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC C3 TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC C4 TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC C5 TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC C6 TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC ************************************************** C1 GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT C2 GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT C3 GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT C4 GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT C5 GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT C6 GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT ************************************************** C1 GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA C2 GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA C3 GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA C4 GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA C5 GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA C6 GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ************************************************** C1 ACTTCGCTTTGACGGTA C2 ACTTCGCTTTGACGGTA C3 ACTTCGCTTTGACGGTA C4 ACTTCGCTTTGACGGTA C5 ACTTCGCTTTGACGGTA C6 ACTTCGCTTTGACGGTA ***************** >C1 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >C2 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >C3 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >C4 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >C5 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >C6 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >C1 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C2 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C3 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C4 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C5 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >C6 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 867 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791891 Setting output file names to "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 991016124 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0082402755 Seed = 1283066530 Swapseed = 1579791891 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1940.387560 -- -24.965149 Chain 2 -- -1940.387560 -- -24.965149 Chain 3 -- -1940.387447 -- -24.965149 Chain 4 -- -1940.387560 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1940.387560 -- -24.965149 Chain 2 -- -1940.387560 -- -24.965149 Chain 3 -- -1940.387447 -- -24.965149 Chain 4 -- -1940.387560 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1940.388] (-1940.388) (-1940.387) (-1940.388) * [-1940.388] (-1940.388) (-1940.387) (-1940.388) 500 -- (-1191.898) [-1201.395] (-1198.135) (-1190.520) * (-1203.951) (-1197.198) [-1185.294] (-1209.845) -- 0:00:00 1000 -- (-1184.677) (-1200.047) (-1188.644) [-1182.716] * (-1188.597) [-1191.555] (-1189.864) (-1187.977) -- 0:00:00 1500 -- (-1185.158) (-1183.515) [-1189.562] (-1188.531) * (-1187.573) [-1186.338] (-1183.521) (-1188.914) -- 0:00:00 2000 -- (-1186.642) [-1186.730] (-1189.337) (-1183.615) * [-1190.474] (-1191.332) (-1188.348) (-1187.953) -- 0:00:00 2500 -- [-1189.784] (-1188.226) (-1188.968) (-1190.843) * (-1183.067) (-1189.844) (-1182.025) [-1188.553] -- 0:00:00 3000 -- (-1187.675) (-1185.970) [-1190.756] (-1190.083) * (-1195.905) (-1192.154) [-1189.198] (-1193.370) -- 0:00:00 3500 -- (-1188.186) (-1185.400) (-1185.051) [-1186.153] * (-1188.152) (-1192.171) (-1185.013) [-1192.218] -- 0:00:00 4000 -- (-1190.710) [-1185.587] (-1189.771) (-1192.714) * (-1193.645) (-1187.825) (-1194.167) [-1186.751] -- 0:00:00 4500 -- (-1189.750) (-1189.701) [-1184.848] (-1197.023) * (-1200.742) [-1186.371] (-1186.977) (-1186.630) -- 0:00:00 5000 -- (-1189.049) (-1184.304) (-1192.059) [-1191.895] * (-1187.918) (-1189.140) [-1191.606] (-1187.932) -- 0:00:00 Average standard deviation of split frequencies: 0.114280 5500 -- (-1187.723) (-1195.697) [-1184.808] (-1188.535) * (-1188.854) (-1193.317) (-1186.459) [-1188.909] -- 0:00:00 6000 -- (-1189.616) [-1184.533] (-1190.311) (-1193.607) * [-1190.553] (-1191.383) (-1182.602) (-1194.209) -- 0:00:00 6500 -- [-1188.135] (-1186.629) (-1187.949) (-1189.879) * [-1183.599] (-1184.492) (-1189.071) (-1185.880) -- 0:00:00 7000 -- (-1198.571) (-1189.670) (-1194.914) [-1190.163] * [-1190.351] (-1190.587) (-1194.384) (-1184.451) -- 0:00:00 7500 -- [-1184.732] (-1191.704) (-1185.524) (-1185.686) * (-1184.866) (-1184.389) [-1190.782] (-1190.399) -- 0:00:00 8000 -- (-1194.869) (-1179.958) [-1183.335] (-1195.838) * (-1195.480) [-1190.059] (-1187.271) (-1199.353) -- 0:00:00 8500 -- (-1193.743) [-1178.041] (-1192.963) (-1187.300) * (-1193.937) (-1189.056) [-1188.851] (-1186.726) -- 0:00:00 9000 -- (-1182.326) [-1183.227] (-1186.975) (-1183.549) * (-1186.119) (-1186.551) [-1189.144] (-1192.336) -- 0:00:00 9500 -- (-1189.046) [-1177.464] (-1187.517) (-1193.426) * (-1194.151) (-1186.703) [-1186.817] (-1191.753) -- 0:00:00 10000 -- (-1185.142) [-1180.928] (-1185.098) (-1184.003) * (-1192.261) (-1187.630) (-1188.165) [-1186.217] -- 0:00:00 Average standard deviation of split frequencies: 0.058150 10500 -- (-1187.685) [-1185.074] (-1191.812) (-1191.855) * [-1187.383] (-1193.000) (-1183.815) (-1187.209) -- 0:00:00 11000 -- [-1184.415] (-1179.718) (-1195.710) (-1189.530) * (-1197.186) (-1194.347) (-1192.247) [-1187.157] -- 0:01:29 11500 -- (-1185.230) [-1178.465] (-1186.710) (-1192.055) * [-1184.980] (-1195.633) (-1185.647) (-1184.454) -- 0:01:25 12000 -- [-1183.423] (-1179.487) (-1196.143) (-1196.915) * (-1189.830) [-1190.474] (-1190.260) (-1191.117) -- 0:01:22 12500 -- (-1185.571) (-1179.712) (-1187.236) [-1190.475] * (-1188.952) (-1191.534) [-1191.057] (-1190.719) -- 0:01:19 13000 -- (-1185.946) (-1178.915) [-1192.435] (-1188.453) * [-1186.458] (-1191.054) (-1183.683) (-1192.013) -- 0:01:15 13500 -- (-1193.361) (-1178.700) [-1187.310] (-1188.866) * (-1187.878) (-1186.505) (-1195.873) [-1187.600] -- 0:01:13 14000 -- (-1185.940) (-1178.124) (-1187.849) [-1180.418] * (-1192.436) (-1182.064) (-1197.391) [-1183.787] -- 0:01:10 14500 -- (-1188.476) (-1178.683) (-1191.345) [-1189.271] * (-1196.861) (-1195.378) (-1186.864) [-1184.564] -- 0:01:07 15000 -- [-1186.368] (-1178.755) (-1188.925) (-1184.401) * (-1187.292) (-1190.104) [-1186.482] (-1189.007) -- 0:01:05 Average standard deviation of split frequencies: 0.048614 15500 -- (-1184.777) (-1180.426) [-1186.938] (-1193.633) * (-1192.126) (-1186.850) [-1189.956] (-1190.894) -- 0:01:03 16000 -- [-1187.824] (-1178.259) (-1186.938) (-1187.498) * (-1194.508) [-1187.959] (-1198.548) (-1185.260) -- 0:01:01 16500 -- (-1195.773) (-1177.491) (-1192.992) [-1186.144] * (-1191.172) (-1196.016) [-1186.763] (-1188.371) -- 0:00:59 17000 -- (-1202.932) (-1179.374) [-1190.618] (-1190.657) * (-1196.260) (-1201.388) [-1181.262] (-1186.534) -- 0:00:57 17500 -- (-1190.798) (-1181.701) (-1188.514) [-1185.905] * (-1187.121) (-1184.096) (-1181.736) [-1192.197] -- 0:00:56 18000 -- [-1186.627] (-1180.752) (-1187.711) (-1188.812) * (-1187.069) (-1182.708) [-1179.436] (-1192.712) -- 0:00:54 18500 -- [-1187.875] (-1177.711) (-1195.071) (-1183.326) * (-1194.023) [-1180.576] (-1179.270) (-1187.369) -- 0:00:53 19000 -- [-1183.753] (-1181.013) (-1189.793) (-1185.484) * [-1188.724] (-1180.504) (-1177.924) (-1191.906) -- 0:00:51 19500 -- [-1194.993] (-1179.965) (-1190.545) (-1185.615) * (-1189.148) [-1178.447] (-1183.644) (-1198.196) -- 0:00:50 20000 -- (-1190.687) (-1177.584) [-1189.192] (-1189.494) * [-1188.817] (-1182.787) (-1179.407) (-1193.636) -- 0:00:49 Average standard deviation of split frequencies: 0.034815 20500 -- (-1197.163) [-1177.650] (-1189.599) (-1188.963) * (-1183.244) (-1179.516) [-1181.688] (-1190.929) -- 0:00:47 21000 -- [-1187.947] (-1178.382) (-1192.578) (-1186.434) * (-1179.850) (-1178.154) (-1180.207) [-1188.400] -- 0:00:46 21500 -- (-1191.196) [-1178.330] (-1189.371) (-1188.727) * (-1181.252) (-1177.929) (-1180.488) [-1191.679] -- 0:00:45 22000 -- (-1186.522) [-1179.008] (-1191.022) (-1190.818) * (-1179.760) (-1178.913) (-1183.150) [-1186.905] -- 0:00:44 22500 -- (-1191.576) (-1178.604) (-1194.682) [-1187.821] * (-1179.969) [-1178.471] (-1178.398) (-1197.333) -- 0:00:43 23000 -- (-1185.934) [-1178.089] (-1190.154) (-1193.112) * (-1181.612) (-1177.854) [-1178.120] (-1192.090) -- 0:00:42 23500 -- (-1185.996) (-1179.432) [-1191.273] (-1195.743) * (-1182.863) [-1178.314] (-1182.991) (-1190.202) -- 0:00:41 24000 -- [-1187.328] (-1178.463) (-1193.806) (-1198.204) * (-1182.258) (-1178.590) [-1180.668] (-1181.222) -- 0:00:40 24500 -- (-1182.813) (-1179.342) [-1184.413] (-1192.598) * (-1181.757) (-1180.617) (-1178.500) [-1178.377] -- 0:00:39 25000 -- (-1190.202) (-1181.880) [-1183.450] (-1192.678) * (-1183.564) [-1177.884] (-1180.218) (-1179.641) -- 0:01:18 Average standard deviation of split frequencies: 0.035438 25500 -- (-1186.745) (-1180.343) [-1187.480] (-1209.866) * (-1180.562) [-1178.666] (-1180.689) (-1178.812) -- 0:01:16 26000 -- [-1191.694] (-1178.018) (-1190.962) (-1188.300) * [-1178.477] (-1177.866) (-1183.507) (-1177.893) -- 0:01:14 26500 -- [-1182.984] (-1178.404) (-1193.369) (-1180.194) * (-1183.631) (-1180.717) [-1180.471] (-1182.582) -- 0:01:13 27000 -- (-1187.965) (-1178.555) (-1187.927) [-1178.207] * [-1178.750] (-1179.820) (-1179.636) (-1179.584) -- 0:01:12 27500 -- (-1189.395) [-1178.725] (-1194.630) (-1178.470) * (-1178.762) (-1178.660) [-1178.576] (-1183.833) -- 0:01:10 28000 -- (-1181.604) [-1177.243] (-1194.578) (-1178.306) * (-1181.228) (-1178.239) [-1179.721] (-1183.109) -- 0:01:09 28500 -- (-1185.514) [-1177.848] (-1190.987) (-1179.486) * [-1178.698] (-1178.392) (-1178.359) (-1181.117) -- 0:01:08 29000 -- (-1197.724) [-1179.052] (-1192.790) (-1178.182) * (-1178.375) (-1178.469) (-1180.676) [-1179.371] -- 0:01:06 29500 -- (-1191.804) [-1178.617] (-1181.749) (-1177.510) * [-1178.392] (-1180.094) (-1179.628) (-1182.665) -- 0:01:05 30000 -- (-1187.031) [-1179.614] (-1189.793) (-1184.078) * (-1178.724) [-1177.796] (-1179.519) (-1179.875) -- 0:01:04 Average standard deviation of split frequencies: 0.037332 30500 -- (-1198.805) (-1179.070) (-1191.626) [-1180.680] * (-1183.618) [-1178.686] (-1179.437) (-1180.031) -- 0:01:03 31000 -- (-1179.419) [-1179.550] (-1196.250) (-1181.202) * (-1179.887) [-1179.474] (-1177.659) (-1185.777) -- 0:01:02 31500 -- (-1181.927) (-1185.807) [-1185.584] (-1179.855) * (-1180.247) [-1178.714] (-1178.217) (-1181.268) -- 0:01:01 32000 -- (-1178.718) (-1185.352) (-1187.105) [-1178.472] * (-1179.185) [-1179.845] (-1181.468) (-1180.463) -- 0:01:00 32500 -- [-1177.830] (-1179.165) (-1205.399) (-1180.011) * (-1178.125) [-1180.027] (-1181.055) (-1180.179) -- 0:00:59 33000 -- [-1178.071] (-1179.397) (-1185.770) (-1179.181) * (-1181.868) (-1179.152) [-1177.239] (-1180.745) -- 0:00:58 33500 -- (-1177.938) (-1180.954) [-1184.321] (-1180.472) * (-1179.565) [-1181.500] (-1177.023) (-1183.821) -- 0:00:57 34000 -- (-1177.347) (-1179.157) (-1197.285) [-1180.083] * (-1180.954) (-1179.471) (-1177.812) [-1180.453] -- 0:00:56 34500 -- (-1178.163) (-1178.632) [-1187.417] (-1178.912) * (-1180.673) (-1179.518) [-1177.176] (-1183.200) -- 0:00:55 35000 -- [-1177.137] (-1182.199) (-1195.440) (-1178.946) * [-1178.435] (-1181.507) (-1177.423) (-1182.050) -- 0:00:55 Average standard deviation of split frequencies: 0.034295 35500 -- [-1186.451] (-1179.780) (-1181.773) (-1178.571) * (-1179.528) [-1180.396] (-1180.368) (-1183.199) -- 0:00:54 36000 -- (-1180.601) [-1179.977] (-1181.501) (-1178.808) * [-1178.739] (-1178.457) (-1180.033) (-1179.430) -- 0:00:53 36500 -- (-1179.530) [-1180.082] (-1179.864) (-1178.676) * (-1178.106) (-1177.902) [-1179.738] (-1178.333) -- 0:00:52 37000 -- (-1179.203) [-1182.781] (-1180.550) (-1180.319) * (-1178.332) (-1178.653) (-1181.197) [-1182.297] -- 0:00:52 37500 -- [-1179.377] (-1179.724) (-1179.167) (-1178.925) * [-1179.386] (-1178.244) (-1179.741) (-1177.532) -- 0:00:51 38000 -- (-1179.217) [-1178.668] (-1183.151) (-1178.275) * (-1180.792) [-1178.296] (-1179.530) (-1178.026) -- 0:00:50 38500 -- [-1180.312] (-1177.964) (-1181.449) (-1179.293) * (-1184.531) (-1177.963) (-1179.214) [-1177.948] -- 0:00:49 39000 -- (-1181.947) (-1178.193) [-1181.537] (-1177.848) * (-1180.239) (-1178.390) [-1178.919] (-1177.488) -- 0:00:49 39500 -- (-1178.065) [-1180.828] (-1177.530) (-1179.723) * [-1180.099] (-1178.851) (-1182.465) (-1178.682) -- 0:00:48 40000 -- (-1180.038) (-1182.385) (-1179.064) [-1177.334] * (-1179.354) [-1180.358] (-1179.088) (-1179.635) -- 0:00:48 Average standard deviation of split frequencies: 0.037826 40500 -- [-1179.149] (-1179.832) (-1179.410) (-1176.959) * (-1179.870) [-1180.453] (-1178.420) (-1180.895) -- 0:01:11 41000 -- [-1179.059] (-1178.133) (-1179.693) (-1177.851) * (-1179.954) (-1180.153) (-1180.933) [-1179.873] -- 0:01:10 41500 -- (-1177.311) (-1177.307) [-1180.507] (-1177.999) * (-1180.135) (-1178.439) [-1178.964] (-1180.368) -- 0:01:09 42000 -- [-1181.405] (-1178.847) (-1182.203) (-1179.275) * (-1180.169) [-1178.072] (-1181.576) (-1178.719) -- 0:01:08 42500 -- (-1181.444) (-1179.616) [-1183.432] (-1178.585) * (-1179.721) (-1182.835) (-1181.014) [-1180.008] -- 0:01:07 43000 -- (-1183.288) (-1182.763) (-1178.569) [-1179.968] * (-1180.900) (-1179.184) (-1185.373) [-1177.227] -- 0:01:06 43500 -- (-1181.120) (-1179.538) [-1177.947] (-1178.826) * (-1180.927) (-1179.581) [-1177.256] (-1177.229) -- 0:01:05 44000 -- (-1181.120) (-1180.987) (-1180.143) [-1180.243] * (-1179.979) (-1178.344) [-1180.299] (-1182.219) -- 0:01:05 44500 -- (-1180.251) (-1177.659) [-1178.676] (-1180.281) * (-1178.824) [-1178.025] (-1178.561) (-1178.269) -- 0:01:04 45000 -- [-1177.738] (-1181.162) (-1179.913) (-1179.901) * (-1179.525) [-1181.192] (-1177.368) (-1179.875) -- 0:01:03 Average standard deviation of split frequencies: 0.038197 45500 -- (-1178.118) [-1182.426] (-1177.922) (-1178.922) * [-1183.220] (-1181.162) (-1178.171) (-1179.461) -- 0:01:02 46000 -- (-1179.994) (-1179.198) (-1177.891) [-1179.496] * (-1180.947) (-1181.243) [-1177.076] (-1180.667) -- 0:01:02 46500 -- [-1180.909] (-1180.772) (-1178.701) (-1179.591) * (-1178.098) (-1180.194) [-1177.766] (-1181.138) -- 0:01:01 47000 -- (-1183.313) (-1178.989) [-1177.577] (-1177.782) * (-1180.474) (-1187.979) (-1177.382) [-1181.571] -- 0:01:00 47500 -- [-1181.169] (-1180.609) (-1178.482) (-1181.243) * (-1178.890) [-1187.550] (-1178.172) (-1180.058) -- 0:01:00 48000 -- (-1181.729) [-1179.295] (-1178.128) (-1177.350) * (-1182.952) (-1181.977) (-1182.653) [-1179.049] -- 0:00:59 48500 -- (-1179.839) (-1180.237) [-1179.856] (-1177.243) * (-1182.090) [-1179.431] (-1182.456) (-1178.657) -- 0:00:58 49000 -- (-1179.892) (-1180.865) (-1183.237) [-1178.444] * (-1182.706) (-1179.655) (-1183.442) [-1178.672] -- 0:00:58 49500 -- (-1178.176) [-1180.079] (-1179.774) (-1180.789) * [-1179.865] (-1181.045) (-1178.175) (-1180.269) -- 0:00:57 50000 -- (-1177.952) [-1179.899] (-1177.647) (-1180.236) * [-1179.769] (-1180.181) (-1177.887) (-1179.951) -- 0:00:57 Average standard deviation of split frequencies: 0.040317 50500 -- (-1177.940) [-1180.839] (-1177.643) (-1178.143) * (-1178.801) [-1179.565] (-1177.384) (-1180.027) -- 0:00:56 51000 -- [-1177.618] (-1181.091) (-1177.597) (-1179.083) * (-1182.993) [-1179.644] (-1180.257) (-1181.522) -- 0:00:55 51500 -- (-1177.309) [-1180.556] (-1177.839) (-1178.564) * (-1179.985) [-1178.575] (-1180.971) (-1178.354) -- 0:00:55 52000 -- [-1186.149] (-1181.475) (-1178.209) (-1179.229) * (-1179.742) (-1181.886) (-1179.806) [-1177.846] -- 0:00:54 52500 -- (-1180.654) [-1177.994] (-1177.708) (-1180.252) * (-1179.645) [-1181.730] (-1179.308) (-1178.656) -- 0:00:54 53000 -- [-1179.894] (-1180.283) (-1179.235) (-1178.687) * (-1181.731) (-1181.812) [-1179.000] (-1181.681) -- 0:00:53 53500 -- (-1180.387) [-1177.610] (-1180.227) (-1178.457) * (-1178.138) [-1179.111] (-1180.069) (-1178.730) -- 0:00:53 54000 -- [-1178.365] (-1179.049) (-1182.422) (-1179.272) * (-1177.839) (-1183.961) (-1179.594) [-1180.417] -- 0:01:10 54500 -- (-1178.138) [-1177.950] (-1180.611) (-1179.745) * [-1178.076] (-1178.796) (-1180.218) (-1182.828) -- 0:01:09 55000 -- [-1178.726] (-1179.809) (-1180.363) (-1181.799) * [-1177.933] (-1178.417) (-1178.619) (-1181.445) -- 0:01:08 Average standard deviation of split frequencies: 0.037680 55500 -- (-1178.819) (-1179.436) (-1181.867) [-1178.524] * (-1179.115) (-1177.678) (-1178.028) [-1183.056] -- 0:01:08 56000 -- (-1177.895) (-1178.718) (-1180.123) [-1179.594] * (-1178.053) [-1179.451] (-1180.343) (-1180.549) -- 0:01:07 56500 -- (-1178.649) (-1181.506) [-1179.408] (-1180.873) * (-1178.091) (-1183.355) (-1179.526) [-1178.143] -- 0:01:06 57000 -- [-1179.336] (-1178.513) (-1182.489) (-1177.633) * (-1186.128) (-1180.468) (-1178.423) [-1178.077] -- 0:01:06 57500 -- (-1179.472) [-1178.584] (-1184.067) (-1178.387) * (-1178.203) (-1178.343) [-1178.403] (-1179.411) -- 0:01:05 58000 -- (-1179.949) [-1180.102] (-1181.495) (-1178.406) * (-1178.632) (-1180.781) [-1177.564] (-1179.933) -- 0:01:04 58500 -- [-1179.933] (-1178.451) (-1182.101) (-1178.110) * (-1179.246) (-1178.782) (-1177.173) [-1179.185] -- 0:01:04 59000 -- (-1179.763) (-1177.855) (-1181.638) [-1177.615] * (-1185.941) (-1177.587) [-1178.107] (-1178.284) -- 0:01:03 59500 -- (-1181.549) [-1177.458] (-1180.170) (-1181.391) * (-1180.972) (-1179.042) [-1181.130] (-1178.336) -- 0:01:03 60000 -- (-1179.142) (-1179.412) (-1179.458) [-1181.477] * (-1183.420) (-1180.617) (-1178.646) [-1179.681] -- 0:01:02 Average standard deviation of split frequencies: 0.034190 60500 -- (-1178.821) (-1177.847) (-1184.559) [-1177.971] * [-1177.437] (-1179.651) (-1179.169) (-1179.703) -- 0:01:02 61000 -- [-1180.498] (-1177.894) (-1185.284) (-1179.752) * (-1177.359) [-1179.685] (-1178.864) (-1181.392) -- 0:01:01 61500 -- (-1181.577) [-1177.704] (-1180.051) (-1177.381) * (-1178.460) (-1181.199) [-1180.734] (-1181.995) -- 0:01:01 62000 -- [-1179.388] (-1178.477) (-1180.156) (-1177.645) * (-1178.831) (-1185.840) (-1180.661) [-1181.647] -- 0:01:00 62500 -- (-1179.020) [-1178.628] (-1179.654) (-1178.619) * (-1179.170) (-1179.776) (-1178.696) [-1180.255] -- 0:01:00 63000 -- [-1178.755] (-1177.314) (-1178.875) (-1181.887) * (-1178.375) (-1180.903) [-1178.927] (-1177.790) -- 0:00:59 63500 -- (-1178.967) (-1178.228) [-1179.265] (-1181.931) * (-1178.360) (-1184.527) [-1181.813] (-1177.742) -- 0:00:58 64000 -- [-1188.323] (-1178.229) (-1178.827) (-1180.960) * [-1179.448] (-1180.828) (-1178.743) (-1178.936) -- 0:00:58 64500 -- (-1181.561) (-1178.657) (-1179.781) [-1178.834] * (-1179.056) (-1182.752) [-1179.842] (-1180.103) -- 0:00:58 65000 -- (-1183.757) (-1177.906) [-1179.607] (-1178.414) * [-1177.312] (-1179.376) (-1181.007) (-1177.760) -- 0:00:57 Average standard deviation of split frequencies: 0.027499 65500 -- (-1189.299) (-1179.363) [-1183.324] (-1178.418) * (-1177.425) [-1180.656] (-1179.913) (-1177.502) -- 0:00:57 66000 -- (-1189.749) (-1180.364) (-1178.769) [-1179.580] * (-1179.441) (-1180.488) [-1179.716] (-1178.870) -- 0:00:56 66500 -- (-1181.569) (-1179.360) [-1178.738] (-1179.840) * (-1182.052) (-1177.935) [-1179.687] (-1180.164) -- 0:00:56 67000 -- (-1180.441) (-1177.104) (-1179.578) [-1181.273] * (-1180.793) (-1180.317) [-1182.223] (-1179.590) -- 0:00:55 67500 -- (-1179.924) (-1177.029) [-1181.367] (-1180.796) * [-1179.588] (-1179.134) (-1179.572) (-1179.714) -- 0:00:55 68000 -- (-1179.475) (-1177.794) [-1181.406] (-1180.101) * (-1179.458) (-1180.192) (-1180.765) [-1179.917] -- 0:01:08 68500 -- (-1178.458) (-1177.235) [-1180.493] (-1177.257) * [-1179.347] (-1179.730) (-1186.060) (-1178.544) -- 0:01:07 69000 -- [-1178.238] (-1177.466) (-1183.290) (-1178.970) * (-1181.749) (-1180.980) [-1182.268] (-1178.582) -- 0:01:07 69500 -- (-1178.194) (-1177.587) (-1180.376) [-1179.298] * (-1180.165) (-1177.381) [-1181.211] (-1178.748) -- 0:01:06 70000 -- (-1185.935) (-1178.870) (-1179.922) [-1177.857] * [-1179.375] (-1178.815) (-1178.619) (-1179.170) -- 0:01:06 Average standard deviation of split frequencies: 0.027350 70500 -- (-1179.242) (-1177.696) (-1177.641) [-1180.209] * (-1179.247) [-1177.716] (-1178.755) (-1179.527) -- 0:01:05 71000 -- (-1179.336) (-1177.226) [-1184.596] (-1180.111) * (-1180.973) [-1181.197] (-1178.800) (-1180.728) -- 0:01:05 71500 -- [-1181.263] (-1177.919) (-1181.457) (-1177.623) * (-1179.270) [-1178.706] (-1177.847) (-1179.133) -- 0:01:04 72000 -- [-1178.123] (-1177.426) (-1180.500) (-1181.304) * (-1178.509) (-1178.666) [-1177.563] (-1178.004) -- 0:01:04 72500 -- (-1178.195) (-1180.677) [-1178.777] (-1178.807) * (-1177.934) (-1184.430) (-1184.157) [-1179.029] -- 0:01:03 73000 -- [-1178.571] (-1178.598) (-1180.335) (-1180.431) * (-1177.526) [-1179.592] (-1181.627) (-1181.228) -- 0:01:03 73500 -- (-1178.171) (-1179.360) (-1181.456) [-1183.315] * (-1178.938) (-1180.069) [-1179.954] (-1179.422) -- 0:01:03 74000 -- (-1177.968) [-1178.536] (-1181.722) (-1179.924) * [-1178.994] (-1179.931) (-1180.946) (-1178.917) -- 0:01:02 74500 -- [-1177.852] (-1179.017) (-1184.681) (-1180.309) * (-1178.490) (-1182.877) [-1179.109] (-1178.061) -- 0:01:02 75000 -- (-1178.113) [-1179.202] (-1179.876) (-1180.085) * [-1180.244] (-1177.669) (-1186.432) (-1180.843) -- 0:01:01 Average standard deviation of split frequencies: 0.033299 75500 -- [-1178.497] (-1178.152) (-1178.464) (-1180.712) * (-1178.628) [-1177.588] (-1183.960) (-1177.729) -- 0:01:01 76000 -- (-1178.588) [-1178.357] (-1178.354) (-1180.285) * (-1178.521) (-1180.348) [-1179.753] (-1177.519) -- 0:01:00 76500 -- (-1180.811) (-1180.492) [-1177.570] (-1178.008) * [-1177.638] (-1181.984) (-1178.942) (-1177.428) -- 0:01:00 77000 -- [-1179.472] (-1179.992) (-1178.166) (-1178.400) * [-1179.940] (-1181.249) (-1177.860) (-1178.797) -- 0:00:59 77500 -- (-1178.903) (-1177.971) [-1177.663] (-1177.699) * (-1179.700) (-1178.871) (-1178.908) [-1179.136] -- 0:00:59 78000 -- [-1177.544] (-1178.057) (-1178.522) (-1178.238) * (-1178.191) [-1178.880] (-1179.358) (-1184.171) -- 0:00:59 78500 -- [-1177.644] (-1178.181) (-1179.763) (-1178.237) * (-1177.986) [-1178.214] (-1180.593) (-1179.099) -- 0:00:58 79000 -- [-1178.452] (-1179.260) (-1179.574) (-1178.637) * (-1179.967) [-1178.053] (-1181.220) (-1179.917) -- 0:00:58 79500 -- (-1177.458) (-1180.184) [-1179.534] (-1180.311) * (-1180.231) [-1179.180] (-1177.706) (-1178.387) -- 0:00:57 80000 -- (-1178.382) [-1181.433] (-1178.130) (-1178.631) * (-1183.557) (-1178.596) (-1178.015) [-1178.014] -- 0:00:57 Average standard deviation of split frequencies: 0.028912 80500 -- [-1177.526] (-1180.040) (-1178.822) (-1178.343) * (-1178.204) [-1177.925] (-1179.290) (-1179.505) -- 0:00:57 81000 -- (-1178.487) (-1181.194) [-1180.134] (-1178.243) * (-1183.760) (-1177.788) (-1178.741) [-1178.442] -- 0:00:56 81500 -- (-1178.644) (-1180.265) [-1179.150] (-1182.413) * (-1180.264) (-1182.435) (-1179.076) [-1178.327] -- 0:00:56 82000 -- (-1178.854) (-1179.287) (-1180.803) [-1178.414] * (-1178.997) [-1181.103] (-1178.323) (-1178.534) -- 0:00:55 82500 -- (-1178.104) (-1180.456) (-1178.819) [-1178.450] * (-1188.901) (-1180.100) [-1177.874] (-1181.007) -- 0:01:06 83000 -- [-1177.103] (-1178.359) (-1177.877) (-1179.675) * (-1179.691) (-1181.860) (-1179.451) [-1179.801] -- 0:01:06 83500 -- (-1177.597) [-1177.978] (-1182.891) (-1178.022) * [-1177.401] (-1180.438) (-1179.476) (-1180.179) -- 0:01:05 84000 -- (-1179.949) (-1178.863) (-1180.004) [-1178.022] * (-1177.434) (-1179.131) (-1179.393) [-1179.074] -- 0:01:05 84500 -- (-1183.855) (-1179.097) (-1180.413) [-1177.953] * (-1177.363) (-1184.057) (-1180.508) [-1178.871] -- 0:01:05 85000 -- (-1181.685) [-1179.941] (-1177.287) (-1179.047) * (-1178.314) (-1180.687) [-1178.031] (-1177.072) -- 0:01:04 Average standard deviation of split frequencies: 0.024536 85500 -- (-1179.784) [-1179.804] (-1178.249) (-1179.418) * (-1184.686) (-1184.119) (-1180.158) [-1178.716] -- 0:01:04 86000 -- (-1180.287) (-1180.899) [-1180.353] (-1178.201) * (-1183.916) (-1180.821) (-1179.085) [-1179.245] -- 0:01:03 86500 -- (-1178.777) (-1183.230) [-1180.517] (-1179.893) * (-1180.277) (-1178.882) (-1177.718) [-1178.510] -- 0:01:03 87000 -- [-1185.553] (-1179.509) (-1177.307) (-1177.801) * (-1182.893) (-1178.801) (-1179.271) [-1177.895] -- 0:01:02 87500 -- (-1183.445) [-1177.717] (-1177.212) (-1179.254) * (-1180.240) [-1179.927] (-1178.957) (-1177.846) -- 0:01:02 88000 -- (-1186.273) (-1184.397) (-1178.097) [-1182.322] * (-1180.022) [-1178.016] (-1182.413) (-1178.903) -- 0:01:02 88500 -- [-1182.047] (-1186.025) (-1185.364) (-1182.862) * (-1180.069) (-1177.482) (-1179.218) [-1180.555] -- 0:01:01 89000 -- (-1179.338) (-1180.903) (-1183.338) [-1183.055] * (-1180.595) [-1178.061] (-1178.740) (-1181.037) -- 0:01:01 89500 -- (-1179.720) (-1180.752) [-1182.344] (-1183.019) * (-1180.055) [-1177.807] (-1178.896) (-1176.947) -- 0:01:01 90000 -- (-1180.083) (-1179.914) [-1180.094] (-1183.594) * (-1179.531) [-1177.334] (-1180.286) (-1177.797) -- 0:01:00 Average standard deviation of split frequencies: 0.024437 90500 -- [-1177.399] (-1183.792) (-1180.570) (-1180.774) * (-1178.854) [-1177.265] (-1179.299) (-1181.952) -- 0:01:00 91000 -- (-1181.277) (-1179.179) (-1180.131) [-1182.107] * (-1181.556) (-1178.526) [-1178.215] (-1178.482) -- 0:00:59 91500 -- (-1178.235) (-1182.468) [-1178.797] (-1180.032) * (-1178.086) (-1179.398) [-1178.718] (-1179.187) -- 0:00:59 92000 -- (-1178.820) (-1180.409) [-1177.482] (-1182.923) * (-1182.242) [-1179.148] (-1178.684) (-1177.750) -- 0:00:59 92500 -- (-1180.883) (-1179.502) [-1177.377] (-1178.600) * (-1179.089) (-1180.031) [-1178.837] (-1177.632) -- 0:00:58 93000 -- (-1180.061) (-1178.849) [-1179.432] (-1178.825) * [-1179.006] (-1179.991) (-1183.287) (-1178.407) -- 0:00:58 93500 -- (-1181.756) (-1179.630) (-1179.222) [-1178.922] * (-1178.441) (-1178.127) [-1183.128] (-1180.471) -- 0:00:58 94000 -- (-1181.832) (-1179.318) [-1179.988] (-1179.127) * (-1178.420) (-1178.624) [-1181.765] (-1180.638) -- 0:00:57 94500 -- (-1178.169) (-1179.717) (-1178.593) [-1181.117] * (-1180.868) (-1177.567) [-1182.450] (-1192.382) -- 0:00:57 95000 -- (-1185.684) [-1178.225] (-1178.917) (-1179.748) * (-1180.784) (-1177.346) (-1178.412) [-1180.468] -- 0:00:57 Average standard deviation of split frequencies: 0.020676 95500 -- (-1184.197) (-1180.524) [-1179.722] (-1182.871) * [-1179.508] (-1177.506) (-1179.765) (-1178.345) -- 0:00:56 96000 -- (-1177.668) [-1178.968] (-1181.781) (-1182.116) * (-1179.763) [-1177.507] (-1179.442) (-1183.436) -- 0:00:56 96500 -- (-1177.537) (-1178.873) (-1180.586) [-1180.466] * (-1179.814) (-1179.560) (-1179.442) [-1179.050] -- 0:00:56 97000 -- (-1178.076) (-1180.857) (-1177.828) [-1178.079] * (-1179.015) [-1177.647] (-1182.625) (-1179.836) -- 0:01:05 97500 -- (-1179.755) [-1179.691] (-1177.215) (-1177.683) * (-1178.360) (-1177.387) (-1178.946) [-1178.828] -- 0:01:04 98000 -- [-1178.197] (-1177.735) (-1180.267) (-1184.242) * (-1180.643) (-1177.424) [-1177.803] (-1177.816) -- 0:01:04 98500 -- (-1177.822) (-1177.775) (-1178.439) [-1182.049] * (-1177.521) (-1177.531) (-1178.867) [-1177.224] -- 0:01:04 99000 -- (-1178.343) (-1179.720) (-1179.998) [-1182.279] * [-1177.932] (-1177.836) (-1181.312) (-1177.222) -- 0:01:03 99500 -- [-1178.324] (-1182.093) (-1179.298) (-1178.896) * (-1181.120) [-1177.887] (-1181.902) (-1177.301) -- 0:01:03 100000 -- [-1178.306] (-1181.879) (-1178.503) (-1178.983) * (-1178.886) (-1177.399) (-1179.780) [-1179.450] -- 0:01:02 Average standard deviation of split frequencies: 0.020032 100500 -- (-1180.117) [-1182.896] (-1180.087) (-1179.157) * [-1178.262] (-1177.434) (-1181.757) (-1178.670) -- 0:01:02 101000 -- [-1177.966] (-1179.750) (-1179.770) (-1177.930) * (-1178.405) [-1178.960] (-1180.344) (-1178.426) -- 0:01:02 101500 -- (-1177.731) (-1180.063) [-1177.108] (-1178.034) * (-1177.429) (-1177.643) (-1179.536) [-1177.863] -- 0:01:01 102000 -- [-1177.616] (-1179.682) (-1179.552) (-1177.609) * (-1180.186) [-1182.160] (-1180.650) (-1179.349) -- 0:01:01 102500 -- (-1178.152) (-1177.945) (-1180.098) [-1177.595] * (-1180.255) (-1179.549) (-1183.393) [-1178.720] -- 0:01:01 103000 -- [-1181.140] (-1178.612) (-1180.565) (-1179.921) * (-1178.517) (-1179.201) [-1178.984] (-1178.308) -- 0:01:00 103500 -- (-1179.678) (-1178.529) (-1181.475) [-1178.026] * (-1179.946) (-1179.086) [-1179.717] (-1179.617) -- 0:01:00 104000 -- [-1180.601] (-1178.020) (-1181.817) (-1178.882) * (-1178.736) [-1179.284] (-1178.900) (-1180.420) -- 0:01:00 104500 -- (-1178.487) [-1177.966] (-1179.470) (-1178.728) * (-1183.466) [-1179.159] (-1180.382) (-1181.312) -- 0:00:59 105000 -- (-1177.795) (-1178.918) (-1178.824) [-1180.014] * (-1180.814) (-1180.370) [-1180.431] (-1178.701) -- 0:00:59 Average standard deviation of split frequencies: 0.018777 105500 -- (-1178.160) (-1178.536) (-1177.746) [-1179.587] * [-1178.481] (-1177.711) (-1180.337) (-1179.032) -- 0:00:59 106000 -- (-1179.899) (-1184.471) (-1179.321) [-1177.770] * [-1180.985] (-1180.784) (-1178.221) (-1177.251) -- 0:00:59 106500 -- (-1178.776) [-1178.968] (-1177.368) (-1178.646) * [-1179.202] (-1180.680) (-1180.289) (-1180.014) -- 0:00:58 107000 -- (-1179.128) (-1178.765) (-1178.837) [-1178.465] * (-1180.185) [-1178.218] (-1178.663) (-1180.509) -- 0:00:58 107500 -- (-1179.890) (-1181.642) [-1179.008] (-1179.305) * (-1179.537) (-1178.449) [-1178.819] (-1179.916) -- 0:00:58 108000 -- (-1180.332) [-1181.030] (-1180.397) (-1178.270) * (-1179.417) (-1182.525) (-1178.076) [-1180.200] -- 0:00:57 108500 -- (-1178.943) (-1180.747) (-1181.954) [-1178.683] * (-1178.387) [-1182.019] (-1178.975) (-1178.698) -- 0:00:57 109000 -- (-1179.374) [-1177.712] (-1182.494) (-1179.289) * (-1178.353) (-1178.361) [-1178.117] (-1177.843) -- 0:00:57 109500 -- (-1178.464) (-1178.859) [-1181.851] (-1179.247) * [-1180.419] (-1177.682) (-1178.234) (-1177.487) -- 0:00:56 110000 -- (-1178.900) (-1180.424) [-1182.189] (-1177.956) * (-1182.828) (-1178.260) [-1180.760] (-1178.844) -- 0:00:56 Average standard deviation of split frequencies: 0.017985 110500 -- [-1177.694] (-1179.016) (-1182.135) (-1178.184) * (-1184.519) [-1180.056] (-1181.404) (-1178.122) -- 0:01:04 111000 -- (-1178.340) (-1177.807) [-1179.049] (-1178.151) * [-1180.184] (-1181.079) (-1179.770) (-1180.117) -- 0:01:04 111500 -- (-1179.409) [-1179.946] (-1183.108) (-1178.874) * (-1179.740) (-1178.739) (-1181.464) [-1180.445] -- 0:01:03 112000 -- (-1179.184) (-1181.043) (-1182.944) [-1180.733] * (-1183.165) [-1178.578] (-1177.749) (-1181.520) -- 0:01:03 112500 -- (-1178.853) (-1183.294) (-1179.825) [-1179.765] * (-1187.275) [-1180.369] (-1179.903) (-1181.172) -- 0:01:03 113000 -- [-1178.338] (-1184.661) (-1181.658) (-1182.503) * (-1177.386) [-1179.430] (-1183.450) (-1179.371) -- 0:01:02 113500 -- (-1178.410) (-1184.651) (-1180.144) [-1184.468] * (-1177.216) [-1178.104] (-1179.273) (-1184.994) -- 0:01:02 114000 -- (-1181.514) (-1179.399) (-1182.138) [-1183.770] * [-1177.301] (-1177.744) (-1177.398) (-1181.913) -- 0:01:02 114500 -- [-1179.263] (-1178.141) (-1185.293) (-1180.845) * (-1177.531) [-1177.684] (-1179.703) (-1180.249) -- 0:01:01 115000 -- (-1178.238) (-1178.822) [-1179.088] (-1180.780) * (-1177.380) (-1178.260) [-1180.835] (-1181.896) -- 0:01:01 Average standard deviation of split frequencies: 0.016933 115500 -- [-1179.168] (-1178.928) (-1178.177) (-1181.511) * (-1177.689) (-1180.289) (-1180.557) [-1181.460] -- 0:01:01 116000 -- [-1178.707] (-1180.941) (-1179.458) (-1180.121) * [-1177.794] (-1182.986) (-1179.179) (-1183.656) -- 0:01:00 116500 -- [-1179.741] (-1178.411) (-1180.858) (-1179.955) * (-1178.285) [-1179.385] (-1178.876) (-1183.858) -- 0:01:00 117000 -- (-1178.280) (-1178.966) (-1184.004) [-1179.752] * (-1178.866) (-1182.532) (-1178.367) [-1178.162] -- 0:01:00 117500 -- (-1180.001) [-1179.340] (-1184.482) (-1177.772) * [-1184.165] (-1182.060) (-1178.760) (-1178.250) -- 0:01:00 118000 -- [-1177.888] (-1179.977) (-1178.867) (-1178.987) * (-1186.895) (-1182.622) (-1178.759) [-1179.536] -- 0:00:59 118500 -- (-1184.188) (-1180.232) (-1178.946) [-1177.631] * (-1180.967) (-1181.460) (-1177.396) [-1179.383] -- 0:00:59 119000 -- (-1180.340) (-1182.072) (-1179.492) [-1178.123] * (-1178.514) (-1182.941) [-1178.152] (-1184.430) -- 0:00:59 119500 -- (-1178.559) (-1182.131) [-1178.529] (-1178.250) * (-1179.245) [-1180.539] (-1177.473) (-1180.578) -- 0:00:58 120000 -- (-1179.660) (-1179.899) [-1179.278] (-1178.729) * (-1179.154) (-1178.753) [-1179.398] (-1181.050) -- 0:00:58 Average standard deviation of split frequencies: 0.015397 120500 -- [-1178.337] (-1178.797) (-1177.328) (-1180.291) * (-1180.355) (-1183.060) [-1180.422] (-1179.016) -- 0:00:58 121000 -- (-1183.304) (-1179.062) (-1177.963) [-1177.985] * (-1179.422) (-1184.027) (-1179.871) [-1178.973] -- 0:00:58 121500 -- (-1183.400) (-1180.731) [-1179.380] (-1180.739) * (-1178.478) (-1180.242) [-1178.917] (-1179.109) -- 0:00:57 122000 -- (-1177.615) (-1179.697) [-1179.435] (-1181.037) * (-1178.164) (-1178.478) [-1181.594] (-1178.245) -- 0:00:57 122500 -- (-1177.475) [-1177.982] (-1184.249) (-1185.146) * [-1177.680] (-1177.524) (-1181.904) (-1177.606) -- 0:00:57 123000 -- (-1179.952) (-1178.108) (-1178.441) [-1182.723] * (-1182.582) [-1178.857] (-1179.349) (-1181.979) -- 0:00:57 123500 -- [-1179.138] (-1181.395) (-1179.239) (-1178.738) * [-1181.922] (-1179.167) (-1180.898) (-1181.333) -- 0:00:56 124000 -- [-1178.718] (-1180.902) (-1178.416) (-1182.760) * [-1182.021] (-1179.042) (-1180.479) (-1179.182) -- 0:00:56 124500 -- (-1180.902) [-1178.222] (-1180.013) (-1179.298) * (-1179.719) (-1182.001) (-1182.228) [-1178.107] -- 0:01:03 125000 -- (-1180.680) [-1178.128] (-1181.343) (-1177.696) * [-1181.789] (-1178.572) (-1180.756) (-1177.646) -- 0:01:03 Average standard deviation of split frequencies: 0.016649 125500 -- (-1178.034) (-1178.787) [-1179.200] (-1179.630) * [-1181.057] (-1178.330) (-1183.158) (-1179.382) -- 0:01:02 126000 -- (-1177.550) [-1178.772] (-1179.389) (-1181.815) * (-1179.028) (-1178.950) (-1181.057) [-1179.411] -- 0:01:02 126500 -- [-1178.138] (-1177.583) (-1180.734) (-1178.743) * [-1177.328] (-1178.986) (-1181.630) (-1180.199) -- 0:01:02 127000 -- (-1179.519) [-1179.210] (-1180.463) (-1179.771) * [-1177.245] (-1178.204) (-1180.855) (-1179.174) -- 0:01:01 127500 -- [-1179.199] (-1177.591) (-1181.721) (-1177.117) * (-1177.022) (-1179.985) (-1180.247) [-1180.063] -- 0:01:01 128000 -- (-1180.373) [-1177.873] (-1179.677) (-1177.810) * (-1178.245) (-1178.741) [-1179.985] (-1179.530) -- 0:01:01 128500 -- (-1179.792) [-1179.216] (-1182.365) (-1179.277) * (-1178.705) (-1178.922) [-1179.527] (-1179.466) -- 0:01:01 129000 -- (-1179.653) (-1179.224) [-1179.498] (-1179.541) * (-1178.358) (-1178.513) [-1178.854] (-1178.185) -- 0:01:00 129500 -- (-1179.740) [-1178.949] (-1181.180) (-1182.459) * (-1180.121) (-1178.490) [-1181.670] (-1177.529) -- 0:01:00 130000 -- (-1179.773) (-1178.949) [-1181.883] (-1179.664) * (-1180.949) [-1178.559] (-1180.515) (-1177.741) -- 0:01:00 Average standard deviation of split frequencies: 0.016776 130500 -- [-1179.362] (-1178.907) (-1177.850) (-1181.746) * (-1182.290) (-1184.299) (-1178.887) [-1178.311] -- 0:00:59 131000 -- [-1184.093] (-1179.818) (-1182.863) (-1181.826) * [-1182.109] (-1182.851) (-1177.388) (-1180.692) -- 0:00:59 131500 -- (-1178.449) [-1180.324] (-1179.478) (-1182.213) * (-1179.533) (-1183.086) (-1177.309) [-1180.486] -- 0:00:59 132000 -- (-1178.755) (-1178.106) [-1179.503] (-1181.875) * (-1181.143) (-1178.929) (-1179.190) [-1179.280] -- 0:00:59 132500 -- (-1180.570) (-1178.038) [-1177.846] (-1179.881) * (-1180.607) (-1179.555) (-1180.892) [-1178.836] -- 0:00:58 133000 -- (-1183.552) [-1178.442] (-1177.507) (-1179.905) * (-1183.426) [-1177.794] (-1180.182) (-1178.922) -- 0:00:58 133500 -- (-1178.306) (-1179.359) [-1177.868] (-1178.489) * (-1181.174) (-1177.627) [-1178.026] (-1178.537) -- 0:00:58 134000 -- [-1177.743] (-1179.892) (-1179.692) (-1180.135) * [-1183.216] (-1179.385) (-1178.254) (-1177.461) -- 0:00:58 134500 -- (-1181.202) (-1179.924) (-1183.768) [-1180.077] * (-1179.139) (-1177.740) (-1178.456) [-1178.233] -- 0:00:57 135000 -- (-1177.813) (-1178.025) (-1182.486) [-1178.337] * (-1183.649) [-1178.197] (-1178.208) (-1180.972) -- 0:00:57 Average standard deviation of split frequencies: 0.018371 135500 -- (-1177.787) (-1177.816) [-1180.406] (-1181.749) * [-1180.476] (-1177.574) (-1180.758) (-1180.322) -- 0:00:57 136000 -- [-1178.485] (-1178.283) (-1181.749) (-1179.802) * [-1182.442] (-1177.991) (-1179.179) (-1179.636) -- 0:00:57 136500 -- (-1184.369) (-1178.711) (-1178.128) [-1181.231] * (-1183.364) [-1178.653] (-1178.651) (-1181.696) -- 0:00:56 137000 -- (-1179.716) [-1179.605] (-1178.056) (-1178.847) * (-1184.803) [-1178.591] (-1178.679) (-1180.468) -- 0:00:56 137500 -- (-1177.687) [-1179.605] (-1179.537) (-1179.012) * (-1188.609) (-1180.533) [-1177.960] (-1179.244) -- 0:00:56 138000 -- [-1177.424] (-1180.044) (-1179.929) (-1179.431) * (-1181.652) [-1178.507] (-1177.798) (-1184.206) -- 0:01:02 138500 -- (-1178.719) (-1179.766) [-1180.019] (-1180.568) * [-1178.594] (-1181.389) (-1181.893) (-1180.107) -- 0:01:02 139000 -- (-1180.480) (-1180.573) [-1179.101] (-1181.273) * [-1179.303] (-1178.600) (-1178.690) (-1185.111) -- 0:01:01 139500 -- (-1179.031) (-1178.867) [-1178.879] (-1182.279) * (-1186.381) (-1181.606) [-1182.704] (-1183.514) -- 0:01:01 140000 -- (-1178.536) (-1178.649) [-1179.574] (-1181.300) * (-1181.296) [-1180.069] (-1181.012) (-1179.352) -- 0:01:01 Average standard deviation of split frequencies: 0.018990 140500 -- (-1180.680) (-1177.169) [-1179.510] (-1179.256) * (-1181.913) (-1178.395) (-1183.881) [-1177.928] -- 0:01:01 141000 -- (-1177.888) (-1180.766) [-1181.947] (-1182.285) * [-1182.727] (-1187.198) (-1182.296) (-1178.262) -- 0:01:00 141500 -- (-1177.003) [-1178.113] (-1181.883) (-1181.594) * (-1178.708) [-1182.001] (-1179.102) (-1180.195) -- 0:01:00 142000 -- [-1182.147] (-1179.599) (-1180.584) (-1181.505) * [-1179.460] (-1178.779) (-1181.638) (-1180.040) -- 0:01:00 142500 -- [-1180.185] (-1178.487) (-1179.539) (-1182.149) * (-1178.993) (-1181.269) (-1184.446) [-1179.618] -- 0:01:00 143000 -- (-1177.563) [-1178.785] (-1178.506) (-1181.611) * (-1178.830) [-1182.560] (-1184.425) (-1178.520) -- 0:00:59 143500 -- (-1179.068) (-1180.096) (-1182.636) [-1179.167] * (-1177.191) [-1181.729] (-1182.983) (-1178.462) -- 0:00:59 144000 -- (-1181.864) (-1178.160) (-1184.339) [-1178.664] * (-1185.128) (-1179.030) [-1180.347] (-1177.523) -- 0:00:59 144500 -- [-1178.751] (-1179.340) (-1179.016) (-1179.334) * (-1177.807) (-1179.742) [-1179.442] (-1177.582) -- 0:00:59 145000 -- [-1179.032] (-1179.498) (-1183.238) (-1180.621) * (-1178.588) (-1180.710) (-1178.788) [-1177.263] -- 0:00:58 Average standard deviation of split frequencies: 0.019373 145500 -- (-1179.926) (-1179.085) (-1178.276) [-1181.043] * (-1180.634) [-1182.738] (-1182.002) (-1177.572) -- 0:00:58 146000 -- (-1182.808) (-1179.852) (-1178.907) [-1179.511] * (-1183.317) (-1180.280) (-1182.055) [-1180.379] -- 0:00:58 146500 -- (-1182.513) (-1178.611) (-1178.517) [-1179.682] * (-1182.167) [-1178.515] (-1185.269) (-1178.917) -- 0:00:58 147000 -- [-1180.635] (-1182.884) (-1179.605) (-1178.012) * (-1181.544) (-1177.630) (-1181.971) [-1180.624] -- 0:00:58 147500 -- (-1178.158) [-1179.821] (-1182.676) (-1178.146) * (-1177.388) (-1177.807) [-1179.653] (-1180.993) -- 0:00:57 148000 -- (-1181.469) (-1184.953) [-1177.770] (-1178.402) * [-1180.223] (-1182.543) (-1182.390) (-1179.963) -- 0:00:57 148500 -- [-1179.548] (-1180.110) (-1179.802) (-1179.361) * [-1177.622] (-1181.776) (-1178.963) (-1181.619) -- 0:00:57 149000 -- (-1177.421) (-1181.385) [-1179.645] (-1178.492) * [-1177.629] (-1178.868) (-1178.102) (-1189.367) -- 0:00:57 149500 -- (-1177.904) (-1183.801) [-1178.812] (-1180.270) * (-1178.748) [-1178.911] (-1180.919) (-1180.198) -- 0:00:56 150000 -- (-1177.795) (-1182.572) (-1179.303) [-1184.482] * (-1178.322) (-1179.709) [-1180.274] (-1179.963) -- 0:00:56 Average standard deviation of split frequencies: 0.021432 150500 -- (-1179.605) (-1180.849) (-1182.442) [-1179.810] * (-1178.656) [-1179.586] (-1179.284) (-1181.644) -- 0:00:56 151000 -- (-1178.443) [-1181.194] (-1179.674) (-1181.062) * [-1181.249] (-1179.989) (-1180.642) (-1182.851) -- 0:01:01 151500 -- [-1178.406] (-1180.207) (-1180.706) (-1178.899) * (-1177.992) (-1177.981) (-1179.089) [-1179.086] -- 0:01:01 152000 -- [-1178.762] (-1178.596) (-1178.644) (-1179.851) * (-1177.404) (-1177.456) (-1182.083) [-1177.480] -- 0:01:01 152500 -- [-1178.887] (-1177.894) (-1178.760) (-1181.103) * (-1177.995) (-1177.848) [-1179.024] (-1181.131) -- 0:01:01 153000 -- (-1178.585) (-1178.446) [-1180.431] (-1181.688) * (-1178.055) [-1177.792] (-1178.694) (-1181.638) -- 0:01:00 153500 -- [-1178.086] (-1177.705) (-1182.652) (-1184.340) * (-1179.258) [-1177.750] (-1178.914) (-1178.475) -- 0:01:00 154000 -- (-1181.216) (-1180.036) [-1180.845] (-1181.043) * [-1179.515] (-1184.539) (-1182.586) (-1181.829) -- 0:01:00 154500 -- (-1180.096) [-1179.087] (-1180.033) (-1183.781) * (-1178.858) (-1183.042) [-1180.038] (-1179.457) -- 0:01:00 155000 -- (-1181.911) (-1179.864) [-1180.634] (-1180.185) * (-1180.858) [-1183.399] (-1178.323) (-1180.876) -- 0:00:59 Average standard deviation of split frequencies: 0.019244 155500 -- (-1181.133) (-1177.243) (-1180.611) [-1179.855] * [-1178.635] (-1178.735) (-1178.321) (-1177.660) -- 0:00:59 156000 -- (-1179.983) (-1178.449) [-1179.637] (-1181.034) * [-1179.523] (-1178.576) (-1178.749) (-1177.456) -- 0:00:59 156500 -- (-1178.234) [-1178.193] (-1180.260) (-1178.387) * (-1183.058) (-1178.187) (-1179.256) [-1177.202] -- 0:00:59 157000 -- (-1180.713) (-1178.159) [-1179.739] (-1183.509) * (-1178.283) [-1179.068] (-1178.453) (-1178.182) -- 0:00:59 157500 -- (-1182.215) (-1178.633) [-1179.289] (-1182.933) * (-1184.369) [-1179.754] (-1178.814) (-1178.002) -- 0:00:58 158000 -- [-1178.792] (-1179.170) (-1179.232) (-1177.994) * [-1178.004] (-1179.697) (-1177.603) (-1178.218) -- 0:00:58 158500 -- (-1178.699) [-1179.203] (-1179.128) (-1178.171) * (-1177.749) (-1177.864) [-1177.982] (-1178.566) -- 0:00:58 159000 -- (-1178.816) (-1181.892) (-1178.436) [-1178.060] * (-1177.532) [-1179.050] (-1179.466) (-1183.227) -- 0:00:58 159500 -- (-1180.115) [-1182.641] (-1180.126) (-1181.935) * [-1180.681] (-1178.912) (-1179.466) (-1180.373) -- 0:00:57 160000 -- [-1180.228] (-1179.301) (-1181.772) (-1179.033) * (-1179.066) [-1179.297] (-1178.911) (-1183.218) -- 0:00:57 Average standard deviation of split frequencies: 0.019149 160500 -- [-1180.334] (-1179.856) (-1178.870) (-1182.332) * (-1183.113) (-1179.462) [-1180.917] (-1180.394) -- 0:00:57 161000 -- [-1177.536] (-1178.891) (-1177.837) (-1183.647) * (-1183.398) (-1178.578) [-1180.101] (-1178.965) -- 0:00:57 161500 -- (-1179.092) [-1178.083] (-1184.046) (-1179.488) * [-1178.853] (-1179.119) (-1179.365) (-1178.307) -- 0:00:57 162000 -- (-1177.546) (-1178.651) (-1178.199) [-1177.411] * (-1183.244) (-1180.028) (-1180.670) [-1179.789] -- 0:00:56 162500 -- [-1177.120] (-1177.378) (-1178.265) (-1178.805) * (-1185.469) (-1180.296) (-1182.405) [-1178.350] -- 0:00:56 163000 -- (-1178.534) (-1184.115) [-1178.146] (-1184.200) * [-1178.814] (-1181.724) (-1180.945) (-1180.768) -- 0:00:56 163500 -- [-1179.384] (-1179.923) (-1177.748) (-1178.604) * (-1177.679) [-1184.856] (-1180.163) (-1182.061) -- 0:00:56 164000 -- (-1180.823) (-1179.096) [-1177.962] (-1179.907) * (-1180.043) (-1182.691) [-1178.725] (-1178.906) -- 0:00:56 164500 -- [-1177.673] (-1178.187) (-1178.171) (-1179.953) * (-1177.336) (-1180.413) (-1179.976) [-1180.243] -- 0:00:55 165000 -- (-1185.894) (-1177.236) (-1182.404) [-1178.064] * [-1180.535] (-1179.600) (-1178.953) (-1178.747) -- 0:01:00 Average standard deviation of split frequencies: 0.018234 165500 -- (-1183.016) (-1179.814) [-1179.674] (-1181.422) * (-1177.848) [-1178.423] (-1179.615) (-1179.842) -- 0:01:00 166000 -- [-1179.584] (-1179.203) (-1178.501) (-1186.175) * [-1179.866] (-1178.125) (-1180.617) (-1185.125) -- 0:01:00 166500 -- (-1181.698) (-1179.565) [-1178.773] (-1182.298) * [-1182.216] (-1178.458) (-1178.890) (-1178.778) -- 0:01:00 167000 -- (-1178.530) (-1179.030) (-1179.242) [-1179.160] * (-1182.975) (-1178.202) [-1178.633] (-1178.900) -- 0:00:59 167500 -- [-1178.646] (-1178.458) (-1179.964) (-1180.634) * (-1182.575) [-1178.187] (-1179.110) (-1180.084) -- 0:00:59 168000 -- (-1180.270) [-1181.109] (-1180.921) (-1179.623) * (-1178.392) [-1178.208] (-1178.459) (-1181.155) -- 0:00:59 168500 -- [-1184.718] (-1180.125) (-1177.715) (-1180.626) * (-1184.003) (-1178.366) [-1179.421] (-1181.684) -- 0:00:59 169000 -- (-1183.388) [-1180.060] (-1179.798) (-1186.204) * (-1181.201) (-1177.802) (-1179.384) [-1178.085] -- 0:00:59 169500 -- (-1183.292) (-1182.140) [-1183.278] (-1184.957) * (-1181.551) (-1178.822) (-1180.647) [-1178.398] -- 0:00:58 170000 -- [-1177.604] (-1179.798) (-1182.214) (-1180.827) * (-1179.146) (-1185.443) (-1179.929) [-1177.933] -- 0:00:58 Average standard deviation of split frequencies: 0.016427 170500 -- [-1179.116] (-1180.899) (-1181.365) (-1181.543) * [-1178.515] (-1177.562) (-1178.850) (-1179.953) -- 0:00:58 171000 -- [-1181.520] (-1178.757) (-1180.332) (-1180.075) * (-1179.226) [-1179.235] (-1183.098) (-1182.329) -- 0:00:58 171500 -- (-1180.352) (-1178.534) (-1180.332) [-1179.783] * (-1181.507) [-1178.706] (-1182.915) (-1178.000) -- 0:00:57 172000 -- (-1179.319) (-1178.512) [-1177.759] (-1178.985) * (-1181.413) [-1183.221] (-1180.365) (-1182.448) -- 0:00:57 172500 -- [-1179.159] (-1178.357) (-1178.470) (-1178.281) * (-1179.949) (-1179.032) (-1178.122) [-1181.054] -- 0:00:57 173000 -- (-1181.934) (-1178.600) (-1177.663) [-1178.279] * (-1179.898) [-1180.466] (-1179.607) (-1178.793) -- 0:00:57 173500 -- (-1184.520) (-1178.865) [-1179.465] (-1178.606) * (-1177.511) (-1178.107) (-1179.740) [-1177.601] -- 0:00:57 174000 -- (-1180.807) [-1178.778] (-1181.017) (-1182.741) * [-1179.958] (-1179.208) (-1180.409) (-1178.047) -- 0:00:56 174500 -- [-1180.829] (-1178.783) (-1181.117) (-1181.811) * (-1186.140) (-1179.402) [-1179.096] (-1178.923) -- 0:00:56 175000 -- (-1177.865) [-1178.881] (-1180.288) (-1181.769) * (-1186.368) [-1179.938] (-1185.111) (-1178.043) -- 0:00:56 Average standard deviation of split frequencies: 0.015401 175500 -- (-1178.558) [-1179.079] (-1179.907) (-1178.902) * [-1179.088] (-1178.145) (-1179.625) (-1178.474) -- 0:00:56 176000 -- (-1178.697) [-1177.852] (-1178.922) (-1180.855) * (-1184.538) (-1179.699) (-1183.611) [-1179.214] -- 0:00:56 176500 -- [-1177.098] (-1182.117) (-1179.665) (-1183.825) * (-1184.376) (-1180.936) (-1182.663) [-1179.216] -- 0:00:55 177000 -- (-1177.037) (-1184.498) (-1181.883) [-1178.015] * (-1179.474) (-1181.283) (-1182.663) [-1178.829] -- 0:00:55 177500 -- (-1178.082) (-1178.047) [-1179.416] (-1177.908) * (-1180.866) (-1178.247) (-1182.599) [-1177.981] -- 0:00:55 178000 -- [-1181.098] (-1180.289) (-1178.453) (-1178.418) * (-1180.645) (-1178.799) (-1180.969) [-1178.143] -- 0:00:55 178500 -- (-1178.123) (-1181.597) (-1179.317) [-1178.165] * (-1177.928) (-1177.564) [-1177.700] (-1181.204) -- 0:00:55 179000 -- [-1177.940] (-1180.516) (-1181.077) (-1178.282) * (-1178.850) [-1177.975] (-1178.121) (-1178.824) -- 0:00:59 179500 -- [-1178.989] (-1183.231) (-1179.373) (-1177.296) * (-1178.645) [-1177.743] (-1181.872) (-1178.377) -- 0:00:59 180000 -- (-1179.598) (-1178.121) (-1180.580) [-1177.844] * (-1179.106) (-1179.433) [-1181.807] (-1178.379) -- 0:00:59 Average standard deviation of split frequencies: 0.014742 180500 -- (-1181.918) (-1180.146) (-1179.374) [-1178.919] * (-1182.083) (-1180.200) [-1178.737] (-1180.654) -- 0:00:59 181000 -- [-1178.826] (-1177.631) (-1178.785) (-1177.760) * (-1178.691) [-1179.576] (-1181.199) (-1178.197) -- 0:00:58 181500 -- (-1178.148) (-1177.825) [-1179.915] (-1177.760) * (-1181.698) (-1179.692) (-1180.017) [-1179.289] -- 0:00:58 182000 -- (-1181.580) [-1177.824] (-1178.749) (-1178.990) * (-1180.009) (-1179.456) [-1179.302] (-1183.380) -- 0:00:58 182500 -- (-1181.482) (-1179.527) [-1182.593] (-1178.556) * [-1178.811] (-1180.596) (-1179.542) (-1177.210) -- 0:00:58 183000 -- (-1180.969) (-1177.680) (-1180.646) [-1178.040] * (-1179.231) (-1179.364) (-1178.094) [-1178.488] -- 0:00:58 183500 -- (-1178.752) [-1177.324] (-1178.492) (-1181.373) * [-1183.423] (-1178.967) (-1181.692) (-1177.979) -- 0:00:57 184000 -- (-1177.830) [-1180.147] (-1178.617) (-1177.536) * (-1181.798) (-1184.899) (-1178.936) [-1177.745] -- 0:00:57 184500 -- (-1177.581) [-1180.830] (-1179.601) (-1177.569) * (-1179.824) (-1185.319) (-1180.048) [-1177.115] -- 0:00:57 185000 -- (-1181.946) (-1180.392) [-1178.953] (-1179.181) * (-1182.816) (-1184.640) [-1178.326] (-1178.299) -- 0:00:57 Average standard deviation of split frequencies: 0.015460 185500 -- (-1180.294) (-1178.178) [-1182.093] (-1181.605) * (-1179.191) (-1181.154) (-1178.616) [-1180.812] -- 0:00:57 186000 -- (-1180.075) [-1179.634] (-1178.271) (-1179.360) * [-1178.802] (-1180.738) (-1181.214) (-1178.003) -- 0:00:56 186500 -- (-1180.354) [-1178.988] (-1180.364) (-1183.107) * (-1179.713) (-1181.330) [-1179.817] (-1179.710) -- 0:00:56 187000 -- (-1178.221) [-1179.614] (-1179.893) (-1180.075) * (-1177.897) (-1178.371) [-1182.118] (-1178.672) -- 0:00:56 187500 -- (-1177.155) (-1182.199) (-1178.380) [-1178.421] * (-1178.817) (-1178.554) [-1178.479] (-1179.530) -- 0:00:56 188000 -- (-1181.173) (-1180.105) [-1180.777] (-1184.377) * (-1178.311) [-1180.171] (-1177.980) (-1180.312) -- 0:00:56 188500 -- (-1182.428) (-1179.498) [-1180.056] (-1187.249) * (-1177.890) (-1180.923) (-1177.966) [-1182.384] -- 0:00:55 189000 -- [-1178.921] (-1180.332) (-1180.589) (-1178.897) * (-1178.045) [-1179.939] (-1180.196) (-1178.810) -- 0:00:55 189500 -- [-1180.676] (-1181.502) (-1179.725) (-1178.860) * (-1178.594) (-1177.281) (-1178.975) [-1181.437] -- 0:00:55 190000 -- [-1178.051] (-1178.087) (-1179.543) (-1179.380) * (-1178.480) (-1178.845) [-1179.318] (-1180.746) -- 0:00:55 Average standard deviation of split frequencies: 0.015823 190500 -- (-1179.349) (-1182.998) (-1180.090) [-1182.289] * (-1178.198) (-1178.303) (-1178.052) [-1180.963] -- 0:00:55 191000 -- [-1177.579] (-1178.874) (-1178.426) (-1178.134) * (-1178.187) [-1180.929] (-1179.123) (-1178.968) -- 0:00:55 191500 -- [-1180.039] (-1183.220) (-1177.480) (-1178.134) * (-1178.046) [-1179.810] (-1177.391) (-1184.980) -- 0:00:54 192000 -- (-1177.254) (-1177.735) [-1179.341] (-1179.407) * (-1178.046) (-1179.346) [-1177.161] (-1181.440) -- 0:00:54 192500 -- (-1179.705) (-1178.977) (-1178.232) [-1178.670] * [-1178.839] (-1179.671) (-1177.579) (-1180.623) -- 0:00:54 193000 -- (-1178.025) [-1177.807] (-1178.762) (-1178.136) * (-1178.488) (-1179.672) (-1177.595) [-1177.407] -- 0:00:58 193500 -- (-1178.242) (-1178.643) [-1183.962] (-1177.971) * [-1178.119] (-1185.701) (-1178.133) (-1178.363) -- 0:00:58 194000 -- (-1177.967) (-1178.393) (-1180.673) [-1179.414] * [-1178.292] (-1178.423) (-1178.091) (-1180.562) -- 0:00:58 194500 -- (-1178.019) (-1180.177) (-1178.481) [-1180.402] * (-1177.886) [-1177.955] (-1182.727) (-1180.756) -- 0:00:57 195000 -- (-1177.973) [-1180.114] (-1180.162) (-1180.095) * [-1177.565] (-1179.312) (-1178.894) (-1180.228) -- 0:00:57 Average standard deviation of split frequencies: 0.014811 195500 -- (-1186.809) (-1180.874) [-1180.001] (-1178.849) * (-1182.546) (-1178.197) (-1177.937) [-1178.756] -- 0:00:57 196000 -- (-1179.293) (-1179.169) (-1179.551) [-1178.674] * (-1190.289) (-1178.180) [-1180.375] (-1177.953) -- 0:00:57 196500 -- (-1178.355) (-1184.918) (-1178.856) [-1179.592] * (-1180.090) (-1177.515) (-1181.515) [-1177.962] -- 0:00:57 197000 -- (-1179.333) (-1180.566) [-1177.967] (-1179.846) * (-1177.594) (-1181.466) (-1184.593) [-1180.875] -- 0:00:57 197500 -- (-1182.374) [-1180.542] (-1184.039) (-1177.976) * (-1179.729) (-1180.536) (-1188.668) [-1178.196] -- 0:00:56 198000 -- (-1180.358) (-1180.764) [-1177.744] (-1177.560) * (-1181.504) (-1179.615) [-1178.840] (-1179.696) -- 0:00:56 198500 -- (-1179.720) (-1178.141) [-1180.246] (-1179.511) * [-1181.021] (-1180.847) (-1178.982) (-1181.063) -- 0:00:56 199000 -- [-1181.605] (-1178.161) (-1180.761) (-1179.062) * [-1182.279] (-1179.878) (-1180.008) (-1178.057) -- 0:00:56 199500 -- (-1180.229) [-1177.723] (-1179.390) (-1178.113) * (-1182.114) (-1178.705) [-1178.270] (-1178.174) -- 0:00:56 200000 -- [-1179.745] (-1178.156) (-1180.069) (-1179.230) * (-1181.557) (-1180.461) (-1179.886) [-1181.508] -- 0:00:55 Average standard deviation of split frequencies: 0.014342 200500 -- (-1181.193) (-1177.816) (-1178.730) [-1178.945] * (-1182.093) (-1179.711) (-1178.695) [-1182.827] -- 0:00:55 201000 -- (-1178.607) (-1177.781) (-1177.780) [-1180.381] * [-1181.338] (-1181.992) (-1177.510) (-1179.077) -- 0:00:55 201500 -- (-1178.501) [-1178.029] (-1179.075) (-1178.558) * (-1178.663) (-1183.387) (-1177.511) [-1176.963] -- 0:00:55 202000 -- (-1180.043) [-1179.971] (-1180.322) (-1179.191) * (-1180.167) [-1179.811] (-1179.177) (-1177.327) -- 0:00:55 202500 -- (-1186.292) [-1177.423] (-1180.051) (-1177.869) * (-1181.018) [-1180.820] (-1178.496) (-1179.842) -- 0:00:55 203000 -- (-1179.618) (-1180.008) [-1185.043] (-1178.117) * (-1183.350) (-1185.697) [-1180.558] (-1179.575) -- 0:00:54 203500 -- (-1180.163) (-1178.776) [-1185.488] (-1182.823) * (-1181.616) (-1181.518) [-1181.148] (-1180.526) -- 0:00:54 204000 -- (-1181.811) [-1181.929] (-1184.188) (-1177.201) * (-1182.276) (-1180.892) [-1180.513] (-1182.374) -- 0:00:54 204500 -- [-1179.408] (-1180.673) (-1178.403) (-1177.332) * (-1180.930) [-1179.358] (-1178.884) (-1180.875) -- 0:00:54 205000 -- (-1179.232) [-1183.343] (-1178.619) (-1177.964) * (-1180.191) (-1177.758) (-1179.349) [-1179.950] -- 0:00:58 Average standard deviation of split frequencies: 0.014188 205500 -- (-1178.960) [-1180.030] (-1179.046) (-1177.868) * (-1180.411) (-1178.557) [-1184.523] (-1178.288) -- 0:00:57 206000 -- (-1178.304) (-1178.162) [-1178.437] (-1179.960) * (-1180.989) (-1180.348) [-1179.722] (-1179.236) -- 0:00:57 206500 -- (-1183.624) (-1177.975) (-1178.720) [-1177.721] * (-1180.431) (-1177.650) (-1178.553) [-1181.196] -- 0:00:57 207000 -- (-1182.554) (-1178.682) (-1180.194) [-1181.052] * (-1178.379) [-1179.790] (-1178.889) (-1182.287) -- 0:00:57 207500 -- (-1184.995) (-1182.503) (-1180.879) [-1182.663] * [-1178.661] (-1178.411) (-1179.456) (-1180.806) -- 0:00:57 208000 -- (-1178.572) (-1182.399) [-1178.629] (-1179.122) * (-1177.553) (-1180.158) [-1179.452] (-1184.154) -- 0:00:57 208500 -- (-1180.755) (-1179.236) [-1178.127] (-1184.197) * (-1177.524) [-1182.244] (-1177.766) (-1182.300) -- 0:00:56 209000 -- (-1178.591) (-1177.791) [-1183.529] (-1178.253) * (-1177.925) [-1179.852] (-1179.310) (-1178.901) -- 0:00:56 209500 -- (-1179.405) [-1178.098] (-1179.276) (-1179.658) * (-1177.630) [-1178.635] (-1182.774) (-1180.889) -- 0:00:56 210000 -- (-1180.175) (-1180.422) (-1177.533) [-1180.396] * (-1177.531) (-1179.185) [-1181.044] (-1179.804) -- 0:00:56 Average standard deviation of split frequencies: 0.013985 210500 -- (-1182.278) (-1180.462) (-1178.350) [-1180.055] * (-1177.622) [-1179.616] (-1185.626) (-1179.457) -- 0:00:56 211000 -- (-1179.740) (-1181.636) (-1181.279) [-1180.205] * (-1178.311) (-1177.483) [-1182.988] (-1180.884) -- 0:00:56 211500 -- (-1177.255) (-1178.830) [-1178.417] (-1179.469) * [-1178.203] (-1181.457) (-1179.552) (-1180.718) -- 0:00:55 212000 -- [-1177.103] (-1182.882) (-1177.703) (-1182.151) * (-1178.406) (-1179.630) [-1179.267] (-1182.664) -- 0:00:55 212500 -- (-1177.522) (-1182.881) [-1178.315] (-1182.171) * (-1179.946) [-1178.543] (-1177.165) (-1187.925) -- 0:00:55 213000 -- (-1177.654) [-1177.222] (-1178.317) (-1181.077) * (-1179.937) (-1177.781) [-1178.592] (-1184.256) -- 0:00:55 213500 -- (-1177.654) [-1177.181] (-1178.067) (-1178.017) * [-1179.600] (-1181.382) (-1178.951) (-1178.976) -- 0:00:55 214000 -- (-1178.525) (-1177.050) [-1180.139] (-1178.338) * [-1180.381] (-1179.768) (-1179.003) (-1178.110) -- 0:00:55 214500 -- (-1182.781) [-1177.570] (-1180.823) (-1178.154) * (-1180.032) [-1180.229] (-1180.135) (-1180.956) -- 0:00:54 215000 -- (-1184.949) [-1177.501] (-1178.530) (-1180.013) * (-1180.015) (-1177.898) [-1178.891] (-1181.427) -- 0:00:54 Average standard deviation of split frequencies: 0.015079 215500 -- (-1182.856) (-1178.015) [-1177.854] (-1179.640) * (-1179.506) (-1179.854) (-1182.714) [-1178.337] -- 0:00:54 216000 -- (-1178.741) (-1178.582) [-1178.121] (-1180.017) * (-1178.180) (-1182.520) [-1181.351] (-1178.414) -- 0:00:54 216500 -- (-1180.139) [-1178.561] (-1180.848) (-1183.238) * (-1179.594) (-1178.274) [-1177.656] (-1180.400) -- 0:00:54 217000 -- (-1179.031) (-1178.797) [-1179.293] (-1185.294) * (-1180.040) [-1178.183] (-1177.511) (-1178.457) -- 0:00:57 217500 -- [-1181.387] (-1180.263) (-1178.507) (-1180.165) * (-1177.945) (-1177.394) [-1180.349] (-1178.594) -- 0:00:57 218000 -- [-1181.280] (-1177.770) (-1183.062) (-1180.166) * (-1179.689) [-1177.853] (-1182.580) (-1177.512) -- 0:00:57 218500 -- (-1178.874) (-1177.516) (-1180.314) [-1179.777] * (-1184.119) (-1177.905) (-1179.746) [-1178.330] -- 0:00:57 219000 -- (-1179.340) [-1178.886] (-1184.853) (-1178.129) * (-1181.093) (-1177.895) [-1177.953] (-1177.518) -- 0:00:57 219500 -- (-1178.621) (-1179.691) [-1180.690] (-1180.619) * (-1178.884) (-1178.026) [-1178.848] (-1177.942) -- 0:00:56 220000 -- (-1180.549) [-1178.466] (-1180.305) (-1178.652) * [-1179.961] (-1177.248) (-1181.336) (-1181.068) -- 0:00:56 Average standard deviation of split frequencies: 0.014841 220500 -- (-1179.440) [-1177.756] (-1178.146) (-1180.316) * (-1178.075) (-1179.400) [-1181.692] (-1181.090) -- 0:00:56 221000 -- (-1179.992) (-1178.746) (-1178.554) [-1178.766] * [-1179.969] (-1179.398) (-1181.654) (-1177.841) -- 0:00:56 221500 -- [-1177.470] (-1178.187) (-1178.791) (-1182.192) * (-1179.123) [-1181.606] (-1181.047) (-1181.415) -- 0:00:56 222000 -- (-1181.154) [-1178.334] (-1178.154) (-1179.252) * [-1176.967] (-1182.357) (-1181.329) (-1182.848) -- 0:00:56 222500 -- (-1178.355) [-1177.639] (-1178.664) (-1183.829) * (-1180.162) [-1179.753] (-1185.303) (-1183.380) -- 0:00:55 223000 -- (-1178.296) (-1181.859) [-1178.682] (-1182.572) * (-1179.990) (-1181.540) (-1182.349) [-1178.694] -- 0:00:55 223500 -- [-1178.210] (-1181.278) (-1179.156) (-1180.013) * [-1178.416] (-1179.651) (-1178.733) (-1185.264) -- 0:00:55 224000 -- (-1178.848) (-1179.197) [-1177.851] (-1181.080) * (-1182.158) (-1178.477) [-1182.426] (-1184.932) -- 0:00:55 224500 -- [-1178.319] (-1179.750) (-1180.688) (-1182.507) * (-1181.168) [-1180.023] (-1178.479) (-1184.171) -- 0:00:55 225000 -- (-1180.896) (-1179.256) (-1179.938) [-1180.744] * (-1180.360) (-1179.619) [-1178.829] (-1180.892) -- 0:00:55 Average standard deviation of split frequencies: 0.014052 225500 -- (-1179.616) [-1179.736] (-1179.802) (-1180.451) * (-1178.583) (-1180.256) (-1177.846) [-1183.778] -- 0:00:54 226000 -- (-1177.798) (-1180.936) (-1181.494) [-1183.547] * [-1179.788] (-1178.370) (-1178.385) (-1179.715) -- 0:00:54 226500 -- (-1180.159) (-1179.956) (-1186.066) [-1180.797] * (-1181.698) (-1177.739) (-1178.633) [-1179.019] -- 0:00:54 227000 -- [-1179.200] (-1180.367) (-1180.876) (-1180.659) * [-1179.173] (-1178.545) (-1177.808) (-1179.295) -- 0:00:54 227500 -- (-1178.721) [-1178.686] (-1183.735) (-1182.590) * (-1178.044) (-1180.371) (-1177.507) [-1179.391] -- 0:00:54 228000 -- (-1178.622) (-1178.827) (-1180.036) [-1182.281] * (-1179.725) (-1180.543) (-1179.255) [-1178.715] -- 0:00:54 228500 -- (-1179.162) (-1180.568) [-1179.724] (-1179.765) * (-1177.770) (-1177.796) [-1178.086] (-1180.458) -- 0:00:54 229000 -- [-1181.216] (-1177.435) (-1180.124) (-1178.292) * (-1180.054) (-1179.212) [-1178.711] (-1181.308) -- 0:00:53 229500 -- (-1183.412) (-1184.977) [-1178.633] (-1185.071) * (-1179.141) (-1177.358) (-1177.349) [-1179.539] -- 0:00:57 230000 -- [-1179.853] (-1181.959) (-1180.468) (-1180.697) * [-1182.352] (-1179.230) (-1179.417) (-1180.566) -- 0:00:56 Average standard deviation of split frequencies: 0.013660 230500 -- (-1179.172) [-1177.200] (-1178.319) (-1181.000) * (-1183.940) [-1177.651] (-1179.401) (-1181.039) -- 0:00:56 231000 -- (-1179.034) (-1179.769) (-1177.636) [-1179.050] * (-1178.574) [-1179.924] (-1182.962) (-1180.134) -- 0:00:56 231500 -- (-1182.007) [-1177.485] (-1178.581) (-1181.238) * (-1182.005) [-1178.770] (-1177.528) (-1180.048) -- 0:00:56 232000 -- (-1180.851) [-1180.400] (-1177.639) (-1178.611) * (-1178.295) (-1181.247) (-1177.869) [-1181.123] -- 0:00:56 232500 -- (-1179.339) (-1178.895) [-1177.265] (-1178.755) * (-1184.271) [-1180.788] (-1179.723) (-1179.048) -- 0:00:56 233000 -- [-1177.931] (-1178.902) (-1177.526) (-1179.715) * (-1177.977) (-1177.959) (-1183.290) [-1181.560] -- 0:00:55 233500 -- (-1179.172) [-1178.898] (-1178.068) (-1180.492) * (-1180.338) (-1178.421) (-1179.426) [-1177.963] -- 0:00:55 234000 -- (-1179.140) (-1179.852) (-1184.056) [-1178.845] * (-1180.840) (-1179.052) [-1179.146] (-1180.382) -- 0:00:55 234500 -- (-1178.396) [-1178.333] (-1180.336) (-1179.527) * (-1180.827) (-1178.326) (-1179.751) [-1178.250] -- 0:00:55 235000 -- (-1180.159) [-1179.493] (-1182.450) (-1178.338) * (-1184.003) (-1178.575) [-1179.751] (-1180.124) -- 0:00:55 Average standard deviation of split frequencies: 0.014087 235500 -- (-1177.507) (-1179.174) [-1185.018] (-1179.159) * (-1182.615) (-1180.053) (-1179.511) [-1180.431] -- 0:00:55 236000 -- [-1177.973] (-1178.703) (-1187.227) (-1180.127) * (-1184.674) [-1179.644] (-1182.098) (-1178.806) -- 0:00:55 236500 -- (-1177.293) (-1177.948) [-1180.133] (-1180.004) * (-1179.146) (-1178.777) (-1180.460) [-1180.021] -- 0:00:54 237000 -- (-1177.268) [-1177.834] (-1180.893) (-1177.785) * [-1178.179] (-1178.078) (-1178.089) (-1179.820) -- 0:00:54 237500 -- (-1178.072) (-1179.829) (-1189.695) [-1180.382] * [-1177.885] (-1179.165) (-1181.140) (-1177.920) -- 0:00:54 238000 -- (-1179.767) (-1180.089) (-1181.014) [-1179.666] * (-1179.641) (-1180.761) [-1180.538] (-1178.395) -- 0:00:54 238500 -- (-1179.086) (-1180.090) [-1179.063] (-1178.853) * (-1179.253) (-1179.685) [-1178.637] (-1178.666) -- 0:00:54 239000 -- (-1179.281) (-1177.847) (-1185.019) [-1178.743] * (-1179.062) [-1179.336] (-1177.775) (-1179.564) -- 0:00:54 239500 -- (-1177.675) (-1180.005) (-1183.978) [-1178.249] * (-1178.963) (-1183.647) [-1178.832] (-1179.987) -- 0:00:53 240000 -- (-1179.249) [-1177.482] (-1178.050) (-1177.448) * (-1178.732) (-1184.132) (-1179.353) [-1178.833] -- 0:00:53 Average standard deviation of split frequencies: 0.013299 240500 -- (-1179.138) (-1179.194) (-1178.171) [-1177.915] * (-1180.209) (-1183.768) (-1181.179) [-1179.270] -- 0:00:53 241000 -- (-1179.346) (-1179.742) [-1177.203] (-1178.140) * (-1178.266) [-1178.046] (-1181.356) (-1179.715) -- 0:00:53 241500 -- (-1179.941) (-1179.075) (-1177.162) [-1177.467] * (-1178.446) (-1181.051) [-1178.238] (-1181.969) -- 0:00:53 242000 -- (-1178.158) [-1180.340] (-1177.255) (-1186.096) * (-1178.444) [-1179.379] (-1181.113) (-1181.130) -- 0:00:53 242500 -- (-1179.154) (-1178.518) (-1178.601) [-1182.276] * (-1181.853) (-1179.162) (-1178.019) [-1180.688] -- 0:00:56 243000 -- [-1181.641] (-1182.976) (-1180.847) (-1179.419) * (-1179.755) (-1179.406) [-1178.530] (-1179.241) -- 0:00:56 243500 -- (-1177.931) [-1177.409] (-1180.847) (-1177.851) * [-1178.925] (-1180.492) (-1179.137) (-1181.220) -- 0:00:55 244000 -- [-1177.229] (-1178.970) (-1179.389) (-1181.030) * (-1178.773) (-1179.123) [-1178.583] (-1180.259) -- 0:00:55 244500 -- [-1179.444] (-1183.076) (-1181.331) (-1178.982) * (-1177.448) [-1178.822] (-1178.590) (-1179.741) -- 0:00:55 245000 -- [-1178.090] (-1184.365) (-1180.752) (-1178.262) * [-1178.186] (-1179.025) (-1180.575) (-1178.900) -- 0:00:55 Average standard deviation of split frequencies: 0.013031 245500 -- (-1178.101) (-1180.981) (-1179.077) [-1179.080] * (-1177.893) (-1179.611) [-1180.568] (-1178.316) -- 0:00:55 246000 -- (-1179.416) (-1178.396) (-1179.942) [-1178.147] * [-1180.366] (-1181.076) (-1178.314) (-1179.080) -- 0:00:55 246500 -- (-1181.594) [-1180.929] (-1178.482) (-1178.864) * [-1179.184] (-1180.059) (-1177.933) (-1179.945) -- 0:00:55 247000 -- (-1179.776) (-1181.087) [-1178.780] (-1177.629) * (-1179.123) (-1177.851) (-1177.626) [-1178.016] -- 0:00:54 247500 -- (-1177.813) (-1178.701) [-1180.912] (-1181.694) * [-1179.665] (-1177.340) (-1180.361) (-1180.806) -- 0:00:54 248000 -- (-1177.768) [-1178.178] (-1178.742) (-1178.989) * [-1179.242] (-1180.015) (-1178.116) (-1183.368) -- 0:00:54 248500 -- [-1179.450] (-1181.566) (-1177.793) (-1179.786) * (-1177.872) (-1179.569) [-1178.751] (-1178.979) -- 0:00:54 249000 -- (-1178.642) [-1179.580] (-1180.056) (-1178.401) * (-1180.209) (-1182.038) [-1178.138] (-1180.623) -- 0:00:54 249500 -- (-1183.783) (-1178.659) [-1179.784] (-1178.352) * (-1178.126) (-1181.237) [-1177.886] (-1181.172) -- 0:00:54 250000 -- (-1185.018) [-1178.764] (-1184.988) (-1179.162) * [-1179.979] (-1180.472) (-1178.914) (-1179.318) -- 0:00:54 Average standard deviation of split frequencies: 0.013070 250500 -- (-1179.066) [-1178.927] (-1181.569) (-1180.119) * (-1180.619) (-1179.050) (-1178.676) [-1181.787] -- 0:00:53 251000 -- [-1178.275] (-1179.382) (-1179.164) (-1180.119) * (-1178.589) (-1179.609) [-1180.724] (-1181.241) -- 0:00:53 251500 -- [-1180.231] (-1184.156) (-1179.022) (-1180.422) * (-1177.711) (-1178.509) (-1186.625) [-1180.511] -- 0:00:53 252000 -- (-1179.783) (-1180.830) [-1178.672] (-1179.200) * (-1179.379) (-1181.909) [-1177.965] (-1181.036) -- 0:00:53 252500 -- (-1178.398) [-1178.265] (-1178.080) (-1179.551) * [-1178.651] (-1186.061) (-1178.264) (-1181.071) -- 0:00:53 253000 -- (-1179.785) (-1179.949) [-1179.556] (-1181.477) * [-1179.115] (-1182.465) (-1180.656) (-1180.232) -- 0:00:53 253500 -- (-1181.167) [-1180.531] (-1179.955) (-1179.915) * [-1180.195] (-1181.199) (-1180.792) (-1179.425) -- 0:00:53 254000 -- (-1177.631) (-1178.373) [-1177.881] (-1180.354) * [-1180.678] (-1179.643) (-1180.195) (-1181.320) -- 0:00:52 254500 -- (-1177.681) [-1177.833] (-1181.606) (-1180.192) * (-1181.264) (-1179.060) (-1178.862) [-1179.394] -- 0:00:52 255000 -- [-1178.736] (-1177.912) (-1182.141) (-1182.290) * (-1180.522) (-1181.905) (-1180.459) [-1177.320] -- 0:00:52 Average standard deviation of split frequencies: 0.013811 255500 -- (-1177.037) [-1177.129] (-1178.465) (-1183.323) * (-1180.272) (-1177.746) (-1180.060) [-1178.767] -- 0:00:52 256000 -- (-1177.142) [-1178.146] (-1178.285) (-1183.439) * [-1178.674] (-1177.821) (-1181.361) (-1183.279) -- 0:00:52 256500 -- (-1178.307) (-1178.905) [-1179.193] (-1182.928) * (-1178.835) (-1177.841) (-1181.835) [-1179.964] -- 0:00:52 257000 -- (-1179.112) [-1180.278] (-1181.019) (-1181.996) * (-1178.322) (-1177.590) (-1179.287) [-1177.855] -- 0:00:54 257500 -- [-1178.061] (-1178.537) (-1179.256) (-1180.215) * (-1180.425) (-1178.731) [-1178.709] (-1178.009) -- 0:00:54 258000 -- (-1177.691) (-1178.821) [-1180.862] (-1179.967) * [-1181.909] (-1179.260) (-1180.223) (-1178.195) -- 0:00:54 258500 -- (-1178.830) [-1180.139] (-1177.958) (-1179.366) * (-1181.022) [-1178.653] (-1181.349) (-1177.796) -- 0:00:54 259000 -- (-1178.059) [-1179.875] (-1177.807) (-1182.293) * [-1180.728] (-1179.782) (-1181.429) (-1177.387) -- 0:00:54 259500 -- (-1179.225) (-1180.391) [-1179.194] (-1180.616) * (-1178.693) (-1178.622) (-1182.025) [-1177.403] -- 0:00:54 260000 -- (-1178.669) (-1179.035) (-1180.037) [-1179.230] * (-1180.393) (-1177.551) (-1181.711) [-1177.270] -- 0:00:54 Average standard deviation of split frequencies: 0.013563 260500 -- [-1182.245] (-1178.008) (-1183.355) (-1178.363) * (-1178.444) [-1179.015] (-1179.692) (-1178.752) -- 0:00:53 261000 -- (-1181.602) [-1178.806] (-1177.806) (-1180.448) * (-1180.402) (-1178.173) [-1179.819] (-1178.931) -- 0:00:53 261500 -- (-1180.085) (-1179.241) [-1179.261] (-1184.936) * (-1180.621) [-1178.790] (-1179.577) (-1185.768) -- 0:00:53 262000 -- [-1179.376] (-1181.106) (-1178.283) (-1183.775) * [-1180.095] (-1177.826) (-1182.399) (-1181.131) -- 0:00:53 262500 -- (-1179.805) [-1182.764] (-1178.633) (-1180.599) * (-1180.889) [-1182.194] (-1180.585) (-1179.489) -- 0:00:53 263000 -- (-1178.737) (-1181.217) (-1179.704) [-1180.642] * [-1182.413] (-1180.690) (-1179.487) (-1180.795) -- 0:00:53 263500 -- [-1178.642] (-1178.957) (-1179.135) (-1177.923) * (-1180.637) [-1178.976] (-1185.931) (-1178.408) -- 0:00:53 264000 -- (-1178.396) [-1179.876] (-1178.811) (-1177.689) * (-1180.158) [-1177.127] (-1177.743) (-1183.533) -- 0:00:52 264500 -- (-1182.550) (-1181.536) (-1179.571) [-1180.603] * (-1180.324) [-1177.013] (-1178.884) (-1188.368) -- 0:00:52 265000 -- (-1178.029) (-1178.884) [-1180.559] (-1179.914) * (-1180.548) [-1177.832] (-1180.082) (-1181.456) -- 0:00:52 Average standard deviation of split frequencies: 0.014089 265500 -- (-1180.148) (-1178.974) (-1182.690) [-1178.385] * (-1181.744) [-1179.193] (-1179.824) (-1182.558) -- 0:00:52 266000 -- (-1177.931) (-1180.543) [-1177.556] (-1179.823) * (-1180.215) [-1177.811] (-1180.810) (-1178.917) -- 0:00:52 266500 -- (-1178.876) [-1177.395] (-1179.633) (-1179.204) * (-1183.202) (-1178.049) [-1181.452] (-1178.734) -- 0:00:52 267000 -- (-1181.306) (-1179.287) (-1180.004) [-1178.483] * (-1182.674) [-1178.105] (-1179.564) (-1178.882) -- 0:00:52 267500 -- (-1180.220) (-1180.310) (-1181.574) [-1179.269] * (-1179.350) [-1179.377] (-1178.328) (-1179.058) -- 0:00:52 268000 -- (-1181.067) [-1178.082] (-1180.799) (-1179.406) * (-1179.107) (-1181.135) [-1177.845] (-1178.671) -- 0:00:51 268500 -- (-1179.997) [-1177.905] (-1182.560) (-1179.408) * (-1179.519) [-1179.194] (-1177.747) (-1179.148) -- 0:00:51 269000 -- [-1178.859] (-1178.266) (-1179.848) (-1181.830) * (-1178.806) [-1178.817] (-1178.984) (-1180.005) -- 0:00:51 269500 -- (-1178.890) [-1177.817] (-1178.696) (-1180.062) * [-1179.076] (-1179.749) (-1177.513) (-1178.349) -- 0:00:51 270000 -- (-1179.886) (-1179.855) [-1182.093] (-1179.000) * (-1181.093) (-1177.692) (-1178.340) [-1178.775] -- 0:00:54 Average standard deviation of split frequencies: 0.014575 270500 -- (-1177.959) [-1177.816] (-1181.359) (-1179.389) * (-1178.209) [-1177.929] (-1177.765) (-1177.880) -- 0:00:53 271000 -- [-1182.951] (-1177.222) (-1178.372) (-1180.360) * (-1181.601) [-1178.795] (-1179.728) (-1178.940) -- 0:00:53 271500 -- (-1178.073) (-1177.734) [-1177.144] (-1179.955) * [-1179.189] (-1177.534) (-1178.563) (-1177.961) -- 0:00:53 272000 -- (-1178.808) (-1178.301) (-1179.650) [-1180.212] * (-1180.550) (-1177.447) [-1179.490] (-1178.645) -- 0:00:53 272500 -- (-1178.668) [-1177.844] (-1177.219) (-1177.811) * [-1179.227] (-1178.132) (-1179.837) (-1177.741) -- 0:00:53 273000 -- [-1178.203] (-1183.949) (-1178.213) (-1178.884) * [-1180.551] (-1178.363) (-1180.475) (-1180.899) -- 0:00:53 273500 -- (-1178.191) (-1182.370) [-1177.426] (-1185.039) * (-1181.135) (-1178.409) (-1183.410) [-1180.544] -- 0:00:53 274000 -- (-1178.293) [-1182.218] (-1177.959) (-1181.426) * [-1178.396] (-1178.334) (-1181.720) (-1179.881) -- 0:00:52 274500 -- (-1179.665) (-1181.746) (-1178.246) [-1177.873] * (-1181.644) [-1180.110] (-1181.024) (-1179.165) -- 0:00:52 275000 -- (-1178.138) [-1178.778] (-1180.043) (-1180.895) * (-1181.242) (-1182.822) [-1179.466] (-1179.313) -- 0:00:52 Average standard deviation of split frequencies: 0.014518 275500 -- (-1180.346) (-1180.234) (-1178.840) [-1178.943] * [-1184.970] (-1181.987) (-1178.965) (-1177.482) -- 0:00:52 276000 -- (-1180.353) [-1178.327] (-1178.480) (-1177.708) * (-1182.129) (-1177.271) (-1179.681) [-1180.697] -- 0:00:52 276500 -- (-1180.443) (-1177.937) (-1177.796) [-1182.398] * (-1177.992) (-1179.333) (-1180.860) [-1180.339] -- 0:00:52 277000 -- (-1180.203) (-1179.231) [-1178.748] (-1184.117) * (-1177.356) (-1178.839) (-1181.184) [-1178.940] -- 0:00:52 277500 -- (-1179.060) [-1179.709] (-1179.070) (-1186.070) * (-1179.458) (-1178.905) (-1180.988) [-1180.746] -- 0:00:52 278000 -- [-1180.224] (-1181.975) (-1179.414) (-1179.574) * (-1177.982) [-1179.474] (-1182.124) (-1183.767) -- 0:00:51 278500 -- (-1178.506) (-1177.522) [-1182.427] (-1178.419) * (-1178.091) (-1180.038) [-1182.442] (-1184.579) -- 0:00:51 279000 -- [-1182.742] (-1179.572) (-1183.383) (-1180.090) * (-1180.134) (-1182.991) (-1178.857) [-1179.911] -- 0:00:51 279500 -- (-1181.318) [-1177.675] (-1179.419) (-1180.009) * (-1179.725) (-1179.870) [-1177.570] (-1179.120) -- 0:00:51 280000 -- [-1179.043] (-1180.470) (-1179.394) (-1179.487) * [-1179.720] (-1178.815) (-1179.630) (-1178.027) -- 0:00:51 Average standard deviation of split frequencies: 0.014232 280500 -- (-1179.285) (-1180.080) [-1179.510] (-1183.807) * (-1177.534) [-1177.099] (-1179.266) (-1177.787) -- 0:00:51 281000 -- (-1181.561) [-1178.020] (-1179.910) (-1181.024) * (-1177.820) (-1177.137) (-1181.804) [-1177.470] -- 0:00:51 281500 -- (-1179.823) (-1177.557) (-1178.981) [-1177.707] * (-1177.360) (-1180.923) [-1178.646] (-1178.068) -- 0:00:51 282000 -- (-1179.564) [-1178.207] (-1179.082) (-1178.854) * (-1177.358) (-1181.138) (-1177.438) [-1178.144] -- 0:00:50 282500 -- [-1185.571] (-1180.199) (-1179.202) (-1179.478) * (-1177.360) (-1182.826) [-1179.283] (-1177.960) -- 0:00:50 283000 -- (-1178.649) [-1180.875] (-1178.546) (-1177.444) * (-1180.319) [-1180.172] (-1179.618) (-1184.533) -- 0:00:50 283500 -- (-1178.622) (-1178.104) (-1178.406) [-1178.361] * (-1184.531) (-1183.597) (-1180.783) [-1183.961] -- 0:00:53 284000 -- [-1179.630] (-1181.153) (-1184.984) (-1178.069) * (-1185.973) [-1179.066] (-1178.313) (-1178.417) -- 0:00:52 284500 -- [-1177.975] (-1183.696) (-1178.995) (-1177.938) * (-1178.242) (-1177.821) [-1180.411] (-1178.085) -- 0:00:52 285000 -- (-1180.146) (-1180.988) (-1181.766) [-1177.920] * (-1179.968) [-1180.137] (-1178.207) (-1182.196) -- 0:00:52 Average standard deviation of split frequencies: 0.013893 285500 -- (-1177.786) (-1177.782) (-1183.171) [-1179.316] * (-1178.902) (-1177.641) (-1182.174) [-1179.693] -- 0:00:52 286000 -- (-1178.788) (-1180.655) [-1177.970] (-1179.514) * (-1179.474) (-1179.318) [-1178.950] (-1179.210) -- 0:00:52 286500 -- (-1178.283) (-1179.437) [-1177.893] (-1180.133) * [-1179.288] (-1180.080) (-1179.343) (-1178.351) -- 0:00:52 287000 -- (-1178.314) (-1179.640) [-1177.857] (-1178.904) * [-1178.545] (-1179.703) (-1178.239) (-1177.386) -- 0:00:52 287500 -- [-1179.660] (-1179.669) (-1178.255) (-1178.081) * (-1183.158) (-1182.009) (-1177.353) [-1177.725] -- 0:00:52 288000 -- (-1182.607) [-1183.901] (-1179.021) (-1179.019) * [-1179.969] (-1189.161) (-1177.353) (-1180.293) -- 0:00:51 288500 -- (-1181.912) (-1179.704) (-1181.206) [-1178.857] * (-1179.570) [-1179.929] (-1178.289) (-1179.332) -- 0:00:51 289000 -- (-1179.388) (-1177.857) [-1180.986] (-1181.291) * (-1178.758) [-1179.870] (-1178.938) (-1179.205) -- 0:00:51 289500 -- (-1178.271) (-1178.238) (-1182.068) [-1179.249] * [-1180.005] (-1181.936) (-1178.783) (-1177.843) -- 0:00:51 290000 -- [-1178.332] (-1177.555) (-1182.103) (-1179.478) * (-1179.466) (-1184.537) [-1177.930] (-1178.373) -- 0:00:51 Average standard deviation of split frequencies: 0.014426 290500 -- (-1181.070) [-1177.469] (-1184.235) (-1179.480) * (-1183.643) (-1186.532) (-1177.820) [-1179.447] -- 0:00:51 291000 -- (-1177.680) [-1177.724] (-1179.676) (-1180.220) * (-1178.250) (-1181.852) [-1178.729] (-1180.051) -- 0:00:51 291500 -- [-1179.583] (-1183.657) (-1177.696) (-1181.899) * (-1180.417) [-1181.082] (-1180.719) (-1178.508) -- 0:00:51 292000 -- (-1178.999) (-1179.987) (-1177.690) [-1182.369] * (-1177.571) [-1180.493] (-1180.997) (-1180.953) -- 0:00:50 292500 -- (-1178.318) (-1178.405) [-1178.123] (-1181.425) * (-1178.314) (-1180.406) [-1177.938] (-1180.665) -- 0:00:50 293000 -- (-1178.322) [-1179.943] (-1179.917) (-1179.246) * (-1183.609) (-1180.768) [-1181.874] (-1182.527) -- 0:00:50 293500 -- (-1177.932) (-1182.052) [-1182.096] (-1179.068) * (-1181.464) (-1179.197) [-1184.537] (-1183.370) -- 0:00:50 294000 -- [-1178.704] (-1183.258) (-1182.276) (-1178.182) * (-1180.118) (-1182.162) (-1183.615) [-1179.534] -- 0:00:50 294500 -- (-1179.725) (-1177.203) (-1186.696) [-1178.490] * (-1180.198) (-1182.173) (-1182.051) [-1180.468] -- 0:00:50 295000 -- [-1177.980] (-1178.071) (-1185.216) (-1179.198) * (-1177.808) (-1178.186) [-1179.473] (-1177.965) -- 0:00:50 Average standard deviation of split frequencies: 0.014585 295500 -- (-1178.854) (-1178.147) [-1179.122] (-1177.837) * (-1177.817) (-1181.940) [-1178.851] (-1179.598) -- 0:00:50 296000 -- [-1179.223] (-1179.709) (-1179.705) (-1180.799) * (-1178.663) (-1180.336) (-1179.230) [-1183.101] -- 0:00:49 296500 -- (-1184.637) (-1180.362) (-1179.616) [-1185.155] * (-1180.685) (-1182.327) (-1178.846) [-1178.675] -- 0:00:49 297000 -- (-1180.873) (-1179.584) [-1181.700] (-1179.709) * (-1183.028) (-1178.568) [-1178.239] (-1178.333) -- 0:00:52 297500 -- (-1179.347) [-1178.140] (-1178.663) (-1181.524) * (-1178.165) (-1182.949) (-1178.634) [-1177.952] -- 0:00:51 298000 -- (-1177.908) (-1177.814) [-1178.693] (-1177.808) * [-1177.290] (-1180.399) (-1180.251) (-1178.295) -- 0:00:51 298500 -- (-1177.810) (-1178.228) [-1178.020] (-1179.179) * (-1181.801) [-1178.810] (-1179.555) (-1180.461) -- 0:00:51 299000 -- [-1178.052] (-1178.473) (-1179.916) (-1179.609) * [-1179.170] (-1178.908) (-1180.799) (-1179.751) -- 0:00:51 299500 -- (-1178.305) (-1177.693) (-1180.441) [-1177.257] * (-1178.200) (-1178.797) (-1180.695) [-1182.389] -- 0:00:51 300000 -- (-1181.000) (-1182.287) [-1179.144] (-1178.878) * (-1178.405) (-1178.277) [-1179.381] (-1180.996) -- 0:00:51 Average standard deviation of split frequencies: 0.014808 300500 -- (-1179.123) (-1179.230) [-1179.285] (-1179.850) * [-1178.843] (-1178.695) (-1183.037) (-1180.547) -- 0:00:51 301000 -- [-1177.644] (-1181.535) (-1178.666) (-1178.657) * [-1180.349] (-1180.484) (-1179.268) (-1179.070) -- 0:00:51 301500 -- [-1177.495] (-1182.211) (-1179.403) (-1177.072) * (-1180.453) (-1178.697) [-1181.531] (-1178.000) -- 0:00:50 302000 -- (-1177.506) (-1180.919) [-1181.529] (-1177.676) * (-1183.246) [-1178.548] (-1178.220) (-1178.792) -- 0:00:50 302500 -- (-1177.360) (-1182.173) (-1178.489) [-1180.967] * (-1183.783) (-1179.143) (-1178.972) [-1179.832] -- 0:00:50 303000 -- (-1181.861) [-1177.432] (-1178.189) (-1179.704) * (-1181.914) (-1179.742) [-1178.853] (-1178.463) -- 0:00:50 303500 -- [-1179.252] (-1177.706) (-1179.377) (-1181.504) * (-1181.798) (-1180.278) [-1177.528] (-1178.981) -- 0:00:50 304000 -- (-1180.172) (-1178.489) [-1180.508] (-1178.359) * [-1181.768] (-1179.571) (-1177.946) (-1180.347) -- 0:00:50 304500 -- (-1177.645) (-1178.712) [-1179.303] (-1177.437) * [-1178.186] (-1180.309) (-1178.538) (-1179.714) -- 0:00:50 305000 -- (-1177.777) [-1178.781] (-1179.167) (-1177.121) * (-1179.761) [-1182.305] (-1178.250) (-1179.788) -- 0:00:50 Average standard deviation of split frequencies: 0.016090 305500 -- (-1178.076) (-1182.484) (-1178.091) [-1177.634] * (-1179.527) (-1180.855) (-1182.205) [-1181.607] -- 0:00:50 306000 -- (-1178.077) [-1180.022] (-1178.123) (-1188.092) * (-1178.941) (-1179.088) [-1178.424] (-1185.623) -- 0:00:49 306500 -- (-1178.134) (-1180.787) (-1179.166) [-1178.216] * [-1178.309] (-1179.451) (-1177.967) (-1181.016) -- 0:00:49 307000 -- [-1178.720] (-1182.627) (-1178.000) (-1179.341) * (-1181.911) [-1180.207] (-1177.741) (-1181.619) -- 0:00:49 307500 -- [-1178.671] (-1181.004) (-1182.978) (-1178.020) * [-1177.849] (-1177.747) (-1180.094) (-1180.409) -- 0:00:49 308000 -- [-1179.681] (-1178.312) (-1179.901) (-1180.589) * [-1178.251] (-1180.270) (-1181.230) (-1177.186) -- 0:00:49 308500 -- (-1178.710) (-1183.526) (-1179.937) [-1177.795] * (-1181.742) [-1179.671] (-1185.556) (-1177.231) -- 0:00:49 309000 -- (-1178.722) (-1179.457) [-1180.448] (-1178.968) * [-1181.402] (-1182.019) (-1178.023) (-1180.499) -- 0:00:49 309500 -- (-1177.975) (-1181.835) (-1179.639) [-1180.112] * [-1184.216] (-1178.097) (-1181.201) (-1180.037) -- 0:00:49 310000 -- (-1180.277) [-1179.141] (-1177.460) (-1184.549) * (-1182.430) [-1179.285] (-1180.451) (-1180.034) -- 0:00:48 Average standard deviation of split frequencies: 0.015174 310500 -- (-1179.586) [-1179.115] (-1177.900) (-1178.646) * (-1181.264) [-1179.119] (-1179.007) (-1179.747) -- 0:00:48 311000 -- (-1180.901) (-1181.283) [-1177.703] (-1179.988) * (-1178.256) [-1179.826] (-1181.495) (-1178.230) -- 0:00:48 311500 -- (-1180.608) (-1179.780) (-1179.410) [-1180.510] * (-1177.403) (-1182.306) [-1178.300] (-1181.708) -- 0:00:50 312000 -- (-1180.730) [-1179.712] (-1179.381) (-1179.862) * (-1181.836) (-1178.524) (-1178.435) [-1179.900] -- 0:00:50 312500 -- [-1181.343] (-1180.043) (-1178.310) (-1182.157) * (-1184.794) (-1178.255) [-1178.246] (-1179.200) -- 0:00:50 313000 -- (-1184.365) [-1177.577] (-1178.453) (-1179.728) * (-1181.959) (-1180.233) [-1178.012] (-1178.961) -- 0:00:50 313500 -- (-1182.828) (-1181.367) (-1179.261) [-1181.870] * [-1182.796] (-1180.373) (-1179.598) (-1183.848) -- 0:00:50 314000 -- (-1181.726) [-1180.594] (-1180.528) (-1180.444) * (-1177.541) (-1179.316) [-1180.793] (-1181.936) -- 0:00:50 314500 -- (-1179.945) (-1177.392) [-1177.909] (-1179.636) * (-1177.898) [-1179.462] (-1179.922) (-1181.614) -- 0:00:50 315000 -- (-1184.214) (-1179.563) (-1178.074) [-1177.872] * (-1178.317) [-1177.556] (-1180.497) (-1185.769) -- 0:00:50 Average standard deviation of split frequencies: 0.014089 315500 -- (-1180.149) [-1178.765] (-1178.863) (-1178.682) * (-1178.412) (-1177.595) (-1177.599) [-1182.366] -- 0:00:49 316000 -- [-1178.624] (-1177.355) (-1179.157) (-1183.189) * (-1183.915) (-1181.675) [-1180.909] (-1179.349) -- 0:00:49 316500 -- [-1178.626] (-1180.889) (-1179.977) (-1182.632) * [-1179.910] (-1183.466) (-1178.917) (-1179.998) -- 0:00:49 317000 -- [-1180.181] (-1177.315) (-1180.231) (-1179.876) * (-1179.828) (-1179.216) [-1181.621] (-1180.735) -- 0:00:49 317500 -- (-1179.567) (-1183.379) (-1181.075) [-1178.130] * [-1182.437] (-1180.106) (-1179.029) (-1184.540) -- 0:00:49 318000 -- [-1177.687] (-1180.171) (-1179.755) (-1178.181) * (-1179.600) (-1179.957) [-1183.918] (-1179.844) -- 0:00:49 318500 -- [-1178.557] (-1180.263) (-1180.861) (-1182.865) * (-1178.876) (-1178.440) [-1180.571] (-1178.346) -- 0:00:49 319000 -- [-1177.491] (-1180.859) (-1181.656) (-1180.485) * [-1177.778] (-1184.121) (-1179.378) (-1179.451) -- 0:00:49 319500 -- (-1177.961) (-1183.095) (-1181.604) [-1178.606] * (-1178.106) [-1177.735] (-1180.571) (-1180.038) -- 0:00:48 320000 -- (-1177.926) (-1180.103) (-1181.559) [-1179.571] * (-1178.807) (-1177.750) (-1178.463) [-1180.633] -- 0:00:48 Average standard deviation of split frequencies: 0.013721 320500 -- (-1178.135) (-1181.276) [-1178.294] (-1182.674) * (-1177.350) [-1179.596] (-1180.374) (-1179.703) -- 0:00:48 321000 -- (-1180.443) [-1181.903] (-1178.712) (-1182.567) * [-1177.763] (-1177.652) (-1181.654) (-1179.105) -- 0:00:48 321500 -- [-1179.191] (-1179.325) (-1181.370) (-1177.730) * (-1178.587) [-1177.560] (-1179.715) (-1179.679) -- 0:00:48 322000 -- (-1179.033) (-1179.906) (-1182.439) [-1177.350] * (-1177.664) [-1178.375] (-1177.170) (-1179.474) -- 0:00:48 322500 -- (-1178.137) (-1178.813) (-1188.110) [-1177.376] * (-1181.558) (-1178.744) (-1179.154) [-1179.425] -- 0:00:48 323000 -- (-1182.033) (-1179.516) (-1187.285) [-1177.351] * (-1180.203) (-1178.690) [-1177.722] (-1179.093) -- 0:00:48 323500 -- (-1180.446) (-1178.764) (-1179.898) [-1177.344] * (-1188.738) (-1178.231) (-1179.012) [-1179.310] -- 0:00:48 324000 -- (-1178.590) [-1178.831] (-1180.222) (-1181.992) * (-1183.359) (-1179.557) (-1177.309) [-1180.864] -- 0:00:47 324500 -- [-1180.362] (-1179.878) (-1180.473) (-1182.371) * (-1184.265) [-1181.587] (-1178.247) (-1183.595) -- 0:00:49 325000 -- (-1182.189) [-1181.837] (-1177.401) (-1183.976) * [-1179.329] (-1185.862) (-1178.246) (-1178.886) -- 0:00:49 Average standard deviation of split frequencies: 0.014380 325500 -- [-1178.591] (-1180.802) (-1179.457) (-1181.594) * [-1177.639] (-1179.480) (-1178.212) (-1180.030) -- 0:00:49 326000 -- (-1178.718) (-1177.891) [-1179.419] (-1179.047) * (-1178.757) (-1178.665) [-1178.678] (-1180.174) -- 0:00:49 326500 -- (-1178.267) (-1180.891) [-1178.384] (-1178.938) * (-1178.919) [-1180.989] (-1178.666) (-1179.355) -- 0:00:49 327000 -- (-1181.587) (-1180.144) (-1179.433) [-1180.376] * (-1180.722) (-1180.416) [-1177.921] (-1179.103) -- 0:00:49 327500 -- (-1181.618) (-1182.128) [-1178.976] (-1182.734) * (-1179.504) (-1179.878) (-1178.039) [-1178.424] -- 0:00:49 328000 -- [-1177.685] (-1181.723) (-1183.465) (-1182.625) * (-1182.495) (-1178.640) (-1179.287) [-1178.483] -- 0:00:49 328500 -- (-1182.453) [-1177.890] (-1181.262) (-1181.832) * (-1180.574) (-1178.050) (-1179.156) [-1177.451] -- 0:00:49 329000 -- [-1178.217] (-1179.354) (-1182.213) (-1178.263) * (-1186.013) [-1179.207] (-1179.647) (-1177.534) -- 0:00:48 329500 -- (-1179.462) [-1177.586] (-1182.153) (-1177.863) * (-1185.052) [-1179.239] (-1181.985) (-1178.999) -- 0:00:48 330000 -- [-1177.875] (-1178.154) (-1180.545) (-1180.148) * (-1187.260) (-1178.642) (-1177.714) [-1181.488] -- 0:00:48 Average standard deviation of split frequencies: 0.014019 330500 -- (-1177.876) (-1184.670) [-1178.408] (-1179.211) * [-1181.803] (-1178.547) (-1180.602) (-1180.888) -- 0:00:48 331000 -- [-1180.136] (-1178.851) (-1179.511) (-1179.688) * (-1183.297) (-1180.784) [-1181.281] (-1179.422) -- 0:00:48 331500 -- (-1178.630) (-1183.509) (-1179.191) [-1178.995] * [-1178.234] (-1182.809) (-1177.483) (-1178.226) -- 0:00:48 332000 -- (-1181.761) (-1177.757) [-1180.575] (-1185.335) * (-1181.415) [-1178.963] (-1179.824) (-1178.900) -- 0:00:48 332500 -- (-1178.572) (-1180.828) (-1182.499) [-1177.877] * [-1178.206] (-1180.296) (-1178.804) (-1180.021) -- 0:00:48 333000 -- (-1178.230) [-1178.152] (-1178.029) (-1178.883) * (-1178.921) [-1177.253] (-1178.614) (-1180.716) -- 0:00:48 333500 -- [-1178.273] (-1178.424) (-1179.429) (-1178.313) * [-1177.935] (-1179.394) (-1182.594) (-1180.716) -- 0:00:47 334000 -- (-1178.359) [-1181.938] (-1180.530) (-1178.980) * (-1178.476) [-1180.311] (-1179.358) (-1186.094) -- 0:00:47 334500 -- (-1181.997) [-1179.095] (-1177.879) (-1177.232) * (-1179.246) (-1177.501) [-1179.733] (-1179.460) -- 0:00:47 335000 -- [-1177.780] (-1179.989) (-1181.876) (-1178.050) * [-1180.206] (-1179.116) (-1178.418) (-1184.382) -- 0:00:47 Average standard deviation of split frequencies: 0.013095 335500 -- (-1177.932) [-1178.808] (-1181.428) (-1178.160) * (-1178.663) (-1177.789) (-1178.157) [-1181.091] -- 0:00:47 336000 -- (-1181.492) (-1178.394) [-1179.771] (-1178.471) * (-1179.191) [-1180.511] (-1181.147) (-1191.233) -- 0:00:47 336500 -- (-1179.009) (-1178.415) (-1177.674) [-1178.583] * (-1177.949) (-1180.398) (-1179.992) [-1180.330] -- 0:00:47 337000 -- [-1179.135] (-1178.570) (-1180.522) (-1178.583) * [-1178.406] (-1180.675) (-1178.151) (-1182.295) -- 0:00:47 337500 -- (-1178.649) (-1177.081) (-1189.620) [-1177.311] * (-1180.612) [-1179.330] (-1179.197) (-1182.312) -- 0:00:47 338000 -- [-1179.124] (-1182.719) (-1180.172) (-1179.024) * (-1178.289) (-1178.764) [-1178.903] (-1179.656) -- 0:00:48 338500 -- (-1183.466) [-1180.566] (-1179.715) (-1179.738) * [-1178.235] (-1181.063) (-1178.478) (-1178.766) -- 0:00:48 339000 -- [-1183.721] (-1180.852) (-1178.633) (-1178.564) * [-1180.092] (-1182.361) (-1177.991) (-1182.037) -- 0:00:48 339500 -- (-1182.118) (-1180.089) (-1177.658) [-1179.335] * (-1178.250) [-1178.728] (-1179.060) (-1178.140) -- 0:00:48 340000 -- (-1179.566) [-1179.160] (-1179.965) (-1180.663) * (-1179.124) [-1179.597] (-1180.844) (-1178.285) -- 0:00:48 Average standard deviation of split frequencies: 0.013105 340500 -- (-1178.465) (-1181.384) [-1179.903] (-1179.075) * (-1180.012) (-1180.304) (-1181.571) [-1177.945] -- 0:00:48 341000 -- (-1178.153) (-1179.950) (-1179.331) [-1178.222] * (-1180.000) [-1179.712] (-1179.442) (-1179.586) -- 0:00:48 341500 -- (-1179.243) [-1177.731] (-1178.596) (-1180.199) * (-1178.806) [-1182.178] (-1180.840) (-1178.843) -- 0:00:48 342000 -- (-1179.437) (-1177.885) (-1182.746) [-1181.065] * (-1179.409) (-1180.416) [-1179.288] (-1178.868) -- 0:00:48 342500 -- (-1181.960) (-1177.723) [-1178.044] (-1179.915) * (-1178.251) (-1180.632) [-1179.282] (-1178.700) -- 0:00:47 343000 -- (-1182.486) (-1179.189) [-1177.908] (-1179.405) * (-1177.775) (-1180.764) [-1179.736] (-1181.098) -- 0:00:47 343500 -- (-1179.133) (-1178.561) (-1177.800) [-1178.149] * (-1177.716) (-1181.254) [-1181.026] (-1182.817) -- 0:00:47 344000 -- [-1180.094] (-1179.762) (-1179.845) (-1183.257) * [-1178.075] (-1180.683) (-1179.557) (-1178.061) -- 0:00:47 344500 -- (-1182.489) [-1178.348] (-1184.115) (-1178.963) * (-1177.722) (-1179.624) (-1179.715) [-1181.162] -- 0:00:47 345000 -- (-1180.850) (-1181.021) [-1182.333] (-1178.567) * (-1177.998) (-1178.214) (-1180.059) [-1181.107] -- 0:00:47 Average standard deviation of split frequencies: 0.013927 345500 -- (-1177.770) (-1183.437) [-1181.842] (-1180.360) * (-1177.870) (-1183.081) [-1178.307] (-1179.385) -- 0:00:47 346000 -- (-1179.779) [-1182.365] (-1181.370) (-1179.397) * (-1179.624) [-1183.268] (-1179.905) (-1181.300) -- 0:00:47 346500 -- (-1180.244) [-1181.106] (-1177.873) (-1177.938) * (-1188.163) (-1179.116) (-1178.189) [-1177.540] -- 0:00:47 347000 -- (-1178.829) (-1178.754) (-1179.136) [-1179.975] * (-1189.808) [-1177.913] (-1177.650) (-1179.682) -- 0:00:47 347500 -- [-1178.788] (-1184.765) (-1182.000) (-1178.810) * (-1180.057) (-1180.343) [-1179.451] (-1178.174) -- 0:00:46 348000 -- (-1179.193) [-1185.476] (-1178.894) (-1180.666) * (-1182.692) (-1179.580) [-1179.731] (-1178.526) -- 0:00:46 348500 -- (-1178.482) (-1185.082) [-1179.206] (-1178.686) * [-1182.408] (-1182.906) (-1179.279) (-1184.875) -- 0:00:46 349000 -- (-1181.484) (-1180.211) [-1178.933] (-1180.163) * (-1178.596) (-1181.624) [-1180.942] (-1180.569) -- 0:00:46 349500 -- [-1178.875] (-1180.042) (-1180.134) (-1181.949) * (-1178.450) (-1181.101) [-1178.803] (-1185.234) -- 0:00:46 350000 -- [-1180.146] (-1184.538) (-1178.996) (-1179.108) * [-1179.721] (-1182.062) (-1179.092) (-1177.349) -- 0:00:46 Average standard deviation of split frequencies: 0.013667 350500 -- (-1179.921) [-1179.981] (-1178.916) (-1181.524) * (-1178.325) [-1186.367] (-1181.713) (-1178.648) -- 0:00:46 351000 -- (-1177.847) (-1181.321) [-1178.300] (-1180.078) * (-1177.580) (-1178.958) [-1177.794] (-1180.939) -- 0:00:46 351500 -- (-1179.581) [-1177.286] (-1179.175) (-1178.273) * (-1178.149) (-1178.264) [-1179.473] (-1181.746) -- 0:00:47 352000 -- (-1181.876) [-1178.635] (-1180.188) (-1178.606) * (-1180.947) (-1177.981) [-1179.066] (-1181.468) -- 0:00:47 352500 -- [-1181.677] (-1181.719) (-1180.454) (-1179.654) * (-1181.821) (-1180.058) (-1180.098) [-1179.330] -- 0:00:47 353000 -- (-1182.733) (-1179.224) (-1181.556) [-1178.640] * (-1180.224) (-1179.416) [-1178.736] (-1177.922) -- 0:00:47 353500 -- (-1177.557) [-1179.986] (-1182.624) (-1178.627) * (-1180.313) [-1178.578] (-1178.228) (-1178.470) -- 0:00:47 354000 -- (-1179.505) (-1180.669) (-1181.096) [-1177.683] * (-1179.951) (-1179.950) (-1182.139) [-1179.593] -- 0:00:47 354500 -- (-1178.067) [-1177.584] (-1182.169) (-1177.013) * (-1184.254) (-1181.404) (-1178.281) [-1179.981] -- 0:00:47 355000 -- (-1182.773) (-1178.207) [-1182.979] (-1178.022) * (-1180.714) (-1179.112) [-1177.832] (-1178.793) -- 0:00:47 Average standard deviation of split frequencies: 0.014051 355500 -- (-1180.162) (-1180.082) [-1180.302] (-1177.854) * (-1177.889) [-1178.616] (-1179.176) (-1178.164) -- 0:00:47 356000 -- (-1179.016) [-1179.069] (-1177.955) (-1178.946) * [-1179.936] (-1183.211) (-1179.187) (-1177.996) -- 0:00:47 356500 -- [-1181.392] (-1179.984) (-1178.595) (-1180.278) * [-1178.204] (-1177.329) (-1179.164) (-1178.027) -- 0:00:46 357000 -- (-1182.600) (-1178.228) (-1186.574) [-1179.468] * (-1180.055) (-1179.832) [-1179.698] (-1178.490) -- 0:00:46 357500 -- (-1178.982) (-1178.639) [-1181.001] (-1182.257) * (-1179.996) [-1179.906] (-1181.042) (-1178.998) -- 0:00:46 358000 -- (-1178.912) (-1177.840) (-1180.228) [-1178.192] * (-1183.345) (-1178.590) (-1181.212) [-1180.113] -- 0:00:46 358500 -- (-1184.100) [-1177.700] (-1180.712) (-1178.448) * (-1179.442) [-1188.043] (-1180.744) (-1178.092) -- 0:00:46 359000 -- [-1185.912] (-1178.491) (-1178.572) (-1179.250) * (-1179.492) (-1181.674) (-1178.999) [-1178.123] -- 0:00:46 359500 -- (-1181.124) (-1179.104) [-1178.459] (-1177.783) * (-1181.209) (-1181.161) (-1182.354) [-1178.499] -- 0:00:46 360000 -- (-1180.319) [-1178.325] (-1180.141) (-1179.048) * [-1178.267] (-1183.712) (-1184.198) (-1178.630) -- 0:00:46 Average standard deviation of split frequencies: 0.014160 360500 -- (-1180.720) (-1178.887) (-1178.995) [-1177.338] * [-1179.177] (-1180.257) (-1181.180) (-1178.235) -- 0:00:46 361000 -- (-1180.687) (-1177.999) (-1178.927) [-1177.704] * (-1177.942) [-1179.156] (-1178.903) (-1177.815) -- 0:00:46 361500 -- (-1184.302) (-1179.219) [-1178.026] (-1177.417) * (-1178.863) (-1181.111) (-1179.347) [-1178.650] -- 0:00:45 362000 -- [-1178.374] (-1179.603) (-1177.021) (-1178.681) * (-1177.814) (-1181.447) [-1178.529] (-1181.473) -- 0:00:45 362500 -- (-1177.790) (-1178.790) (-1177.564) [-1181.962] * (-1177.827) [-1178.522] (-1178.225) (-1178.611) -- 0:00:45 363000 -- (-1177.672) (-1180.348) (-1178.901) [-1178.539] * [-1182.729] (-1184.022) (-1178.047) (-1182.616) -- 0:00:45 363500 -- [-1178.169] (-1178.384) (-1181.102) (-1182.485) * (-1185.725) [-1180.986] (-1178.088) (-1180.159) -- 0:00:45 364000 -- (-1179.756) [-1178.349] (-1179.012) (-1181.835) * [-1180.873] (-1181.056) (-1179.604) (-1179.646) -- 0:00:45 364500 -- (-1177.990) [-1178.578] (-1179.503) (-1179.863) * (-1179.434) (-1178.384) (-1181.135) [-1182.043] -- 0:00:45 365000 -- (-1179.033) (-1179.995) [-1180.176] (-1179.260) * (-1179.391) (-1178.075) [-1178.793] (-1178.577) -- 0:00:46 Average standard deviation of split frequencies: 0.014311 365500 -- (-1178.788) [-1180.248] (-1179.101) (-1180.658) * [-1179.324] (-1178.092) (-1179.453) (-1179.294) -- 0:00:46 366000 -- (-1182.068) [-1181.291] (-1178.985) (-1178.446) * (-1178.609) (-1178.092) [-1181.823] (-1178.354) -- 0:00:46 366500 -- (-1183.236) (-1181.198) [-1179.895] (-1179.531) * (-1178.904) (-1179.140) [-1179.282] (-1180.421) -- 0:00:46 367000 -- (-1184.389) (-1179.282) (-1178.843) [-1179.432] * (-1180.843) (-1178.561) (-1183.594) [-1179.219] -- 0:00:46 367500 -- (-1180.103) (-1181.114) (-1177.411) [-1178.449] * [-1180.921] (-1177.477) (-1182.775) (-1179.826) -- 0:00:46 368000 -- (-1180.191) (-1178.292) (-1179.100) [-1178.130] * (-1179.997) (-1177.520) (-1183.472) [-1177.677] -- 0:00:46 368500 -- (-1184.918) (-1185.167) [-1182.250] (-1180.042) * (-1180.230) [-1178.645] (-1180.681) (-1181.761) -- 0:00:46 369000 -- (-1179.230) [-1182.329] (-1180.160) (-1180.184) * (-1177.966) [-1178.835] (-1181.521) (-1181.304) -- 0:00:46 369500 -- (-1182.526) (-1179.876) [-1179.897] (-1181.808) * [-1178.116] (-1178.636) (-1180.186) (-1179.383) -- 0:00:46 370000 -- [-1180.430] (-1179.078) (-1179.607) (-1178.597) * [-1178.054] (-1177.913) (-1178.777) (-1178.239) -- 0:00:45 Average standard deviation of split frequencies: 0.014257 370500 -- (-1179.021) [-1179.359] (-1180.700) (-1178.625) * [-1177.680] (-1179.597) (-1179.871) (-1179.268) -- 0:00:45 371000 -- (-1177.663) (-1179.512) [-1180.737] (-1180.416) * (-1179.253) [-1183.401] (-1180.384) (-1181.147) -- 0:00:45 371500 -- (-1180.256) [-1184.541] (-1181.629) (-1178.390) * (-1179.585) [-1181.827] (-1180.461) (-1178.319) -- 0:00:45 372000 -- (-1180.822) (-1180.421) (-1183.348) [-1182.058] * (-1177.915) (-1180.659) [-1181.573] (-1180.728) -- 0:00:45 372500 -- (-1180.600) [-1179.557] (-1179.111) (-1181.657) * [-1178.871] (-1180.891) (-1180.390) (-1178.237) -- 0:00:45 373000 -- [-1184.603] (-1180.185) (-1177.574) (-1185.056) * (-1181.417) [-1181.031] (-1177.703) (-1178.480) -- 0:00:45 373500 -- (-1183.870) (-1179.571) (-1183.524) [-1178.658] * (-1182.589) (-1180.388) (-1177.818) [-1178.299] -- 0:00:45 374000 -- (-1180.304) (-1179.443) [-1181.836] (-1181.590) * (-1181.108) [-1179.368] (-1177.790) (-1178.303) -- 0:00:45 374500 -- (-1180.118) (-1182.634) (-1180.549) [-1179.324] * (-1177.940) (-1179.662) [-1177.126] (-1178.069) -- 0:00:45 375000 -- (-1178.977) (-1180.926) (-1182.601) [-1182.450] * (-1178.074) (-1178.867) [-1180.659] (-1181.676) -- 0:00:45 Average standard deviation of split frequencies: 0.013721 375500 -- (-1178.984) (-1180.551) [-1178.613] (-1181.578) * (-1179.028) [-1178.990] (-1178.358) (-1179.055) -- 0:00:44 376000 -- (-1178.071) (-1180.095) [-1178.244] (-1181.171) * (-1179.415) (-1179.003) (-1181.521) [-1178.054] -- 0:00:44 376500 -- (-1178.010) [-1181.331] (-1182.118) (-1178.946) * (-1180.090) (-1178.541) (-1181.280) [-1179.084] -- 0:00:44 377000 -- (-1178.847) (-1179.144) [-1181.397] (-1181.089) * (-1178.183) (-1178.790) (-1178.571) [-1178.244] -- 0:00:44 377500 -- (-1181.127) [-1179.373] (-1179.444) (-1178.812) * (-1178.345) (-1180.412) [-1178.756] (-1182.122) -- 0:00:44 378000 -- (-1177.421) (-1182.754) (-1179.198) [-1179.987] * (-1178.350) (-1180.569) (-1177.851) [-1180.066] -- 0:00:44 378500 -- (-1179.071) [-1179.546] (-1178.773) (-1177.249) * (-1179.336) (-1181.149) [-1177.089] (-1181.346) -- 0:00:45 379000 -- [-1182.378] (-1178.653) (-1180.557) (-1177.642) * (-1181.951) [-1179.576] (-1178.378) (-1180.332) -- 0:00:45 379500 -- [-1178.364] (-1179.338) (-1181.000) (-1180.482) * (-1177.121) (-1180.600) (-1179.525) [-1179.993] -- 0:00:45 380000 -- [-1180.007] (-1185.148) (-1182.043) (-1179.768) * (-1180.020) (-1182.736) [-1178.391] (-1179.173) -- 0:00:45 Average standard deviation of split frequencies: 0.013687 380500 -- (-1178.893) (-1181.090) (-1182.895) [-1181.456] * [-1178.570] (-1179.071) (-1180.092) (-1185.783) -- 0:00:45 381000 -- (-1178.300) [-1178.688] (-1178.963) (-1181.082) * (-1181.605) [-1179.443] (-1180.470) (-1187.562) -- 0:00:45 381500 -- [-1179.328] (-1179.728) (-1178.643) (-1179.729) * [-1178.270] (-1179.677) (-1184.069) (-1181.609) -- 0:00:45 382000 -- (-1178.606) (-1182.320) [-1180.726] (-1179.851) * [-1178.477] (-1181.759) (-1178.912) (-1180.150) -- 0:00:45 382500 -- (-1177.493) (-1181.548) (-1179.960) [-1178.829] * (-1180.831) [-1182.161] (-1182.867) (-1180.538) -- 0:00:45 383000 -- (-1177.116) (-1178.239) [-1179.061] (-1179.451) * (-1184.895) (-1179.372) (-1182.484) [-1180.862] -- 0:00:45 383500 -- (-1177.654) (-1178.208) (-1178.704) [-1177.856] * (-1181.589) [-1181.525] (-1177.405) (-1178.256) -- 0:00:45 384000 -- (-1177.875) [-1179.299] (-1179.510) (-1181.089) * [-1179.601] (-1178.105) (-1180.115) (-1177.630) -- 0:00:44 384500 -- [-1180.978] (-1178.160) (-1179.645) (-1179.413) * (-1180.298) (-1177.747) [-1179.046] (-1181.206) -- 0:00:44 385000 -- [-1177.551] (-1177.914) (-1177.530) (-1177.880) * [-1179.261] (-1178.706) (-1177.556) (-1182.405) -- 0:00:44 Average standard deviation of split frequencies: 0.014105 385500 -- (-1178.539) (-1180.226) [-1177.117] (-1180.111) * (-1180.128) (-1180.004) [-1178.976] (-1181.410) -- 0:00:44 386000 -- (-1179.905) (-1178.463) [-1177.837] (-1179.416) * (-1177.781) [-1179.415] (-1178.863) (-1180.524) -- 0:00:44 386500 -- (-1180.200) (-1179.934) (-1182.163) [-1185.125] * (-1177.432) (-1181.122) [-1178.925] (-1177.742) -- 0:00:44 387000 -- [-1186.107] (-1180.764) (-1182.494) (-1179.872) * (-1178.718) (-1180.382) (-1180.641) [-1178.761] -- 0:00:44 387500 -- (-1181.139) [-1178.506] (-1182.561) (-1179.987) * [-1178.767] (-1180.623) (-1181.224) (-1179.985) -- 0:00:44 388000 -- (-1182.135) [-1178.074] (-1179.465) (-1181.996) * [-1178.653] (-1181.936) (-1179.223) (-1178.824) -- 0:00:44 388500 -- (-1183.006) [-1178.672] (-1178.712) (-1181.652) * (-1178.352) (-1178.632) [-1178.629] (-1182.021) -- 0:00:44 389000 -- [-1180.101] (-1180.871) (-1179.390) (-1178.125) * [-1179.150] (-1179.565) (-1186.863) (-1180.669) -- 0:00:43 389500 -- (-1183.930) (-1178.080) (-1181.443) [-1178.449] * (-1180.071) (-1179.351) [-1178.666] (-1179.947) -- 0:00:43 390000 -- (-1182.761) (-1179.054) (-1182.340) [-1179.640] * (-1180.912) (-1177.658) [-1180.531] (-1180.049) -- 0:00:43 Average standard deviation of split frequencies: 0.013337 390500 -- (-1181.647) (-1180.633) (-1183.476) [-1177.220] * [-1181.300] (-1180.053) (-1178.272) (-1180.140) -- 0:00:43 391000 -- (-1184.496) (-1180.118) [-1178.173] (-1182.293) * (-1179.672) (-1182.890) [-1180.031] (-1180.776) -- 0:00:43 391500 -- (-1183.571) [-1183.125] (-1180.902) (-1178.376) * [-1179.347] (-1183.420) (-1183.657) (-1177.648) -- 0:00:43 392000 -- [-1179.207] (-1181.128) (-1177.352) (-1177.502) * (-1178.106) (-1178.438) (-1181.856) [-1178.942] -- 0:00:43 392500 -- [-1178.429] (-1179.975) (-1182.821) (-1178.714) * (-1178.121) (-1181.545) (-1180.459) [-1178.408] -- 0:00:43 393000 -- [-1178.110] (-1181.265) (-1177.949) (-1181.968) * (-1180.634) (-1182.559) (-1182.200) [-1179.186] -- 0:00:43 393500 -- (-1179.713) (-1180.561) (-1183.612) [-1181.923] * [-1179.259] (-1179.586) (-1180.441) (-1177.613) -- 0:00:43 394000 -- (-1179.025) [-1177.994] (-1180.730) (-1185.578) * [-1179.960] (-1179.114) (-1178.408) (-1179.903) -- 0:00:44 394500 -- (-1180.927) [-1180.135] (-1183.122) (-1182.836) * (-1179.146) [-1178.273] (-1178.549) (-1181.860) -- 0:00:44 395000 -- [-1178.070] (-1177.630) (-1182.477) (-1177.199) * [-1180.270] (-1177.912) (-1177.709) (-1179.506) -- 0:00:44 Average standard deviation of split frequencies: 0.013721 395500 -- (-1178.201) (-1177.463) [-1179.795] (-1181.815) * (-1180.115) [-1178.150] (-1177.542) (-1179.466) -- 0:00:44 396000 -- (-1181.278) (-1177.961) [-1178.515] (-1180.675) * (-1178.317) (-1178.620) [-1178.115] (-1181.134) -- 0:00:44 396500 -- (-1181.285) (-1177.901) [-1179.636] (-1179.418) * (-1178.577) (-1185.136) [-1178.126] (-1180.056) -- 0:00:44 397000 -- [-1178.127] (-1178.241) (-1181.972) (-1178.485) * [-1178.217] (-1178.022) (-1179.546) (-1178.436) -- 0:00:44 397500 -- [-1179.214] (-1178.370) (-1180.106) (-1177.826) * (-1179.519) (-1180.631) [-1178.089] (-1177.514) -- 0:00:43 398000 -- (-1179.714) [-1183.114] (-1181.609) (-1181.604) * (-1178.245) [-1178.396] (-1178.171) (-1178.186) -- 0:00:43 398500 -- (-1180.254) (-1180.766) [-1180.533] (-1180.875) * (-1182.042) (-1178.221) [-1177.716] (-1178.187) -- 0:00:43 399000 -- (-1180.205) (-1177.840) [-1179.007] (-1181.287) * [-1178.284] (-1178.821) (-1184.021) (-1177.806) -- 0:00:43 399500 -- (-1180.023) [-1178.555] (-1180.610) (-1179.970) * [-1178.660] (-1178.529) (-1179.667) (-1178.552) -- 0:00:43 400000 -- (-1179.922) (-1178.652) (-1185.798) [-1179.708] * (-1180.634) (-1177.949) (-1178.159) [-1178.715] -- 0:00:43 Average standard deviation of split frequencies: 0.014490 400500 -- (-1178.091) (-1181.165) [-1181.744] (-1179.321) * (-1184.156) (-1180.422) [-1178.267] (-1178.873) -- 0:00:43 401000 -- (-1180.028) (-1179.738) (-1179.036) [-1178.115] * (-1179.552) [-1177.317] (-1179.454) (-1179.434) -- 0:00:43 401500 -- (-1178.738) (-1177.420) (-1180.670) [-1178.500] * [-1178.648] (-1177.928) (-1178.683) (-1179.535) -- 0:00:43 402000 -- (-1178.931) [-1177.497] (-1181.518) (-1182.347) * (-1178.648) [-1177.714] (-1178.065) (-1179.464) -- 0:00:43 402500 -- (-1177.929) [-1180.416] (-1180.827) (-1180.646) * (-1179.810) (-1178.190) (-1178.119) [-1178.367] -- 0:00:43 403000 -- (-1177.529) (-1181.406) [-1177.981] (-1180.064) * (-1179.646) (-1178.995) [-1180.268] (-1179.779) -- 0:00:42 403500 -- [-1180.728] (-1181.475) (-1177.389) (-1183.003) * (-1179.182) (-1179.351) (-1177.590) [-1181.852] -- 0:00:42 404000 -- (-1179.710) (-1182.567) (-1177.791) [-1180.307] * (-1178.074) (-1178.231) (-1177.224) [-1178.016] -- 0:00:42 404500 -- (-1178.515) (-1179.325) [-1177.712] (-1179.124) * (-1178.205) (-1179.135) [-1178.134] (-1179.588) -- 0:00:42 405000 -- (-1177.923) [-1179.894] (-1180.156) (-1179.585) * [-1178.676] (-1180.425) (-1178.304) (-1177.193) -- 0:00:42 Average standard deviation of split frequencies: 0.014239 405500 -- (-1177.787) [-1179.209] (-1179.959) (-1180.865) * (-1178.309) [-1178.516] (-1179.023) (-1178.833) -- 0:00:42 406000 -- (-1179.436) (-1177.812) (-1178.716) [-1180.121] * [-1181.043] (-1180.370) (-1180.596) (-1182.528) -- 0:00:42 406500 -- (-1179.900) (-1178.872) (-1178.728) [-1178.779] * (-1181.286) [-1179.490] (-1179.266) (-1178.001) -- 0:00:42 407000 -- [-1181.120] (-1181.601) (-1178.673) (-1180.894) * (-1180.373) (-1180.985) [-1178.159] (-1178.405) -- 0:00:42 407500 -- (-1183.853) [-1179.086] (-1177.857) (-1179.574) * (-1179.304) [-1179.386] (-1178.294) (-1178.471) -- 0:00:42 408000 -- (-1180.461) (-1181.126) (-1178.771) [-1179.956] * (-1182.113) (-1178.075) [-1177.872] (-1179.106) -- 0:00:42 408500 -- (-1179.154) (-1178.479) (-1183.690) [-1178.257] * (-1180.660) (-1177.706) (-1180.736) [-1182.969] -- 0:00:41 409000 -- (-1178.607) [-1179.996] (-1180.589) (-1180.976) * (-1179.615) (-1177.815) [-1178.600] (-1181.333) -- 0:00:43 409500 -- [-1177.280] (-1179.923) (-1179.082) (-1178.297) * (-1178.678) (-1180.173) [-1178.025] (-1179.325) -- 0:00:43 410000 -- [-1177.356] (-1178.763) (-1181.122) (-1179.679) * (-1179.244) (-1178.587) [-1177.982] (-1177.869) -- 0:00:43 Average standard deviation of split frequencies: 0.013520 410500 -- (-1179.385) [-1178.373] (-1178.946) (-1177.492) * (-1181.544) [-1179.089] (-1182.203) (-1179.238) -- 0:00:43 411000 -- (-1177.931) (-1179.271) (-1179.099) [-1178.889] * (-1179.182) (-1180.362) (-1183.483) [-1179.346] -- 0:00:42 411500 -- (-1179.060) (-1180.847) [-1177.973] (-1180.957) * (-1181.637) [-1179.074] (-1181.252) (-1179.551) -- 0:00:42 412000 -- [-1177.856] (-1177.380) (-1177.974) (-1182.345) * (-1178.964) (-1179.110) (-1178.740) [-1177.924] -- 0:00:42 412500 -- (-1180.625) (-1180.176) (-1178.106) [-1179.180] * (-1180.447) [-1178.746] (-1180.737) (-1178.158) -- 0:00:42 413000 -- (-1178.067) (-1180.482) [-1178.410] (-1182.879) * (-1182.604) (-1178.259) (-1179.904) [-1177.431] -- 0:00:42 413500 -- (-1177.451) (-1178.731) (-1179.678) [-1182.424] * (-1186.102) [-1178.258] (-1177.391) (-1179.459) -- 0:00:42 414000 -- (-1177.603) (-1179.207) (-1179.652) [-1177.430] * [-1181.044] (-1182.760) (-1179.748) (-1177.609) -- 0:00:42 414500 -- (-1178.219) (-1183.824) [-1180.541] (-1178.095) * [-1178.967] (-1182.101) (-1182.148) (-1179.742) -- 0:00:42 415000 -- (-1178.219) (-1179.873) (-1180.489) [-1177.692] * [-1178.476] (-1178.823) (-1178.359) (-1179.751) -- 0:00:42 Average standard deviation of split frequencies: 0.012918 415500 -- (-1178.768) (-1178.670) [-1179.731] (-1180.661) * [-1177.527] (-1181.329) (-1183.104) (-1178.192) -- 0:00:42 416000 -- (-1179.584) (-1179.479) [-1177.895] (-1178.348) * (-1177.709) (-1180.725) (-1181.398) [-1181.695] -- 0:00:42 416500 -- (-1180.164) (-1178.089) (-1178.041) [-1177.890] * (-1180.230) (-1180.247) [-1182.174] (-1181.748) -- 0:00:42 417000 -- [-1179.370] (-1179.652) (-1181.820) (-1178.424) * (-1180.686) (-1177.992) [-1184.936] (-1178.603) -- 0:00:41 417500 -- (-1184.190) (-1177.549) (-1181.528) [-1178.222] * (-1179.377) [-1178.345] (-1180.640) (-1179.858) -- 0:00:41 418000 -- [-1182.040] (-1178.332) (-1181.727) (-1178.432) * (-1179.834) (-1184.011) [-1179.268] (-1184.780) -- 0:00:41 418500 -- (-1178.469) [-1181.543] (-1178.805) (-1183.367) * (-1181.749) (-1181.545) [-1180.424] (-1179.749) -- 0:00:41 419000 -- [-1178.469] (-1182.977) (-1179.017) (-1177.327) * (-1181.355) (-1181.384) [-1177.680] (-1177.243) -- 0:00:41 419500 -- (-1184.717) (-1181.718) (-1179.470) [-1177.339] * (-1178.343) (-1177.322) [-1179.906] (-1190.073) -- 0:00:41 420000 -- (-1182.386) [-1179.936] (-1180.101) (-1179.764) * (-1179.305) (-1177.130) (-1180.026) [-1177.965] -- 0:00:41 Average standard deviation of split frequencies: 0.012514 420500 -- (-1178.346) (-1180.501) [-1180.254] (-1179.432) * [-1177.701] (-1180.444) (-1178.233) (-1179.357) -- 0:00:41 421000 -- (-1179.428) (-1179.341) (-1181.848) [-1182.236] * [-1178.164] (-1182.716) (-1178.878) (-1183.571) -- 0:00:41 421500 -- [-1179.617] (-1178.851) (-1187.540) (-1179.991) * (-1179.451) (-1178.439) (-1177.869) [-1179.560] -- 0:00:41 422000 -- (-1181.731) [-1180.199] (-1181.901) (-1181.260) * (-1180.819) (-1181.945) [-1179.908] (-1178.688) -- 0:00:41 422500 -- [-1182.658] (-1179.407) (-1179.842) (-1180.487) * [-1181.019] (-1178.206) (-1180.678) (-1180.265) -- 0:00:41 423000 -- (-1183.719) (-1177.687) (-1178.424) [-1180.227] * (-1181.930) [-1177.727] (-1181.465) (-1180.631) -- 0:00:40 423500 -- (-1181.590) [-1179.868] (-1180.644) (-1179.889) * (-1178.699) (-1178.959) [-1179.609] (-1179.534) -- 0:00:40 424000 -- [-1181.039] (-1179.954) (-1178.653) (-1182.038) * [-1178.069] (-1178.165) (-1181.213) (-1178.033) -- 0:00:42 424500 -- (-1179.383) (-1179.865) (-1181.004) [-1181.426] * (-1179.240) (-1178.097) [-1179.693] (-1177.566) -- 0:00:42 425000 -- (-1177.379) (-1180.932) (-1177.558) [-1180.006] * (-1179.479) [-1178.973] (-1180.433) (-1178.185) -- 0:00:41 Average standard deviation of split frequencies: 0.012871 425500 -- (-1177.202) [-1178.982] (-1181.124) (-1182.289) * (-1178.442) (-1180.884) [-1179.018] (-1179.818) -- 0:00:41 426000 -- [-1177.954] (-1182.045) (-1180.539) (-1182.383) * (-1181.541) (-1177.175) [-1178.393] (-1178.464) -- 0:00:41 426500 -- [-1177.786] (-1183.947) (-1180.534) (-1180.676) * (-1178.184) (-1179.239) [-1177.346] (-1177.611) -- 0:00:41 427000 -- (-1177.674) [-1181.993] (-1177.950) (-1183.336) * (-1185.368) [-1177.515] (-1180.162) (-1177.645) -- 0:00:41 427500 -- (-1184.309) [-1178.317] (-1177.737) (-1178.984) * (-1184.728) (-1178.025) [-1180.468] (-1179.510) -- 0:00:41 428000 -- (-1178.744) (-1179.168) [-1177.381] (-1180.660) * (-1180.218) (-1177.344) [-1178.999] (-1181.598) -- 0:00:41 428500 -- [-1181.497] (-1181.085) (-1180.793) (-1179.891) * [-1179.650] (-1179.521) (-1177.769) (-1179.907) -- 0:00:41 429000 -- (-1178.870) [-1180.982] (-1180.580) (-1179.139) * (-1180.193) (-1180.211) (-1178.681) [-1178.687] -- 0:00:41 429500 -- (-1179.366) (-1178.528) [-1177.970] (-1179.561) * [-1178.645] (-1184.089) (-1178.086) (-1178.511) -- 0:00:41 430000 -- (-1180.465) (-1178.743) (-1180.801) [-1178.364] * (-1179.611) (-1182.501) [-1178.717] (-1186.227) -- 0:00:41 Average standard deviation of split frequencies: 0.012649 430500 -- (-1181.120) (-1177.459) (-1178.460) [-1178.198] * (-1179.668) (-1181.475) [-1179.913] (-1180.621) -- 0:00:41 431000 -- (-1177.316) (-1180.010) [-1180.870] (-1180.488) * (-1182.405) (-1182.335) (-1180.162) [-1180.035] -- 0:00:40 431500 -- [-1180.311] (-1178.902) (-1181.356) (-1179.269) * [-1179.530] (-1181.259) (-1182.169) (-1180.107) -- 0:00:40 432000 -- (-1178.514) (-1184.198) [-1182.821] (-1181.862) * (-1178.893) [-1180.050] (-1180.044) (-1179.504) -- 0:00:40 432500 -- (-1179.109) (-1180.923) [-1180.696] (-1183.148) * [-1179.434] (-1179.934) (-1178.138) (-1179.142) -- 0:00:40 433000 -- (-1178.829) (-1180.957) [-1182.835] (-1179.601) * (-1179.416) (-1179.317) [-1179.760] (-1179.687) -- 0:00:40 433500 -- (-1180.002) (-1180.582) [-1180.666] (-1182.159) * [-1178.758] (-1178.774) (-1180.583) (-1178.666) -- 0:00:40 434000 -- (-1178.537) (-1178.479) (-1179.718) [-1180.144] * (-1180.446) (-1180.530) (-1180.996) [-1178.684] -- 0:00:40 434500 -- (-1178.833) (-1177.862) (-1179.249) [-1179.219] * [-1180.676] (-1181.300) (-1178.849) (-1180.535) -- 0:00:40 435000 -- (-1178.500) [-1178.290] (-1179.185) (-1179.231) * (-1180.635) (-1180.145) [-1177.905] (-1178.216) -- 0:00:40 Average standard deviation of split frequencies: 0.013031 435500 -- (-1178.728) [-1180.891] (-1184.593) (-1181.079) * (-1178.198) [-1178.133] (-1177.448) (-1178.013) -- 0:00:40 436000 -- (-1178.296) [-1180.049] (-1182.476) (-1180.653) * (-1183.131) (-1180.414) [-1179.405] (-1177.909) -- 0:00:40 436500 -- [-1180.269] (-1178.063) (-1178.668) (-1184.157) * (-1179.279) (-1181.647) [-1180.122] (-1177.849) -- 0:00:40 437000 -- (-1178.936) (-1177.702) [-1178.578] (-1177.359) * [-1178.426] (-1179.943) (-1180.557) (-1181.522) -- 0:00:41 437500 -- [-1177.867] (-1178.552) (-1177.687) (-1181.884) * (-1179.727) (-1179.781) [-1183.654] (-1180.288) -- 0:00:41 438000 -- (-1178.198) (-1179.388) (-1179.201) [-1181.300] * (-1179.799) [-1179.218] (-1182.090) (-1178.809) -- 0:00:41 438500 -- (-1177.993) (-1182.010) (-1180.108) [-1177.767] * (-1178.431) [-1178.070] (-1183.543) (-1178.891) -- 0:00:40 439000 -- (-1178.171) (-1178.649) (-1179.402) [-1178.091] * (-1178.289) (-1178.728) [-1180.901] (-1179.212) -- 0:00:40 439500 -- [-1179.525] (-1178.647) (-1179.235) (-1180.166) * (-1180.237) [-1178.946] (-1178.907) (-1178.184) -- 0:00:40 440000 -- (-1178.847) (-1180.366) (-1179.005) [-1180.436] * [-1178.055] (-1180.806) (-1178.283) (-1179.146) -- 0:00:40 Average standard deviation of split frequencies: 0.013287 440500 -- (-1179.649) (-1177.761) [-1181.509] (-1180.572) * (-1177.373) (-1178.574) [-1180.764] (-1178.520) -- 0:00:40 441000 -- (-1183.773) [-1178.971] (-1179.189) (-1178.172) * (-1180.514) (-1177.655) [-1180.725] (-1177.512) -- 0:00:40 441500 -- (-1183.212) [-1179.206] (-1180.198) (-1178.633) * (-1179.120) [-1180.457] (-1180.460) (-1177.804) -- 0:00:40 442000 -- (-1179.946) [-1179.244] (-1181.111) (-1178.206) * (-1181.588) (-1180.804) (-1180.104) [-1177.567] -- 0:00:40 442500 -- (-1181.361) (-1179.300) (-1179.481) [-1177.685] * (-1178.709) [-1179.606] (-1178.335) (-1179.055) -- 0:00:40 443000 -- (-1180.414) (-1178.089) (-1182.609) [-1177.146] * (-1180.856) [-1181.136] (-1178.411) (-1177.862) -- 0:00:40 443500 -- (-1177.744) [-1179.908] (-1179.084) (-1181.101) * (-1180.976) (-1178.063) [-1178.879] (-1178.728) -- 0:00:40 444000 -- (-1180.763) [-1179.746] (-1181.886) (-1177.696) * (-1180.737) (-1179.991) (-1178.932) [-1181.008] -- 0:00:40 444500 -- (-1180.569) [-1183.103] (-1177.285) (-1177.696) * (-1181.902) [-1178.025] (-1183.922) (-1179.745) -- 0:00:39 445000 -- [-1178.658] (-1178.978) (-1177.285) (-1180.300) * (-1178.761) (-1178.660) (-1179.604) [-1179.118] -- 0:00:39 Average standard deviation of split frequencies: 0.013129 445500 -- (-1179.269) (-1178.236) [-1179.380] (-1177.809) * (-1179.029) [-1177.899] (-1178.990) (-1182.958) -- 0:00:39 446000 -- [-1179.204] (-1178.749) (-1178.098) (-1180.032) * (-1179.078) (-1178.076) [-1177.007] (-1183.834) -- 0:00:39 446500 -- (-1178.459) (-1184.759) [-1180.602] (-1178.880) * (-1179.851) (-1178.551) [-1180.876] (-1181.144) -- 0:00:39 447000 -- (-1181.664) [-1183.516] (-1179.348) (-1182.112) * [-1178.660] (-1179.095) (-1183.123) (-1181.966) -- 0:00:39 447500 -- [-1177.651] (-1178.211) (-1179.226) (-1179.243) * (-1178.531) (-1178.775) [-1180.558] (-1180.970) -- 0:00:39 448000 -- [-1178.578] (-1178.357) (-1180.339) (-1178.679) * [-1179.905] (-1177.346) (-1179.346) (-1181.726) -- 0:00:39 448500 -- [-1179.877] (-1178.162) (-1179.759) (-1178.965) * (-1178.050) [-1177.176] (-1177.668) (-1178.588) -- 0:00:39 449000 -- (-1179.686) (-1180.834) (-1178.632) [-1179.338] * [-1177.272] (-1177.284) (-1182.598) (-1177.849) -- 0:00:39 449500 -- [-1188.405] (-1181.512) (-1185.518) (-1179.618) * [-1178.183] (-1178.750) (-1180.378) (-1180.182) -- 0:00:39 450000 -- (-1182.473) [-1182.347] (-1178.827) (-1178.695) * (-1179.641) (-1181.667) (-1180.454) [-1178.434] -- 0:00:40 Average standard deviation of split frequencies: 0.013075 450500 -- (-1180.959) (-1177.994) [-1177.877] (-1178.359) * [-1179.608] (-1181.093) (-1179.441) (-1180.133) -- 0:00:40 451000 -- (-1177.733) [-1181.071] (-1180.299) (-1177.578) * [-1180.470] (-1178.860) (-1180.195) (-1178.404) -- 0:00:40 451500 -- (-1179.610) (-1178.906) (-1178.337) [-1178.183] * (-1181.525) (-1178.939) [-1178.513] (-1183.736) -- 0:00:40 452000 -- [-1178.555] (-1179.914) (-1179.925) (-1181.088) * (-1178.223) (-1179.843) [-1180.736] (-1180.080) -- 0:00:40 452500 -- (-1180.128) (-1180.522) (-1178.394) [-1179.265] * (-1180.193) [-1179.439] (-1178.159) (-1178.629) -- 0:00:39 453000 -- (-1179.199) (-1184.045) [-1179.050] (-1177.690) * [-1179.567] (-1178.470) (-1178.884) (-1178.838) -- 0:00:39 453500 -- (-1179.127) [-1182.690] (-1179.145) (-1178.554) * (-1178.221) (-1179.511) [-1179.263] (-1179.244) -- 0:00:39 454000 -- (-1179.337) (-1180.035) [-1177.630] (-1181.239) * (-1179.103) [-1180.590] (-1178.755) (-1180.420) -- 0:00:39 454500 -- [-1178.563] (-1179.872) (-1179.499) (-1179.562) * (-1181.067) [-1179.547] (-1177.250) (-1179.332) -- 0:00:39 455000 -- [-1178.244] (-1178.827) (-1183.880) (-1180.089) * (-1178.650) (-1177.890) [-1177.972] (-1180.709) -- 0:00:39 Average standard deviation of split frequencies: 0.012520 455500 -- (-1177.965) [-1179.153] (-1182.142) (-1179.361) * [-1178.185] (-1180.543) (-1178.276) (-1179.408) -- 0:00:39 456000 -- [-1179.121] (-1181.295) (-1179.912) (-1180.282) * (-1180.488) [-1179.134] (-1177.825) (-1178.350) -- 0:00:39 456500 -- (-1178.028) (-1181.914) (-1178.823) [-1179.571] * (-1177.920) (-1180.140) (-1177.224) [-1178.996] -- 0:00:39 457000 -- (-1180.702) (-1179.795) (-1179.070) [-1179.486] * [-1178.294] (-1180.681) (-1178.151) (-1178.901) -- 0:00:39 457500 -- (-1184.460) (-1178.827) [-1178.814] (-1178.384) * (-1179.488) (-1183.376) [-1178.961] (-1179.334) -- 0:00:39 458000 -- (-1178.767) (-1178.162) (-1184.562) [-1179.180] * (-1179.153) [-1178.191] (-1181.518) (-1178.218) -- 0:00:39 458500 -- (-1178.502) (-1181.035) [-1179.310] (-1180.062) * (-1179.409) [-1179.051] (-1180.519) (-1178.218) -- 0:00:38 459000 -- (-1177.892) (-1179.851) (-1182.911) [-1179.617] * [-1179.196] (-1178.354) (-1184.909) (-1179.512) -- 0:00:38 459500 -- (-1177.817) [-1177.622] (-1179.199) (-1187.512) * (-1179.992) (-1180.434) (-1178.905) [-1178.690] -- 0:00:38 460000 -- [-1178.711] (-1177.956) (-1178.896) (-1182.786) * (-1181.305) (-1180.952) [-1177.994] (-1183.133) -- 0:00:38 Average standard deviation of split frequencies: 0.013019 460500 -- (-1180.539) (-1177.743) (-1179.990) [-1180.584] * (-1178.470) (-1183.650) (-1178.731) [-1178.404] -- 0:00:38 461000 -- [-1178.779] (-1177.973) (-1178.676) (-1183.986) * [-1178.358] (-1181.576) (-1178.265) (-1182.917) -- 0:00:38 461500 -- (-1181.778) (-1178.063) (-1180.070) [-1184.096] * (-1179.493) (-1178.900) (-1177.343) [-1181.909] -- 0:00:38 462000 -- (-1179.795) [-1179.455] (-1180.994) (-1183.553) * (-1179.908) (-1178.732) [-1177.349] (-1178.876) -- 0:00:38 462500 -- (-1179.191) (-1179.005) [-1182.086] (-1185.768) * (-1179.597) (-1178.176) (-1177.280) [-1179.942] -- 0:00:38 463000 -- [-1178.291] (-1188.805) (-1182.313) (-1182.592) * (-1180.698) (-1180.165) (-1178.199) [-1177.072] -- 0:00:38 463500 -- (-1180.298) (-1188.309) [-1181.677] (-1178.912) * [-1178.874] (-1181.862) (-1178.667) (-1179.442) -- 0:00:38 464000 -- (-1178.182) (-1179.775) [-1180.519] (-1179.801) * (-1179.933) [-1179.896] (-1178.103) (-1179.159) -- 0:00:38 464500 -- (-1177.822) [-1181.492] (-1180.078) (-1182.424) * (-1180.508) [-1178.433] (-1179.066) (-1180.206) -- 0:00:38 465000 -- (-1178.456) (-1180.105) [-1178.014] (-1179.402) * [-1179.218] (-1179.980) (-1183.794) (-1182.140) -- 0:00:39 Average standard deviation of split frequencies: 0.013376 465500 -- (-1179.550) [-1179.007] (-1180.870) (-1177.072) * (-1178.634) [-1178.503] (-1180.308) (-1178.099) -- 0:00:39 466000 -- [-1177.163] (-1180.074) (-1181.851) (-1179.800) * (-1178.229) (-1180.261) (-1178.933) [-1182.141] -- 0:00:38 466500 -- (-1178.876) [-1178.427] (-1178.300) (-1178.203) * (-1178.593) (-1180.157) [-1177.341] (-1178.980) -- 0:00:38 467000 -- (-1180.341) (-1177.520) [-1179.798] (-1181.563) * (-1180.979) [-1177.234] (-1179.844) (-1180.443) -- 0:00:38 467500 -- (-1181.717) [-1180.315] (-1181.061) (-1180.753) * (-1179.269) (-1180.020) [-1179.429] (-1189.317) -- 0:00:38 468000 -- (-1178.941) (-1183.292) (-1180.422) [-1179.603] * [-1178.265] (-1186.856) (-1179.186) (-1181.507) -- 0:00:38 468500 -- (-1181.008) (-1180.707) (-1180.844) [-1178.319] * (-1178.939) (-1181.734) [-1178.559] (-1181.210) -- 0:00:38 469000 -- (-1177.582) (-1185.146) [-1178.053] (-1182.583) * [-1177.392] (-1181.747) (-1179.275) (-1183.082) -- 0:00:38 469500 -- (-1178.037) (-1179.179) [-1179.214] (-1185.165) * [-1178.342] (-1179.759) (-1181.351) (-1179.014) -- 0:00:38 470000 -- (-1179.593) (-1178.352) (-1182.089) [-1181.075] * (-1184.014) (-1179.759) [-1178.990] (-1179.517) -- 0:00:38 Average standard deviation of split frequencies: 0.012130 470500 -- (-1182.715) (-1181.155) [-1179.105] (-1181.291) * [-1180.794] (-1177.687) (-1179.003) (-1181.432) -- 0:00:38 471000 -- (-1179.731) (-1180.979) [-1183.081] (-1179.896) * (-1183.570) (-1180.048) [-1180.135] (-1178.901) -- 0:00:38 471500 -- [-1180.196] (-1182.182) (-1179.368) (-1178.886) * (-1180.303) (-1178.908) (-1179.780) [-1181.036] -- 0:00:38 472000 -- (-1179.068) [-1181.440] (-1178.459) (-1177.149) * (-1178.185) (-1179.694) (-1179.387) [-1180.573] -- 0:00:38 472500 -- (-1179.076) [-1180.475] (-1179.517) (-1179.051) * (-1181.045) (-1180.892) (-1181.720) [-1178.272] -- 0:00:37 473000 -- (-1181.178) (-1179.881) [-1179.215] (-1179.427) * (-1182.845) (-1185.151) (-1184.015) [-1178.952] -- 0:00:37 473500 -- (-1180.957) (-1179.534) [-1177.441] (-1178.612) * (-1178.470) (-1181.117) (-1179.146) [-1181.166] -- 0:00:37 474000 -- (-1180.044) (-1179.588) [-1179.602] (-1186.461) * [-1178.874] (-1178.530) (-1178.996) (-1181.834) -- 0:00:37 474500 -- (-1180.149) [-1177.589] (-1183.545) (-1183.537) * (-1179.654) (-1180.693) [-1179.612] (-1179.106) -- 0:00:37 475000 -- (-1178.406) (-1177.384) [-1181.535] (-1183.720) * (-1178.977) (-1179.495) (-1179.592) [-1179.013] -- 0:00:37 Average standard deviation of split frequencies: 0.011939 475500 -- (-1179.584) (-1178.530) (-1179.882) [-1179.165] * (-1178.561) (-1181.828) [-1178.507] (-1181.064) -- 0:00:37 476000 -- (-1178.163) [-1178.925] (-1179.719) (-1179.114) * (-1178.233) (-1178.338) [-1178.117] (-1180.693) -- 0:00:37 476500 -- (-1178.169) (-1180.019) [-1177.182] (-1179.116) * (-1178.974) [-1177.653] (-1180.161) (-1180.699) -- 0:00:37 477000 -- [-1180.103] (-1179.184) (-1180.937) (-1183.063) * [-1180.859] (-1179.254) (-1177.495) (-1178.947) -- 0:00:37 477500 -- (-1179.253) (-1178.905) (-1177.463) [-1180.951] * (-1178.972) [-1178.717] (-1180.134) (-1180.637) -- 0:00:37 478000 -- (-1178.309) (-1180.127) [-1178.525] (-1179.748) * [-1178.594] (-1181.092) (-1178.437) (-1183.224) -- 0:00:37 478500 -- [-1179.053] (-1180.958) (-1179.129) (-1183.965) * (-1178.634) (-1186.938) (-1179.373) [-1179.271] -- 0:00:37 479000 -- [-1178.710] (-1183.438) (-1183.656) (-1180.185) * (-1179.578) (-1181.721) [-1179.011] (-1177.695) -- 0:00:36 479500 -- (-1178.397) [-1180.339] (-1183.013) (-1184.372) * (-1178.592) (-1178.993) [-1179.425] (-1179.532) -- 0:00:36 480000 -- (-1179.987) (-1182.749) [-1184.877] (-1180.396) * [-1180.073] (-1177.483) (-1179.583) (-1179.547) -- 0:00:37 Average standard deviation of split frequencies: 0.011614 480500 -- [-1180.100] (-1182.548) (-1181.234) (-1178.468) * (-1179.102) (-1178.682) [-1178.316] (-1177.467) -- 0:00:37 481000 -- (-1182.706) (-1179.177) [-1180.935] (-1178.445) * (-1182.148) (-1177.928) [-1181.506] (-1177.354) -- 0:00:37 481500 -- (-1178.628) (-1178.270) (-1179.554) [-1177.814] * (-1177.452) (-1178.069) (-1185.001) [-1177.342] -- 0:00:37 482000 -- (-1178.699) [-1177.979] (-1179.293) (-1180.839) * (-1181.736) [-1179.967] (-1182.094) (-1179.218) -- 0:00:37 482500 -- [-1178.973] (-1179.167) (-1179.000) (-1179.898) * (-1178.822) (-1179.279) (-1180.783) [-1179.285] -- 0:00:37 483000 -- (-1179.239) [-1179.436] (-1177.400) (-1180.120) * (-1178.385) (-1178.531) (-1178.505) [-1178.650] -- 0:00:37 483500 -- (-1182.067) (-1177.767) (-1178.010) [-1178.723] * (-1181.141) (-1178.060) (-1177.637) [-1178.767] -- 0:00:37 484000 -- (-1177.984) (-1178.365) [-1178.129] (-1179.235) * (-1183.287) [-1177.293] (-1178.771) (-1178.845) -- 0:00:37 484500 -- (-1179.053) (-1178.226) [-1180.843] (-1178.831) * (-1178.807) [-1180.065] (-1181.670) (-1182.751) -- 0:00:37 485000 -- [-1180.437] (-1178.596) (-1179.757) (-1181.655) * (-1177.693) [-1178.544] (-1184.817) (-1183.854) -- 0:00:37 Average standard deviation of split frequencies: 0.011435 485500 -- (-1180.094) (-1178.137) [-1178.102] (-1183.572) * (-1177.821) (-1181.485) [-1180.651] (-1182.161) -- 0:00:37 486000 -- (-1179.343) [-1180.649] (-1179.675) (-1181.986) * (-1178.119) (-1180.177) [-1180.131] (-1180.933) -- 0:00:37 486500 -- (-1178.680) [-1181.033] (-1182.441) (-1179.643) * (-1183.009) (-1179.570) (-1179.602) [-1181.137] -- 0:00:36 487000 -- (-1181.514) (-1181.678) [-1181.495] (-1180.157) * (-1180.999) (-1177.806) [-1179.475] (-1179.484) -- 0:00:36 487500 -- [-1181.816] (-1182.708) (-1179.725) (-1180.645) * (-1177.983) (-1177.957) [-1177.740] (-1180.192) -- 0:00:36 488000 -- (-1180.217) (-1180.417) [-1182.037] (-1180.386) * (-1180.427) (-1179.192) (-1180.066) [-1178.201] -- 0:00:36 488500 -- (-1180.009) (-1182.060) [-1179.503] (-1182.841) * (-1180.390) (-1180.781) [-1178.413] (-1177.840) -- 0:00:36 489000 -- (-1180.339) [-1178.817] (-1181.058) (-1178.261) * [-1177.106] (-1181.574) (-1178.923) (-1179.008) -- 0:00:36 489500 -- (-1179.025) (-1177.555) (-1177.589) [-1177.261] * (-1177.158) [-1178.186] (-1179.545) (-1181.482) -- 0:00:36 490000 -- (-1185.569) (-1177.720) [-1178.410] (-1181.564) * (-1178.587) (-1180.208) (-1178.622) [-1178.132] -- 0:00:36 Average standard deviation of split frequencies: 0.011155 490500 -- [-1178.777] (-1180.154) (-1180.646) (-1179.916) * (-1178.235) [-1178.980] (-1178.462) (-1177.925) -- 0:00:36 491000 -- (-1178.575) (-1177.708) [-1177.638] (-1178.947) * (-1177.552) (-1182.195) (-1178.163) [-1177.801] -- 0:00:36 491500 -- [-1178.940] (-1178.711) (-1179.453) (-1178.089) * (-1179.300) [-1179.980] (-1178.741) (-1180.489) -- 0:00:36 492000 -- (-1178.083) (-1179.468) (-1179.400) [-1178.049] * (-1180.300) [-1177.304] (-1179.448) (-1178.631) -- 0:00:36 492500 -- (-1178.551) (-1179.121) (-1179.376) [-1181.160] * (-1181.078) (-1179.184) [-1181.742] (-1181.662) -- 0:00:36 493000 -- (-1177.756) [-1178.775] (-1180.240) (-1181.561) * (-1180.488) [-1178.403] (-1177.484) (-1180.148) -- 0:00:35 493500 -- [-1178.115] (-1180.047) (-1178.092) (-1182.123) * (-1182.916) (-1178.289) [-1177.830] (-1180.219) -- 0:00:35 494000 -- (-1177.798) [-1179.669] (-1178.611) (-1177.944) * (-1178.537) [-1177.583] (-1178.432) (-1179.639) -- 0:00:35 494500 -- (-1177.855) [-1179.895] (-1183.170) (-1177.547) * (-1178.124) (-1179.034) (-1179.575) [-1179.461] -- 0:00:36 495000 -- (-1178.398) (-1182.416) [-1179.342] (-1178.187) * (-1178.258) (-1179.282) (-1178.915) [-1180.036] -- 0:00:36 Average standard deviation of split frequencies: 0.011352 495500 -- [-1179.639] (-1183.235) (-1181.675) (-1179.836) * (-1185.261) [-1179.136] (-1178.954) (-1180.481) -- 0:00:36 496000 -- (-1178.995) [-1181.541] (-1179.467) (-1180.100) * (-1180.685) (-1179.295) [-1178.665] (-1180.790) -- 0:00:36 496500 -- (-1180.358) [-1178.926] (-1182.835) (-1178.427) * (-1179.319) (-1180.506) (-1177.210) [-1182.797] -- 0:00:36 497000 -- (-1178.871) [-1178.837] (-1183.776) (-1179.958) * (-1181.091) [-1179.562] (-1177.661) (-1178.884) -- 0:00:36 497500 -- (-1178.481) (-1178.239) (-1183.240) [-1178.431] * [-1180.173] (-1177.683) (-1178.546) (-1178.012) -- 0:00:36 498000 -- (-1178.836) (-1178.088) [-1181.480] (-1179.154) * (-1178.518) [-1179.372] (-1178.545) (-1177.433) -- 0:00:36 498500 -- (-1177.763) [-1178.110] (-1182.296) (-1177.451) * (-1177.677) (-1180.401) [-1181.919] (-1179.872) -- 0:00:36 499000 -- (-1177.610) [-1177.480] (-1177.896) (-1179.123) * [-1177.696] (-1182.537) (-1181.445) (-1178.210) -- 0:00:36 499500 -- [-1177.264] (-1178.495) (-1177.245) (-1177.857) * (-1178.952) (-1180.161) [-1180.249] (-1181.594) -- 0:00:36 500000 -- (-1177.261) (-1181.152) (-1179.458) [-1177.409] * (-1178.654) (-1181.178) (-1181.308) [-1177.990] -- 0:00:36 Average standard deviation of split frequencies: 0.011508 500500 -- (-1177.575) (-1181.464) (-1177.481) [-1177.743] * (-1179.215) (-1177.932) (-1183.277) [-1177.613] -- 0:00:35 501000 -- (-1179.818) [-1180.468] (-1178.591) (-1178.928) * [-1183.056] (-1183.262) (-1181.352) (-1181.146) -- 0:00:35 501500 -- [-1177.874] (-1178.728) (-1178.019) (-1179.062) * (-1178.941) [-1177.667] (-1180.360) (-1177.454) -- 0:00:35 502000 -- (-1179.937) [-1179.491] (-1178.212) (-1178.311) * (-1179.663) (-1177.407) (-1178.249) [-1179.971] -- 0:00:35 502500 -- (-1180.480) (-1177.798) (-1178.205) [-1181.150] * [-1178.863] (-1177.412) (-1179.798) (-1178.447) -- 0:00:35 503000 -- (-1182.745) (-1177.806) (-1178.102) [-1177.803] * [-1180.271] (-1179.474) (-1184.357) (-1177.255) -- 0:00:35 503500 -- (-1179.768) (-1177.806) [-1178.463] (-1177.229) * (-1180.245) (-1177.712) (-1178.811) [-1180.058] -- 0:00:35 504000 -- (-1180.902) (-1177.524) [-1179.194] (-1180.764) * (-1180.076) (-1177.281) [-1177.683] (-1179.976) -- 0:00:35 504500 -- (-1178.306) [-1183.087] (-1181.633) (-1182.420) * (-1181.121) [-1178.907] (-1179.303) (-1181.512) -- 0:00:35 505000 -- (-1178.495) (-1177.288) [-1181.693] (-1182.306) * (-1182.305) (-1178.683) [-1181.134] (-1179.709) -- 0:00:35 Average standard deviation of split frequencies: 0.011283 505500 -- (-1180.800) (-1178.341) [-1179.015] (-1180.986) * (-1179.410) [-1179.627] (-1179.532) (-1179.212) -- 0:00:35 506000 -- (-1178.930) (-1178.347) [-1178.913] (-1181.064) * (-1179.834) (-1177.955) (-1178.723) [-1178.261] -- 0:00:35 506500 -- (-1178.046) (-1179.603) (-1180.527) [-1177.393] * (-1177.830) (-1177.195) (-1178.773) [-1178.934] -- 0:00:35 507000 -- [-1177.614] (-1178.077) (-1179.889) (-1181.908) * (-1179.281) (-1178.388) [-1184.313] (-1180.642) -- 0:00:35 507500 -- (-1181.587) (-1178.923) (-1180.258) [-1181.906] * (-1178.029) [-1180.590] (-1182.542) (-1178.803) -- 0:00:35 508000 -- (-1181.224) (-1178.825) (-1178.057) [-1180.610] * (-1179.394) (-1191.272) (-1179.582) [-1181.256] -- 0:00:35 508500 -- [-1178.092] (-1180.501) (-1178.363) (-1182.760) * (-1180.474) [-1180.562] (-1182.267) (-1182.362) -- 0:00:35 509000 -- [-1178.207] (-1180.250) (-1179.046) (-1179.464) * (-1178.241) (-1178.911) (-1178.915) [-1178.410] -- 0:00:35 509500 -- (-1179.420) (-1183.871) (-1180.341) [-1178.910] * [-1178.792] (-1179.647) (-1179.793) (-1178.497) -- 0:00:35 510000 -- (-1180.276) (-1179.043) [-1182.089] (-1179.080) * [-1178.402] (-1180.174) (-1178.840) (-1178.719) -- 0:00:35 Average standard deviation of split frequencies: 0.010689 510500 -- (-1178.373) (-1180.826) (-1177.528) [-1181.078] * (-1183.391) (-1180.654) [-1177.263] (-1178.583) -- 0:00:35 511000 -- (-1186.381) (-1181.949) [-1179.181] (-1179.216) * (-1178.492) (-1179.873) (-1179.652) [-1181.849] -- 0:00:35 511500 -- (-1178.832) (-1178.454) (-1179.292) [-1180.607] * (-1182.089) [-1177.880] (-1179.767) (-1179.834) -- 0:00:35 512000 -- (-1178.962) [-1178.367] (-1179.581) (-1181.594) * [-1180.798] (-1177.898) (-1179.838) (-1177.538) -- 0:00:35 512500 -- (-1178.587) (-1178.072) [-1181.608] (-1180.228) * (-1179.823) (-1180.562) [-1177.696] (-1178.786) -- 0:00:35 513000 -- (-1181.186) (-1179.006) [-1181.367] (-1183.153) * (-1184.186) [-1179.605] (-1179.974) (-1177.399) -- 0:00:35 513500 -- (-1180.307) (-1181.925) (-1179.362) [-1183.308] * (-1179.150) (-1179.588) (-1180.709) [-1178.324] -- 0:00:35 514000 -- (-1177.490) (-1179.677) [-1178.124] (-1178.224) * [-1179.014] (-1180.213) (-1178.630) (-1179.151) -- 0:00:34 514500 -- (-1178.688) [-1178.483] (-1178.528) (-1178.970) * (-1180.074) (-1180.998) (-1178.288) [-1179.817] -- 0:00:34 515000 -- (-1178.556) [-1177.348] (-1178.859) (-1179.670) * (-1178.223) [-1179.943] (-1180.338) (-1178.479) -- 0:00:34 Average standard deviation of split frequencies: 0.010709 515500 -- (-1182.614) (-1181.638) (-1181.351) [-1178.392] * (-1181.458) (-1182.710) [-1179.674] (-1180.024) -- 0:00:34 516000 -- (-1177.395) [-1179.123] (-1181.290) (-1178.993) * (-1181.816) [-1179.682] (-1181.283) (-1181.454) -- 0:00:34 516500 -- (-1178.415) (-1179.742) [-1181.018] (-1182.346) * [-1180.153] (-1178.743) (-1178.593) (-1181.939) -- 0:00:34 517000 -- [-1179.430] (-1182.206) (-1179.199) (-1178.802) * (-1178.540) [-1179.569] (-1178.342) (-1179.934) -- 0:00:34 517500 -- (-1179.656) (-1177.587) [-1179.389] (-1178.619) * (-1182.498) (-1179.787) [-1178.384] (-1180.405) -- 0:00:34 518000 -- (-1180.707) (-1178.888) (-1182.895) [-1180.352] * [-1183.327] (-1178.478) (-1177.726) (-1182.528) -- 0:00:34 518500 -- (-1177.824) (-1181.604) [-1178.968] (-1180.457) * (-1182.882) [-1180.742] (-1179.094) (-1180.025) -- 0:00:34 519000 -- (-1179.524) (-1187.777) (-1181.814) [-1178.316] * (-1178.218) (-1178.403) (-1178.678) [-1179.730] -- 0:00:34 519500 -- (-1179.339) (-1180.383) [-1178.757] (-1179.584) * [-1178.809] (-1177.489) (-1182.294) (-1180.701) -- 0:00:34 520000 -- (-1180.815) (-1178.760) (-1180.557) [-1178.652] * [-1181.080] (-1179.223) (-1181.379) (-1179.868) -- 0:00:35 Average standard deviation of split frequencies: 0.010462 520500 -- (-1179.227) (-1180.230) [-1181.897] (-1181.861) * [-1180.177] (-1180.650) (-1180.217) (-1181.000) -- 0:00:35 521000 -- (-1180.397) (-1179.906) [-1180.018] (-1180.265) * (-1181.145) [-1184.011] (-1181.731) (-1179.863) -- 0:00:34 521500 -- (-1179.369) (-1185.936) [-1179.456] (-1180.224) * (-1179.443) (-1178.382) [-1179.278] (-1180.012) -- 0:00:34 522000 -- (-1178.457) [-1178.960] (-1179.694) (-1180.470) * (-1179.557) [-1181.289] (-1178.551) (-1178.668) -- 0:00:34 522500 -- (-1182.268) [-1179.207] (-1177.453) (-1182.967) * [-1177.738] (-1179.487) (-1181.223) (-1182.103) -- 0:00:34 523000 -- [-1177.463] (-1179.646) (-1178.637) (-1182.586) * [-1178.324] (-1183.416) (-1178.144) (-1182.521) -- 0:00:34 523500 -- [-1179.435] (-1183.709) (-1177.648) (-1179.290) * (-1185.274) (-1180.554) [-1177.404] (-1179.317) -- 0:00:34 524000 -- (-1184.631) [-1181.935] (-1177.793) (-1182.416) * (-1182.426) (-1178.353) (-1178.532) [-1180.907] -- 0:00:34 524500 -- (-1182.852) (-1179.102) (-1178.823) [-1180.293] * (-1177.728) (-1181.701) (-1180.170) [-1178.418] -- 0:00:34 525000 -- [-1178.992] (-1177.401) (-1179.317) (-1179.459) * (-1180.880) (-1179.718) [-1177.763] (-1178.785) -- 0:00:34 Average standard deviation of split frequencies: 0.009808 525500 -- (-1178.866) [-1177.350] (-1179.011) (-1179.148) * (-1181.721) (-1180.942) [-1178.633] (-1178.328) -- 0:00:34 526000 -- (-1177.721) (-1177.376) (-1177.978) [-1177.411] * [-1181.461] (-1180.044) (-1178.635) (-1178.704) -- 0:00:34 526500 -- (-1180.174) [-1179.670] (-1179.455) (-1178.426) * (-1178.967) [-1180.036] (-1180.635) (-1178.879) -- 0:00:34 527000 -- (-1179.481) (-1179.588) (-1182.071) [-1177.809] * [-1181.391] (-1180.811) (-1179.585) (-1178.844) -- 0:00:34 527500 -- (-1180.399) [-1178.661] (-1187.781) (-1177.504) * [-1179.031] (-1180.957) (-1179.885) (-1182.367) -- 0:00:34 528000 -- [-1182.603] (-1181.504) (-1183.475) (-1178.208) * (-1178.200) (-1182.957) [-1180.084] (-1178.836) -- 0:00:33 528500 -- (-1181.080) [-1179.799] (-1183.540) (-1181.376) * (-1180.571) (-1180.941) [-1178.781] (-1184.002) -- 0:00:33 529000 -- (-1180.743) (-1181.494) (-1180.096) [-1178.869] * (-1180.220) (-1178.376) [-1178.570] (-1183.484) -- 0:00:33 529500 -- (-1177.566) (-1178.139) [-1180.534] (-1180.603) * (-1181.143) (-1178.225) [-1178.396] (-1186.827) -- 0:00:33 530000 -- (-1177.727) [-1182.053] (-1181.527) (-1178.824) * [-1180.123] (-1179.983) (-1177.294) (-1180.054) -- 0:00:33 Average standard deviation of split frequencies: 0.009870 530500 -- [-1178.153] (-1178.758) (-1179.102) (-1180.909) * (-1178.531) (-1177.493) (-1180.640) [-1180.600] -- 0:00:33 531000 -- (-1179.341) (-1177.594) [-1178.799] (-1181.800) * (-1178.042) (-1177.267) [-1183.668] (-1181.447) -- 0:00:33 531500 -- (-1183.387) (-1179.976) [-1177.979] (-1179.879) * (-1179.025) (-1180.237) [-1181.267] (-1180.895) -- 0:00:33 532000 -- (-1181.279) (-1179.705) (-1178.079) [-1181.867] * (-1181.279) (-1183.254) (-1183.256) [-1181.298] -- 0:00:33 532500 -- (-1182.195) (-1179.124) (-1181.831) [-1180.369] * (-1181.277) (-1179.376) [-1181.838] (-1179.636) -- 0:00:33 533000 -- [-1178.990] (-1177.891) (-1180.408) (-1178.980) * (-1181.879) [-1178.659] (-1180.282) (-1180.294) -- 0:00:33 533500 -- (-1178.751) (-1177.846) [-1182.927] (-1190.981) * (-1180.775) (-1178.125) [-1180.025] (-1178.300) -- 0:00:33 534000 -- (-1181.616) (-1181.267) (-1178.526) [-1179.415] * (-1187.091) (-1181.406) [-1181.780] (-1179.203) -- 0:00:34 534500 -- (-1178.361) (-1179.255) [-1179.112] (-1178.831) * (-1178.244) (-1177.522) [-1184.288] (-1182.620) -- 0:00:33 535000 -- [-1178.360] (-1178.661) (-1179.012) (-1180.128) * (-1178.205) (-1180.237) [-1183.260] (-1179.580) -- 0:00:33 Average standard deviation of split frequencies: 0.009772 535500 -- (-1180.011) (-1179.681) (-1180.628) [-1183.231] * [-1178.227] (-1177.080) (-1180.785) (-1178.711) -- 0:00:33 536000 -- (-1180.629) [-1179.185] (-1180.583) (-1181.378) * (-1179.130) (-1179.717) [-1181.459] (-1177.981) -- 0:00:33 536500 -- (-1179.856) (-1182.500) (-1177.652) [-1181.903] * (-1179.198) [-1177.197] (-1178.146) (-1177.254) -- 0:00:33 537000 -- (-1179.342) (-1191.260) (-1178.910) [-1179.791] * [-1179.192] (-1182.031) (-1180.778) (-1177.751) -- 0:00:33 537500 -- (-1179.876) (-1191.349) [-1178.593] (-1180.365) * (-1180.487) (-1179.472) (-1178.947) [-1182.314] -- 0:00:33 538000 -- [-1181.290] (-1182.066) (-1178.054) (-1179.299) * (-1180.778) (-1178.628) [-1179.198] (-1179.330) -- 0:00:33 538500 -- (-1177.780) (-1182.223) [-1178.663] (-1179.369) * [-1178.696] (-1179.038) (-1179.007) (-1178.183) -- 0:00:33 539000 -- (-1178.742) (-1180.647) [-1179.788] (-1177.836) * (-1180.044) (-1177.963) (-1177.705) [-1184.013] -- 0:00:33 539500 -- [-1180.752] (-1183.506) (-1177.777) (-1181.209) * (-1177.339) (-1179.366) [-1178.266] (-1177.443) -- 0:00:33 540000 -- (-1179.532) (-1179.166) (-1180.121) [-1178.176] * [-1178.440] (-1177.227) (-1178.316) (-1182.229) -- 0:00:33 Average standard deviation of split frequencies: 0.009639 540500 -- (-1181.183) (-1179.379) [-1180.134] (-1185.892) * (-1181.644) [-1180.466] (-1178.570) (-1184.955) -- 0:00:33 541000 -- [-1182.382] (-1179.147) (-1181.125) (-1185.195) * (-1181.622) (-1182.760) (-1180.666) [-1180.216] -- 0:00:33 541500 -- (-1179.603) [-1181.900] (-1182.525) (-1179.072) * (-1182.175) (-1177.425) [-1179.669] (-1179.057) -- 0:00:33 542000 -- (-1180.303) [-1177.494] (-1180.605) (-1178.504) * (-1177.553) [-1177.160] (-1179.631) (-1179.325) -- 0:00:32 542500 -- (-1180.063) (-1179.308) (-1180.511) [-1177.837] * (-1179.933) [-1178.092] (-1177.845) (-1177.623) -- 0:00:32 543000 -- (-1177.216) [-1179.250] (-1181.592) (-1178.540) * [-1179.296] (-1180.428) (-1177.923) (-1185.465) -- 0:00:32 543500 -- (-1178.903) (-1177.667) (-1180.899) [-1179.748] * (-1177.973) (-1182.726) [-1179.739] (-1182.181) -- 0:00:32 544000 -- [-1179.626] (-1178.657) (-1177.942) (-1177.280) * (-1179.259) (-1182.826) (-1179.739) [-1178.636] -- 0:00:32 544500 -- [-1179.669] (-1178.549) (-1177.499) (-1178.696) * (-1181.941) [-1179.473] (-1190.064) (-1179.793) -- 0:00:32 545000 -- [-1178.733] (-1181.222) (-1181.147) (-1178.928) * (-1179.526) [-1177.589] (-1181.123) (-1182.507) -- 0:00:32 Average standard deviation of split frequencies: 0.009543 545500 -- (-1178.905) (-1180.744) [-1180.222] (-1182.074) * (-1177.887) (-1177.411) (-1178.375) [-1180.980] -- 0:00:32 546000 -- [-1180.776] (-1180.241) (-1180.177) (-1182.720) * (-1181.411) (-1181.570) [-1180.359] (-1178.883) -- 0:00:32 546500 -- (-1180.460) (-1179.831) [-1178.364] (-1178.002) * [-1180.871] (-1178.386) (-1180.788) (-1179.448) -- 0:00:32 547000 -- (-1178.421) (-1179.454) (-1179.585) [-1178.870] * (-1181.953) (-1178.751) (-1180.833) [-1179.449] -- 0:00:32 547500 -- (-1178.985) (-1178.910) [-1177.830] (-1177.378) * (-1180.044) [-1180.087] (-1181.738) (-1180.898) -- 0:00:32 548000 -- (-1177.672) (-1178.478) [-1178.582] (-1179.092) * (-1178.690) (-1180.480) [-1180.249] (-1180.394) -- 0:00:32 548500 -- (-1179.869) (-1178.362) [-1180.311] (-1179.463) * (-1178.974) (-1178.769) (-1188.624) [-1178.666] -- 0:00:32 549000 -- (-1179.527) [-1179.837] (-1180.646) (-1182.134) * (-1180.102) [-1180.550] (-1179.384) (-1183.921) -- 0:00:32 549500 -- (-1178.262) [-1179.324] (-1184.361) (-1180.314) * [-1177.559] (-1178.732) (-1182.176) (-1182.961) -- 0:00:32 550000 -- (-1178.377) (-1178.462) [-1183.365] (-1178.812) * (-1178.497) (-1180.545) (-1181.489) [-1179.937] -- 0:00:32 Average standard deviation of split frequencies: 0.009845 550500 -- (-1178.377) [-1178.133] (-1182.460) (-1177.950) * (-1178.297) (-1180.009) (-1179.293) [-1178.415] -- 0:00:32 551000 -- [-1179.796] (-1178.177) (-1178.318) (-1179.200) * [-1178.746] (-1177.498) (-1180.277) (-1179.107) -- 0:00:32 551500 -- (-1178.932) [-1182.230] (-1178.498) (-1180.164) * (-1177.997) (-1180.109) (-1179.891) [-1178.361] -- 0:00:32 552000 -- (-1179.287) [-1178.802] (-1187.919) (-1178.444) * [-1181.363] (-1180.231) (-1178.753) (-1180.447) -- 0:00:32 552500 -- (-1182.158) (-1180.278) (-1179.414) [-1177.221] * (-1178.371) (-1180.267) (-1180.597) [-1179.384] -- 0:00:32 553000 -- (-1177.891) (-1178.440) (-1186.869) [-1177.108] * (-1179.162) (-1179.005) [-1180.224] (-1180.196) -- 0:00:32 553500 -- (-1181.363) (-1179.960) (-1184.512) [-1179.559] * [-1179.005] (-1180.317) (-1178.487) (-1180.727) -- 0:00:32 554000 -- (-1178.557) (-1180.106) (-1182.036) [-1178.077] * [-1179.277] (-1179.876) (-1180.712) (-1177.290) -- 0:00:32 554500 -- [-1177.501] (-1179.944) (-1180.165) (-1179.080) * (-1180.035) (-1179.068) (-1178.745) [-1177.922] -- 0:00:32 555000 -- (-1177.641) [-1181.776] (-1178.211) (-1179.622) * (-1179.539) [-1182.245] (-1177.639) (-1179.038) -- 0:00:32 Average standard deviation of split frequencies: 0.010025 555500 -- (-1178.406) [-1180.846] (-1180.558) (-1187.862) * (-1177.532) (-1179.128) [-1177.319] (-1178.221) -- 0:00:32 556000 -- (-1178.406) (-1178.142) [-1180.381] (-1179.926) * (-1179.087) [-1178.643] (-1179.671) (-1178.431) -- 0:00:31 556500 -- (-1178.585) (-1178.389) [-1181.993] (-1182.373) * (-1180.419) [-1179.938] (-1180.651) (-1183.178) -- 0:00:31 557000 -- (-1178.837) (-1178.510) (-1178.274) [-1179.379] * (-1179.982) (-1181.157) (-1179.339) [-1178.851] -- 0:00:31 557500 -- (-1178.662) (-1180.559) (-1187.439) [-1178.317] * [-1181.517] (-1181.296) (-1179.217) (-1178.764) -- 0:00:31 558000 -- (-1183.851) (-1179.981) (-1182.864) [-1181.222] * (-1182.346) (-1180.931) [-1179.337] (-1180.647) -- 0:00:31 558500 -- [-1178.569] (-1180.691) (-1180.127) (-1178.436) * (-1180.733) (-1179.030) (-1178.800) [-1178.301] -- 0:00:31 559000 -- [-1178.616] (-1183.199) (-1180.823) (-1182.118) * [-1178.904] (-1178.787) (-1178.771) (-1181.106) -- 0:00:31 559500 -- (-1181.468) (-1181.340) [-1179.558] (-1179.846) * [-1177.850] (-1179.532) (-1178.701) (-1179.600) -- 0:00:31 560000 -- (-1184.840) (-1180.783) [-1178.390] (-1180.049) * [-1180.245] (-1178.070) (-1181.105) (-1180.113) -- 0:00:32 Average standard deviation of split frequencies: 0.010188 560500 -- (-1180.946) (-1179.869) (-1187.847) [-1183.237] * (-1178.675) [-1177.417] (-1181.570) (-1178.741) -- 0:00:32 561000 -- (-1180.448) (-1179.844) [-1178.371] (-1178.839) * (-1186.804) [-1178.171] (-1177.910) (-1178.104) -- 0:00:32 561500 -- [-1179.526] (-1178.595) (-1181.535) (-1182.791) * [-1180.095] (-1177.691) (-1179.007) (-1177.938) -- 0:00:32 562000 -- (-1178.614) [-1178.666] (-1178.838) (-1184.559) * [-1180.939] (-1178.896) (-1178.902) (-1177.875) -- 0:00:31 562500 -- (-1182.019) [-1180.410] (-1178.161) (-1180.360) * (-1179.230) (-1178.381) (-1178.994) [-1177.811] -- 0:00:31 563000 -- (-1183.128) (-1178.755) (-1177.058) [-1179.998] * (-1185.095) (-1177.391) (-1180.842) [-1179.905] -- 0:00:31 563500 -- (-1179.705) (-1180.259) (-1177.057) [-1179.335] * (-1178.143) [-1180.514] (-1186.516) (-1180.586) -- 0:00:31 564000 -- (-1179.720) (-1178.949) (-1178.382) [-1180.202] * [-1179.763] (-1180.318) (-1180.802) (-1182.181) -- 0:00:31 564500 -- [-1179.213] (-1177.627) (-1180.780) (-1179.576) * (-1181.506) (-1178.506) [-1180.596] (-1178.278) -- 0:00:31 565000 -- [-1178.001] (-1179.301) (-1179.234) (-1180.586) * (-1183.830) [-1178.245] (-1177.469) (-1178.314) -- 0:00:31 Average standard deviation of split frequencies: 0.010288 565500 -- [-1177.506] (-1177.509) (-1178.818) (-1181.775) * (-1179.959) (-1178.791) (-1177.220) [-1177.996] -- 0:00:31 566000 -- (-1178.142) (-1179.153) (-1179.834) [-1180.332] * (-1179.649) [-1181.781] (-1178.415) (-1177.994) -- 0:00:31 566500 -- [-1178.075] (-1180.983) (-1179.496) (-1179.810) * (-1179.672) [-1177.477] (-1178.144) (-1181.674) -- 0:00:31 567000 -- (-1179.920) (-1180.412) [-1177.993] (-1181.421) * [-1177.316] (-1179.377) (-1177.682) (-1178.853) -- 0:00:31 567500 -- (-1180.137) [-1178.752] (-1181.697) (-1181.387) * (-1179.322) (-1182.226) [-1177.148] (-1177.415) -- 0:00:31 568000 -- [-1180.052] (-1178.804) (-1181.349) (-1177.710) * (-1179.145) (-1180.863) [-1177.096] (-1178.841) -- 0:00:31 568500 -- (-1179.133) (-1177.858) [-1179.700] (-1179.792) * (-1181.203) (-1185.065) (-1178.456) [-1178.835] -- 0:00:31 569000 -- (-1179.060) (-1181.387) [-1181.019] (-1180.234) * (-1178.812) (-1178.574) [-1178.140] (-1177.379) -- 0:00:31 569500 -- (-1178.156) (-1178.592) (-1178.587) [-1179.654] * (-1179.474) (-1179.266) (-1180.528) [-1177.645] -- 0:00:30 570000 -- (-1182.045) (-1180.314) (-1181.752) [-1179.706] * [-1179.334] (-1183.665) (-1178.473) (-1180.957) -- 0:00:30 Average standard deviation of split frequencies: 0.010739 570500 -- (-1179.091) [-1177.620] (-1180.258) (-1178.255) * (-1177.360) (-1180.540) (-1178.441) [-1179.097] -- 0:00:30 571000 -- (-1181.127) [-1177.789] (-1181.769) (-1178.705) * (-1177.174) (-1179.358) [-1178.191] (-1178.033) -- 0:00:30 571500 -- (-1181.792) [-1179.442] (-1177.120) (-1177.640) * (-1177.912) (-1179.095) (-1180.604) [-1179.362] -- 0:00:30 572000 -- (-1179.934) [-1177.942] (-1181.064) (-1177.465) * [-1178.525] (-1181.153) (-1183.603) (-1183.888) -- 0:00:31 572500 -- [-1180.569] (-1181.483) (-1178.926) (-1178.655) * [-1177.804] (-1181.227) (-1181.009) (-1179.640) -- 0:00:31 573000 -- (-1181.074) (-1178.124) (-1178.410) [-1177.799] * (-1178.539) (-1180.748) (-1182.309) [-1181.403] -- 0:00:31 573500 -- [-1180.494] (-1178.471) (-1178.823) (-1180.469) * (-1179.796) (-1180.133) [-1180.472] (-1183.107) -- 0:00:31 574000 -- [-1180.275] (-1178.141) (-1180.494) (-1179.137) * [-1182.547] (-1182.690) (-1178.355) (-1179.423) -- 0:00:31 574500 -- (-1179.896) [-1177.548] (-1179.469) (-1184.950) * [-1182.094] (-1180.579) (-1178.571) (-1179.758) -- 0:00:31 575000 -- (-1182.184) (-1180.265) [-1178.867] (-1179.031) * (-1180.136) (-1179.855) (-1179.065) [-1178.143] -- 0:00:31 Average standard deviation of split frequencies: 0.011185 575500 -- (-1180.077) [-1177.928] (-1180.189) (-1178.312) * (-1178.146) [-1179.414] (-1178.309) (-1177.640) -- 0:00:30 576000 -- [-1179.900] (-1177.355) (-1179.589) (-1178.431) * (-1182.993) [-1177.996] (-1181.658) (-1181.127) -- 0:00:30 576500 -- (-1179.344) (-1181.844) [-1178.803] (-1179.390) * (-1178.704) (-1183.356) [-1180.579] (-1182.941) -- 0:00:30 577000 -- (-1179.947) (-1182.931) [-1178.885] (-1179.063) * (-1178.680) (-1178.859) [-1181.145] (-1182.125) -- 0:00:30 577500 -- (-1179.058) (-1185.206) (-1180.088) [-1179.427] * [-1180.716] (-1179.189) (-1181.207) (-1183.088) -- 0:00:30 578000 -- [-1178.341] (-1185.083) (-1181.837) (-1178.279) * (-1180.202) (-1183.222) (-1179.371) [-1178.380] -- 0:00:30 578500 -- (-1178.617) [-1177.085] (-1180.974) (-1178.531) * (-1180.610) (-1177.669) (-1181.213) [-1179.284] -- 0:00:30 579000 -- (-1178.487) (-1181.311) (-1179.044) [-1178.009] * (-1180.928) [-1179.690] (-1179.069) (-1184.018) -- 0:00:30 579500 -- (-1179.349) (-1178.903) (-1183.605) [-1178.375] * (-1177.843) [-1179.992] (-1178.340) (-1183.258) -- 0:00:30 580000 -- [-1178.624] (-1178.942) (-1187.554) (-1179.816) * (-1178.104) (-1183.106) (-1181.322) [-1178.916] -- 0:00:30 Average standard deviation of split frequencies: 0.011127 580500 -- (-1178.449) (-1178.016) [-1180.161] (-1179.768) * (-1179.613) (-1179.741) (-1179.554) [-1180.559] -- 0:00:30 581000 -- (-1177.970) (-1179.831) (-1179.545) [-1177.889] * (-1179.338) (-1180.364) [-1178.297] (-1179.813) -- 0:00:30 581500 -- (-1179.740) (-1179.821) (-1179.959) [-1177.845] * (-1179.551) [-1179.436] (-1178.191) (-1181.783) -- 0:00:30 582000 -- (-1180.080) [-1178.606] (-1178.163) (-1178.016) * (-1179.430) [-1179.706] (-1179.903) (-1178.780) -- 0:00:30 582500 -- (-1180.875) [-1177.967] (-1181.219) (-1178.765) * (-1177.670) (-1180.035) [-1177.996] (-1177.282) -- 0:00:30 583000 -- (-1178.941) (-1177.230) [-1179.902] (-1178.243) * [-1178.945] (-1178.932) (-1185.526) (-1177.933) -- 0:00:30 583500 -- (-1178.515) (-1178.732) (-1180.113) [-1177.511] * (-1177.799) [-1178.111] (-1182.044) (-1179.997) -- 0:00:29 584000 -- (-1179.611) (-1179.612) [-1179.974] (-1177.630) * (-1178.305) (-1179.034) (-1181.532) [-1182.466] -- 0:00:30 584500 -- (-1178.326) (-1179.109) [-1183.305] (-1179.432) * (-1180.952) (-1179.806) (-1178.754) [-1180.790] -- 0:00:30 585000 -- (-1180.554) (-1177.363) [-1179.042] (-1178.828) * (-1179.866) (-1177.909) (-1179.603) [-1181.754] -- 0:00:30 Average standard deviation of split frequencies: 0.010288 585500 -- [-1180.075] (-1179.135) (-1179.774) (-1182.281) * (-1178.755) (-1177.192) (-1178.856) [-1178.753] -- 0:00:30 586000 -- (-1179.969) (-1180.647) (-1180.671) [-1176.972] * [-1177.758] (-1179.293) (-1179.436) (-1181.882) -- 0:00:30 586500 -- (-1177.501) (-1177.293) [-1178.196] (-1176.986) * (-1180.604) [-1180.890] (-1179.733) (-1180.797) -- 0:00:30 587000 -- (-1178.003) [-1179.031] (-1178.963) (-1177.098) * (-1178.305) [-1181.197] (-1182.687) (-1179.578) -- 0:00:30 587500 -- (-1178.062) (-1179.868) [-1181.147] (-1177.638) * [-1177.677] (-1179.807) (-1178.035) (-1179.287) -- 0:00:30 588000 -- [-1179.583] (-1178.654) (-1178.487) (-1178.100) * (-1180.942) (-1180.087) (-1180.181) [-1181.279] -- 0:00:30 588500 -- (-1180.773) [-1177.674] (-1178.041) (-1180.351) * [-1177.827] (-1181.392) (-1180.005) (-1181.228) -- 0:00:30 589000 -- (-1181.052) [-1177.214] (-1177.842) (-1181.894) * (-1182.816) [-1181.658] (-1178.488) (-1179.488) -- 0:00:30 589500 -- [-1180.332] (-1177.893) (-1177.821) (-1182.942) * (-1183.501) [-1180.888] (-1180.071) (-1178.797) -- 0:00:29 590000 -- (-1178.431) (-1177.989) (-1180.530) [-1179.129] * (-1179.272) [-1180.443] (-1181.721) (-1181.769) -- 0:00:29 Average standard deviation of split frequencies: 0.010553 590500 -- (-1182.465) (-1178.216) (-1180.966) [-1178.304] * (-1177.731) [-1179.673] (-1180.302) (-1178.968) -- 0:00:29 591000 -- (-1183.354) [-1178.692] (-1184.400) (-1179.771) * (-1177.331) [-1178.186] (-1177.928) (-1179.094) -- 0:00:29 591500 -- (-1180.692) (-1181.551) [-1180.203] (-1177.893) * (-1179.362) (-1178.723) [-1180.389] (-1178.945) -- 0:00:29 592000 -- [-1177.778] (-1179.475) (-1180.307) (-1182.348) * (-1177.567) (-1180.575) [-1179.064] (-1178.969) -- 0:00:29 592500 -- (-1180.863) (-1179.108) [-1177.763] (-1178.407) * [-1177.567] (-1180.040) (-1179.675) (-1177.610) -- 0:00:29 593000 -- (-1179.636) (-1178.631) (-1179.807) [-1184.530] * (-1178.466) (-1178.266) [-1177.154] (-1177.828) -- 0:00:29 593500 -- (-1179.681) (-1178.292) (-1178.573) [-1181.218] * [-1177.966] (-1179.100) (-1177.915) (-1177.661) -- 0:00:29 594000 -- [-1177.328] (-1177.605) (-1180.151) (-1180.519) * (-1178.478) (-1180.024) [-1178.324] (-1177.932) -- 0:00:29 594500 -- (-1177.767) [-1177.578] (-1179.107) (-1181.582) * (-1184.305) (-1178.524) (-1179.771) [-1178.837] -- 0:00:29 595000 -- (-1179.478) (-1180.741) (-1180.585) [-1177.906] * [-1178.766] (-1178.076) (-1178.572) (-1178.412) -- 0:00:29 Average standard deviation of split frequencies: 0.010907 595500 -- (-1181.439) (-1179.093) [-1179.725] (-1179.299) * (-1186.177) (-1177.792) [-1180.617] (-1177.174) -- 0:00:29 596000 -- [-1180.502] (-1178.288) (-1182.285) (-1179.853) * (-1182.273) (-1178.779) (-1177.823) [-1178.012] -- 0:00:29 596500 -- (-1183.098) (-1177.663) [-1181.692] (-1178.117) * (-1179.204) (-1178.808) (-1178.899) [-1178.844] -- 0:00:29 597000 -- [-1179.269] (-1178.386) (-1180.393) (-1180.302) * [-1179.341] (-1177.464) (-1177.451) (-1180.623) -- 0:00:29 597500 -- (-1180.852) [-1180.982] (-1179.204) (-1178.695) * (-1178.387) [-1181.626] (-1178.514) (-1178.322) -- 0:00:29 598000 -- (-1178.592) (-1179.655) (-1182.054) [-1178.674] * [-1179.027] (-1185.323) (-1180.295) (-1180.428) -- 0:00:29 598500 -- (-1179.936) (-1180.530) (-1179.812) [-1177.355] * [-1181.037] (-1180.120) (-1178.908) (-1177.470) -- 0:00:29 599000 -- (-1178.293) [-1186.800] (-1181.526) (-1179.177) * (-1184.197) (-1179.260) [-1177.215] (-1180.200) -- 0:00:29 599500 -- (-1178.004) (-1180.103) (-1180.742) [-1177.336] * [-1179.102] (-1179.658) (-1178.232) (-1185.092) -- 0:00:29 600000 -- (-1179.506) (-1179.889) (-1184.500) [-1177.465] * (-1178.902) (-1181.335) [-1178.460] (-1181.941) -- 0:00:29 Average standard deviation of split frequencies: 0.010822 600500 -- (-1179.572) [-1178.878] (-1179.613) (-1177.465) * (-1181.961) (-1177.871) (-1180.534) [-1179.794] -- 0:00:29 601000 -- [-1179.812] (-1178.027) (-1178.005) (-1178.842) * (-1177.481) (-1177.702) [-1179.279] (-1179.109) -- 0:00:29 601500 -- (-1180.036) (-1177.990) [-1180.202] (-1180.553) * (-1179.106) [-1177.741] (-1179.199) (-1186.472) -- 0:00:29 602000 -- (-1181.777) [-1178.628] (-1179.521) (-1180.224) * (-1179.734) (-1179.686) [-1181.970] (-1182.601) -- 0:00:29 602500 -- (-1185.856) [-1180.295] (-1178.434) (-1184.080) * (-1182.954) (-1182.155) (-1178.992) [-1179.541] -- 0:00:29 603000 -- (-1184.010) [-1178.048] (-1179.497) (-1177.909) * [-1178.752] (-1186.303) (-1181.099) (-1178.793) -- 0:00:28 603500 -- (-1183.946) (-1178.370) [-1181.006] (-1179.041) * (-1181.941) (-1185.029) [-1178.357] (-1181.150) -- 0:00:28 604000 -- (-1178.421) (-1181.804) (-1180.551) [-1184.124] * [-1178.536] (-1177.734) (-1181.258) (-1178.266) -- 0:00:28 604500 -- (-1179.156) [-1179.217] (-1182.753) (-1178.366) * (-1180.041) [-1178.244] (-1178.461) (-1181.554) -- 0:00:28 605000 -- (-1178.208) (-1179.585) (-1178.911) [-1178.366] * (-1179.702) [-1177.857] (-1178.201) (-1181.552) -- 0:00:28 Average standard deviation of split frequencies: 0.010645 605500 -- (-1178.986) [-1178.893] (-1179.804) (-1180.490) * (-1177.349) [-1177.202] (-1179.991) (-1182.735) -- 0:00:28 606000 -- (-1181.023) [-1178.217] (-1178.478) (-1179.839) * [-1178.662] (-1178.798) (-1182.188) (-1177.318) -- 0:00:28 606500 -- (-1179.367) (-1181.333) [-1179.133] (-1178.134) * (-1178.659) [-1178.383] (-1182.275) (-1178.588) -- 0:00:28 607000 -- (-1179.521) (-1178.406) (-1178.100) [-1180.390] * (-1179.801) [-1182.326] (-1177.613) (-1177.917) -- 0:00:29 607500 -- (-1178.079) (-1179.314) (-1183.428) [-1178.640] * (-1180.974) [-1179.466] (-1180.184) (-1179.708) -- 0:00:29 608000 -- (-1177.679) (-1179.325) (-1184.680) [-1178.865] * (-1178.302) (-1179.021) [-1177.969] (-1181.635) -- 0:00:29 608500 -- (-1181.599) [-1188.429] (-1180.725) (-1181.448) * (-1179.960) (-1180.509) (-1178.252) [-1178.672] -- 0:00:28 609000 -- [-1178.630] (-1182.887) (-1184.189) (-1181.133) * [-1179.070] (-1184.874) (-1178.245) (-1180.166) -- 0:00:28 609500 -- (-1182.053) (-1177.973) [-1177.296] (-1182.549) * (-1181.120) (-1177.640) [-1177.526] (-1179.382) -- 0:00:28 610000 -- (-1177.429) [-1181.503] (-1178.180) (-1180.927) * [-1178.861] (-1180.874) (-1181.379) (-1179.872) -- 0:00:28 Average standard deviation of split frequencies: 0.010293 610500 -- (-1183.340) (-1179.993) [-1177.639] (-1183.458) * [-1185.982] (-1179.641) (-1180.617) (-1177.827) -- 0:00:28 611000 -- (-1186.290) [-1179.547] (-1180.124) (-1181.081) * (-1183.052) [-1178.545] (-1178.829) (-1178.393) -- 0:00:28 611500 -- [-1188.885] (-1180.511) (-1181.150) (-1181.380) * [-1178.913] (-1180.253) (-1180.083) (-1178.759) -- 0:00:28 612000 -- [-1179.820] (-1177.924) (-1182.344) (-1179.590) * (-1182.023) (-1180.747) [-1179.671] (-1179.044) -- 0:00:28 612500 -- [-1180.015] (-1181.004) (-1179.187) (-1178.284) * (-1179.030) (-1182.635) (-1182.245) [-1178.441] -- 0:00:28 613000 -- (-1179.195) [-1180.266] (-1177.406) (-1177.410) * (-1181.238) [-1182.160] (-1181.005) (-1182.002) -- 0:00:28 613500 -- (-1179.366) (-1179.278) (-1179.616) [-1179.171] * (-1179.998) (-1185.983) [-1179.338] (-1183.538) -- 0:00:28 614000 -- (-1178.469) (-1179.147) (-1178.311) [-1181.524] * (-1178.679) [-1182.388] (-1179.339) (-1181.168) -- 0:00:28 614500 -- (-1182.445) (-1177.716) (-1182.025) [-1179.618] * [-1181.239] (-1180.737) (-1177.811) (-1178.135) -- 0:00:28 615000 -- [-1183.348] (-1179.323) (-1183.895) (-1179.356) * (-1178.692) (-1180.263) [-1179.532] (-1180.229) -- 0:00:28 Average standard deviation of split frequencies: 0.009566 615500 -- (-1179.616) (-1179.134) [-1177.932] (-1177.823) * (-1179.223) [-1181.268] (-1179.736) (-1180.033) -- 0:00:28 616000 -- [-1181.454] (-1177.949) (-1178.602) (-1178.095) * (-1177.847) (-1184.620) [-1178.472] (-1185.853) -- 0:00:28 616500 -- (-1181.303) (-1179.804) (-1180.213) [-1178.672] * (-1178.409) [-1179.913] (-1180.828) (-1178.725) -- 0:00:27 617000 -- (-1177.452) [-1177.793] (-1179.196) (-1178.672) * (-1178.556) [-1180.348] (-1180.833) (-1177.192) -- 0:00:27 617500 -- (-1180.760) (-1181.875) [-1179.886] (-1178.419) * (-1178.044) (-1181.206) (-1179.296) [-1179.209] -- 0:00:27 618000 -- (-1181.349) (-1178.813) (-1178.123) [-1180.354] * (-1178.492) (-1178.457) (-1185.642) [-1179.150] -- 0:00:28 618500 -- (-1183.468) (-1178.750) [-1179.629] (-1180.186) * (-1178.767) (-1178.671) [-1177.639] (-1177.529) -- 0:00:28 619000 -- (-1177.321) (-1182.493) (-1179.466) [-1178.419] * (-1179.487) (-1179.741) (-1179.899) [-1178.042] -- 0:00:28 619500 -- (-1179.087) (-1180.911) (-1179.471) [-1178.812] * (-1179.965) (-1181.924) (-1182.601) [-1179.114] -- 0:00:28 620000 -- [-1181.360] (-1183.804) (-1178.109) (-1177.775) * (-1183.175) [-1177.817] (-1179.864) (-1180.398) -- 0:00:28 Average standard deviation of split frequencies: 0.009194 620500 -- [-1179.469] (-1179.131) (-1178.766) (-1179.118) * (-1180.974) (-1179.624) (-1178.061) [-1179.633] -- 0:00:28 621000 -- (-1183.228) (-1179.678) [-1178.310] (-1180.830) * (-1177.980) (-1182.444) (-1177.684) [-1179.229] -- 0:00:28 621500 -- [-1180.558] (-1180.203) (-1178.771) (-1178.178) * (-1181.420) [-1177.720] (-1177.775) (-1180.451) -- 0:00:28 622000 -- (-1179.037) (-1178.158) [-1177.973] (-1179.062) * (-1181.498) (-1178.451) [-1179.819] (-1178.595) -- 0:00:27 622500 -- (-1180.302) [-1183.124] (-1179.288) (-1181.615) * (-1181.673) (-1177.822) (-1182.598) [-1181.290] -- 0:00:27 623000 -- (-1180.520) [-1177.130] (-1178.542) (-1180.735) * [-1179.972] (-1178.465) (-1181.523) (-1180.321) -- 0:00:27 623500 -- (-1180.353) (-1179.140) [-1177.480] (-1180.289) * [-1182.244] (-1177.917) (-1179.349) (-1180.615) -- 0:00:27 624000 -- [-1179.405] (-1179.003) (-1177.795) (-1180.353) * (-1179.967) [-1179.209] (-1182.033) (-1177.667) -- 0:00:27 624500 -- (-1179.428) (-1180.715) [-1180.599] (-1180.166) * (-1178.877) (-1179.713) [-1181.277] (-1177.363) -- 0:00:27 625000 -- [-1179.842] (-1178.697) (-1181.720) (-1182.507) * (-1179.514) (-1179.037) (-1177.618) [-1178.323] -- 0:00:27 Average standard deviation of split frequencies: 0.009037 625500 -- (-1178.059) (-1178.267) [-1181.478] (-1179.059) * (-1179.737) (-1179.092) [-1178.353] (-1181.629) -- 0:00:27 626000 -- (-1179.139) (-1178.404) (-1177.616) [-1180.001] * (-1177.798) (-1177.997) (-1179.233) [-1182.085] -- 0:00:27 626500 -- (-1178.129) [-1179.364] (-1184.593) (-1178.443) * (-1179.130) (-1178.776) [-1179.222] (-1184.749) -- 0:00:27 627000 -- (-1178.942) (-1181.823) [-1179.398] (-1182.204) * (-1178.122) (-1181.879) [-1177.800] (-1181.111) -- 0:00:27 627500 -- [-1182.521] (-1183.486) (-1181.827) (-1179.652) * (-1182.676) (-1179.711) [-1181.055] (-1178.600) -- 0:00:27 628000 -- (-1178.668) (-1181.369) (-1178.052) [-1178.201] * (-1182.390) (-1179.529) [-1178.634] (-1177.801) -- 0:00:27 628500 -- [-1177.193] (-1182.497) (-1179.526) (-1181.059) * [-1178.401] (-1185.639) (-1177.522) (-1179.203) -- 0:00:27 629000 -- (-1178.511) (-1179.335) [-1179.498] (-1180.070) * (-1177.510) (-1184.177) [-1179.342] (-1177.803) -- 0:00:27 629500 -- (-1181.792) [-1184.446] (-1178.238) (-1179.707) * (-1177.996) (-1180.769) [-1181.376] (-1179.824) -- 0:00:27 630000 -- (-1180.643) [-1181.030] (-1179.378) (-1185.118) * (-1178.549) (-1181.898) [-1177.760] (-1177.327) -- 0:00:27 Average standard deviation of split frequencies: 0.009088 630500 -- (-1178.931) (-1178.321) (-1179.498) [-1178.196] * (-1178.324) (-1183.524) [-1178.539] (-1181.441) -- 0:00:26 631000 -- [-1178.043] (-1178.031) (-1182.534) (-1177.316) * (-1182.144) [-1180.719] (-1178.689) (-1178.865) -- 0:00:26 631500 -- [-1179.646] (-1179.652) (-1177.816) (-1177.375) * [-1179.715] (-1181.006) (-1181.727) (-1180.451) -- 0:00:26 632000 -- [-1177.891] (-1180.933) (-1180.279) (-1178.601) * (-1177.986) (-1182.742) [-1178.990] (-1177.318) -- 0:00:26 632500 -- (-1180.695) (-1178.906) [-1178.465] (-1180.431) * (-1183.004) [-1179.566] (-1179.235) (-1177.528) -- 0:00:26 633000 -- [-1180.489] (-1183.281) (-1182.251) (-1178.270) * (-1179.860) [-1179.517] (-1180.204) (-1180.981) -- 0:00:27 633500 -- [-1180.488] (-1181.379) (-1179.359) (-1180.058) * (-1179.657) [-1181.706] (-1179.350) (-1183.025) -- 0:00:27 634000 -- (-1178.069) (-1177.906) [-1180.453] (-1178.980) * (-1177.710) (-1182.499) [-1179.419] (-1178.680) -- 0:00:27 634500 -- (-1183.225) (-1181.420) [-1180.149] (-1181.300) * [-1179.372] (-1182.196) (-1180.318) (-1179.395) -- 0:00:27 635000 -- (-1178.027) [-1184.226] (-1178.734) (-1179.502) * (-1178.979) (-1183.632) (-1180.811) [-1180.441] -- 0:00:27 Average standard deviation of split frequencies: 0.009519 635500 -- (-1177.191) (-1180.279) (-1181.977) [-1178.029] * (-1179.279) (-1180.235) [-1178.122] (-1181.043) -- 0:00:26 636000 -- (-1178.704) [-1177.562] (-1180.038) (-1178.156) * [-1179.596] (-1178.174) (-1177.938) (-1178.888) -- 0:00:26 636500 -- (-1181.914) (-1180.164) [-1178.485] (-1178.416) * [-1179.350] (-1178.784) (-1179.874) (-1180.361) -- 0:00:26 637000 -- (-1184.790) (-1179.757) [-1178.143] (-1177.768) * (-1179.451) (-1178.521) [-1180.011] (-1179.358) -- 0:00:26 637500 -- [-1179.140] (-1177.853) (-1178.045) (-1178.993) * [-1179.565] (-1179.012) (-1182.716) (-1179.774) -- 0:00:26 638000 -- [-1180.326] (-1177.799) (-1182.144) (-1177.497) * (-1180.978) (-1177.618) (-1178.772) [-1178.151] -- 0:00:26 638500 -- [-1181.482] (-1181.561) (-1181.629) (-1177.656) * (-1179.839) (-1177.381) [-1181.367] (-1179.116) -- 0:00:26 639000 -- (-1181.374) [-1180.724] (-1180.465) (-1177.735) * (-1178.217) (-1177.644) (-1179.567) [-1177.922] -- 0:00:26 639500 -- (-1184.640) (-1179.048) [-1180.289] (-1179.482) * (-1178.064) [-1178.166] (-1179.147) (-1179.224) -- 0:00:26 640000 -- (-1186.680) [-1181.455] (-1180.611) (-1181.737) * [-1179.055] (-1178.166) (-1180.301) (-1182.515) -- 0:00:26 Average standard deviation of split frequencies: 0.009198 640500 -- [-1181.259] (-1179.869) (-1177.779) (-1179.328) * (-1180.360) (-1179.061) (-1179.631) [-1183.991] -- 0:00:26 641000 -- [-1178.354] (-1179.490) (-1177.615) (-1178.063) * (-1180.973) [-1179.733] (-1180.301) (-1179.043) -- 0:00:26 641500 -- (-1178.726) (-1181.024) [-1177.353] (-1177.811) * [-1182.460] (-1185.060) (-1179.774) (-1179.549) -- 0:00:26 642000 -- (-1177.786) (-1180.141) [-1177.353] (-1178.326) * [-1180.330] (-1181.853) (-1180.687) (-1180.064) -- 0:00:26 642500 -- (-1177.349) (-1179.152) (-1177.350) [-1181.133] * [-1180.249] (-1182.436) (-1179.344) (-1183.815) -- 0:00:26 643000 -- (-1179.274) (-1178.319) [-1177.690] (-1179.825) * (-1179.167) (-1180.037) [-1178.956] (-1181.837) -- 0:00:26 643500 -- (-1179.830) [-1178.503] (-1177.204) (-1179.836) * (-1179.534) (-1179.870) (-1177.620) [-1178.919] -- 0:00:26 644000 -- [-1178.293] (-1180.564) (-1182.282) (-1182.531) * (-1180.767) (-1180.778) [-1180.215] (-1179.457) -- 0:00:25 644500 -- (-1180.535) [-1182.049] (-1187.053) (-1181.841) * (-1184.505) [-1178.733] (-1178.426) (-1178.592) -- 0:00:25 645000 -- [-1178.404] (-1178.868) (-1180.845) (-1178.561) * [-1177.676] (-1178.632) (-1180.158) (-1178.279) -- 0:00:25 Average standard deviation of split frequencies: 0.008928 645500 -- [-1179.248] (-1179.732) (-1180.897) (-1178.257) * [-1180.897] (-1179.669) (-1178.129) (-1181.063) -- 0:00:25 646000 -- (-1179.268) (-1180.464) [-1179.688] (-1178.597) * (-1180.455) [-1179.069] (-1179.195) (-1180.789) -- 0:00:25 646500 -- (-1178.275) (-1180.046) (-1178.984) [-1177.876] * [-1179.046] (-1181.038) (-1178.686) (-1178.985) -- 0:00:25 647000 -- [-1181.429] (-1178.581) (-1178.258) (-1180.598) * [-1181.869] (-1178.885) (-1179.822) (-1178.831) -- 0:00:25 647500 -- (-1181.131) [-1178.269] (-1177.708) (-1181.055) * (-1182.964) [-1178.761] (-1182.395) (-1178.679) -- 0:00:26 648000 -- [-1178.127] (-1178.577) (-1177.912) (-1177.314) * (-1179.750) (-1180.179) [-1179.028] (-1178.711) -- 0:00:26 648500 -- (-1183.024) [-1179.476] (-1178.069) (-1178.685) * [-1178.398] (-1182.590) (-1179.429) (-1179.493) -- 0:00:26 649000 -- (-1178.470) (-1181.193) (-1178.809) [-1178.330] * (-1177.724) (-1179.256) (-1180.215) [-1181.047] -- 0:00:25 649500 -- (-1180.906) [-1178.235] (-1181.329) (-1177.354) * [-1180.671] (-1179.290) (-1183.153) (-1181.389) -- 0:00:25 650000 -- (-1184.897) (-1180.219) [-1179.678] (-1179.197) * (-1179.284) (-1177.442) (-1181.728) [-1182.226] -- 0:00:25 Average standard deviation of split frequencies: 0.009037 650500 -- (-1179.823) [-1177.588] (-1178.778) (-1180.407) * (-1178.444) (-1179.438) (-1179.317) [-1179.887] -- 0:00:25 651000 -- (-1181.430) (-1178.349) [-1179.139] (-1180.697) * (-1179.739) (-1179.144) (-1178.217) [-1181.868] -- 0:00:25 651500 -- [-1180.867] (-1178.490) (-1180.187) (-1178.841) * (-1178.606) (-1179.118) (-1177.588) [-1177.982] -- 0:00:25 652000 -- (-1180.078) (-1180.051) [-1178.668] (-1178.849) * [-1180.567] (-1183.438) (-1177.478) (-1178.746) -- 0:00:25 652500 -- (-1180.123) [-1178.792] (-1178.622) (-1185.134) * [-1180.332] (-1179.713) (-1178.814) (-1179.036) -- 0:00:25 653000 -- [-1178.040] (-1180.223) (-1178.823) (-1178.079) * (-1179.711) (-1180.003) (-1184.997) [-1181.371] -- 0:00:25 653500 -- (-1179.916) (-1180.264) [-1177.784] (-1178.655) * [-1177.906] (-1178.678) (-1185.144) (-1178.813) -- 0:00:25 654000 -- (-1177.939) (-1178.570) (-1179.149) [-1178.119] * (-1179.637) (-1177.946) [-1178.687] (-1179.066) -- 0:00:25 654500 -- (-1177.896) (-1184.875) (-1178.425) [-1177.873] * (-1178.400) (-1181.306) [-1178.954] (-1179.998) -- 0:00:25 655000 -- (-1181.749) [-1179.924] (-1180.644) (-1180.234) * [-1178.420] (-1179.624) (-1180.227) (-1178.930) -- 0:00:25 Average standard deviation of split frequencies: 0.008503 655500 -- (-1182.268) [-1179.219] (-1183.194) (-1178.423) * (-1178.190) (-1180.208) (-1179.179) [-1179.574] -- 0:00:25 656000 -- (-1179.634) (-1180.153) [-1179.667] (-1178.814) * [-1177.775] (-1179.654) (-1183.628) (-1179.267) -- 0:00:25 656500 -- [-1178.987] (-1179.464) (-1179.358) (-1180.758) * (-1182.350) (-1178.879) (-1180.233) [-1180.076] -- 0:00:25 657000 -- (-1181.747) [-1178.181] (-1179.571) (-1180.883) * (-1179.619) [-1178.413] (-1183.545) (-1181.166) -- 0:00:25 657500 -- (-1181.694) [-1178.439] (-1182.330) (-1183.186) * (-1178.164) [-1181.213] (-1179.366) (-1182.449) -- 0:00:25 658000 -- (-1177.702) (-1178.280) [-1183.050] (-1180.553) * (-1178.171) (-1179.443) [-1180.504] (-1178.454) -- 0:00:24 658500 -- (-1178.292) (-1177.994) (-1178.047) [-1184.999] * (-1177.899) (-1179.873) [-1179.173] (-1180.818) -- 0:00:24 659000 -- (-1179.344) (-1179.834) (-1178.696) [-1183.007] * (-1177.989) (-1184.018) [-1179.056] (-1179.454) -- 0:00:24 659500 -- [-1179.495] (-1180.049) (-1179.531) (-1185.191) * [-1178.747] (-1181.989) (-1178.804) (-1178.469) -- 0:00:24 660000 -- (-1178.953) (-1177.697) [-1178.080] (-1178.876) * (-1178.007) (-1179.001) (-1179.415) [-1183.311] -- 0:00:24 Average standard deviation of split frequencies: 0.008269 660500 -- [-1177.888] (-1180.225) (-1177.870) (-1180.042) * [-1177.979] (-1178.609) (-1180.309) (-1180.782) -- 0:00:24 661000 -- [-1177.616] (-1178.896) (-1183.136) (-1177.046) * (-1180.821) (-1184.072) [-1180.762] (-1179.800) -- 0:00:24 661500 -- (-1179.430) [-1178.500] (-1182.123) (-1180.031) * [-1179.646] (-1180.740) (-1181.360) (-1179.898) -- 0:00:24 662000 -- (-1181.650) (-1179.462) (-1181.278) [-1180.217] * [-1180.687] (-1178.247) (-1177.853) (-1181.141) -- 0:00:24 662500 -- [-1179.019] (-1183.598) (-1182.812) (-1178.603) * (-1178.349) (-1180.316) (-1177.951) [-1180.562] -- 0:00:24 663000 -- [-1177.648] (-1181.552) (-1183.753) (-1178.271) * [-1180.159] (-1179.232) (-1177.729) (-1179.698) -- 0:00:24 663500 -- (-1182.758) (-1179.847) [-1178.487] (-1178.403) * (-1177.534) (-1180.006) (-1181.247) [-1181.123] -- 0:00:24 664000 -- (-1178.656) (-1180.308) [-1179.576] (-1178.461) * [-1178.254] (-1179.199) (-1181.335) (-1182.720) -- 0:00:24 664500 -- (-1181.715) (-1180.773) (-1179.786) [-1181.438] * (-1177.924) [-1178.756] (-1179.064) (-1179.087) -- 0:00:24 665000 -- (-1180.067) [-1179.013] (-1179.586) (-1178.732) * (-1177.680) [-1179.399] (-1177.880) (-1181.013) -- 0:00:24 Average standard deviation of split frequencies: 0.007120 665500 -- (-1185.252) (-1179.187) [-1181.695] (-1181.120) * (-1177.680) (-1180.240) (-1178.252) [-1181.192] -- 0:00:24 666000 -- (-1182.515) (-1180.524) (-1180.564) [-1180.898] * (-1179.235) (-1181.107) [-1178.490] (-1178.684) -- 0:00:24 666500 -- (-1181.183) (-1180.524) [-1180.487] (-1180.591) * (-1180.982) (-1180.644) [-1177.764] (-1178.466) -- 0:00:24 667000 -- (-1179.062) (-1181.754) [-1180.399] (-1180.593) * [-1179.259] (-1182.363) (-1179.396) (-1179.060) -- 0:00:24 667500 -- (-1182.583) [-1180.784] (-1179.917) (-1178.537) * (-1183.315) (-1183.570) (-1181.672) [-1179.121] -- 0:00:24 668000 -- (-1181.255) (-1181.121) (-1182.720) [-1178.183] * (-1181.459) (-1180.718) (-1183.975) [-1178.247] -- 0:00:24 668500 -- (-1181.370) (-1181.486) (-1177.808) [-1177.883] * (-1180.845) (-1179.568) (-1179.636) [-1177.897] -- 0:00:24 669000 -- (-1177.952) (-1178.442) (-1182.176) [-1178.157] * [-1179.469] (-1180.045) (-1178.955) (-1180.983) -- 0:00:24 669500 -- [-1178.108] (-1179.823) (-1182.546) (-1177.427) * (-1179.482) (-1182.031) (-1179.264) [-1178.291] -- 0:00:24 670000 -- (-1178.962) (-1180.532) (-1177.781) [-1178.372] * (-1182.630) [-1178.227] (-1179.106) (-1179.712) -- 0:00:24 Average standard deviation of split frequencies: 0.007649 670500 -- (-1178.347) (-1182.774) [-1178.823] (-1181.240) * [-1181.545] (-1181.417) (-1184.630) (-1178.974) -- 0:00:24 671000 -- (-1179.388) (-1181.036) [-1180.213] (-1180.153) * [-1178.883] (-1179.311) (-1179.270) (-1177.851) -- 0:00:24 671500 -- (-1177.994) [-1181.320] (-1181.496) (-1179.110) * (-1181.922) [-1180.012] (-1178.675) (-1181.167) -- 0:00:23 672000 -- (-1181.179) [-1179.552] (-1184.395) (-1178.053) * (-1181.215) (-1186.627) [-1177.747] (-1178.372) -- 0:00:23 672500 -- (-1185.070) (-1181.125) (-1181.993) [-1181.316] * (-1178.735) (-1178.533) [-1177.564] (-1178.328) -- 0:00:23 673000 -- (-1181.581) [-1181.849] (-1177.268) (-1179.322) * (-1177.827) [-1180.035] (-1183.206) (-1178.079) -- 0:00:23 673500 -- (-1182.379) [-1180.690] (-1177.827) (-1178.897) * (-1184.162) (-1180.128) [-1181.248] (-1178.634) -- 0:00:23 674000 -- [-1179.883] (-1178.029) (-1178.348) (-1177.705) * (-1182.613) (-1180.451) [-1178.744] (-1178.935) -- 0:00:23 674500 -- (-1182.167) (-1177.687) (-1181.366) [-1178.059] * (-1179.657) [-1178.386] (-1178.171) (-1181.993) -- 0:00:23 675000 -- (-1181.920) [-1177.657] (-1177.560) (-1177.664) * (-1178.001) (-1181.193) [-1180.130] (-1178.641) -- 0:00:23 Average standard deviation of split frequencies: 0.007630 675500 -- (-1180.076) [-1180.828] (-1178.234) (-1177.901) * [-1178.440] (-1180.883) (-1181.494) (-1178.742) -- 0:00:23 676000 -- (-1179.350) (-1179.223) [-1179.062] (-1178.712) * (-1178.453) (-1183.473) (-1179.009) [-1178.519] -- 0:00:23 676500 -- [-1178.631] (-1182.210) (-1181.664) (-1179.427) * (-1178.687) (-1182.870) [-1177.846] (-1178.765) -- 0:00:23 677000 -- (-1180.337) (-1180.628) [-1179.044] (-1179.229) * [-1177.996] (-1179.424) (-1182.036) (-1178.304) -- 0:00:23 677500 -- (-1182.473) [-1177.962] (-1178.410) (-1178.126) * [-1179.562] (-1180.300) (-1178.578) (-1178.133) -- 0:00:23 678000 -- (-1183.487) [-1178.770] (-1177.376) (-1178.204) * (-1179.728) (-1181.523) [-1181.255] (-1180.370) -- 0:00:23 678500 -- [-1179.684] (-1180.985) (-1178.967) (-1179.363) * (-1178.800) (-1179.619) (-1178.491) [-1178.465] -- 0:00:23 679000 -- [-1177.655] (-1180.145) (-1179.228) (-1179.872) * (-1179.498) [-1179.254] (-1181.187) (-1178.998) -- 0:00:23 679500 -- [-1179.594] (-1179.678) (-1178.203) (-1183.432) * (-1177.851) [-1178.367] (-1183.315) (-1178.989) -- 0:00:23 680000 -- (-1178.977) (-1179.082) [-1179.419] (-1182.734) * [-1178.236] (-1179.432) (-1181.699) (-1177.212) -- 0:00:23 Average standard deviation of split frequencies: 0.007333 680500 -- (-1179.014) (-1178.667) [-1178.302] (-1177.434) * (-1178.204) (-1178.520) [-1177.541] (-1179.116) -- 0:00:23 681000 -- [-1178.498] (-1177.734) (-1178.771) (-1177.112) * [-1178.597] (-1178.479) (-1179.307) (-1180.567) -- 0:00:23 681500 -- (-1178.236) [-1181.850] (-1183.337) (-1177.570) * (-1178.327) [-1180.448] (-1182.994) (-1180.701) -- 0:00:23 682000 -- (-1179.375) (-1181.700) (-1182.841) [-1178.084] * (-1179.891) (-1179.956) [-1181.409] (-1177.912) -- 0:00:23 682500 -- [-1179.457] (-1179.680) (-1181.971) (-1178.583) * (-1180.522) (-1179.994) (-1183.271) [-1179.797] -- 0:00:23 683000 -- (-1178.489) [-1178.241] (-1186.710) (-1177.501) * (-1179.736) (-1178.073) [-1179.436] (-1178.921) -- 0:00:23 683500 -- [-1177.377] (-1181.794) (-1181.431) (-1177.481) * (-1178.642) [-1177.402] (-1179.711) (-1178.365) -- 0:00:23 684000 -- (-1179.220) (-1179.805) [-1180.011] (-1178.579) * (-1181.276) (-1177.443) [-1178.741] (-1178.204) -- 0:00:23 684500 -- (-1179.592) [-1183.515] (-1181.142) (-1178.970) * (-1182.070) (-1179.687) [-1177.621] (-1179.920) -- 0:00:23 685000 -- [-1180.325] (-1178.707) (-1177.502) (-1178.338) * (-1180.705) (-1179.459) [-1179.039] (-1178.877) -- 0:00:22 Average standard deviation of split frequencies: 0.007519 685500 -- (-1180.137) [-1178.822] (-1179.137) (-1186.318) * (-1181.571) (-1180.827) (-1179.367) [-1181.925] -- 0:00:22 686000 -- (-1177.876) [-1177.514] (-1181.477) (-1182.360) * (-1181.177) [-1179.038] (-1178.951) (-1180.709) -- 0:00:22 686500 -- [-1180.033] (-1177.942) (-1178.650) (-1180.563) * (-1179.406) (-1178.628) [-1178.596] (-1178.083) -- 0:00:22 687000 -- (-1178.705) [-1178.720] (-1183.404) (-1179.521) * [-1178.330] (-1177.961) (-1177.338) (-1178.934) -- 0:00:22 687500 -- [-1178.332] (-1179.087) (-1178.940) (-1179.298) * [-1180.512] (-1181.504) (-1177.346) (-1178.511) -- 0:00:22 688000 -- (-1180.924) [-1178.867] (-1178.601) (-1179.146) * (-1178.243) (-1178.497) [-1178.515] (-1178.803) -- 0:00:22 688500 -- (-1181.359) (-1180.591) (-1178.124) [-1177.563] * [-1177.717] (-1177.104) (-1177.079) (-1178.384) -- 0:00:22 689000 -- (-1179.017) (-1179.801) (-1181.144) [-1179.060] * (-1179.724) [-1178.770] (-1183.726) (-1177.736) -- 0:00:22 689500 -- (-1178.931) (-1177.565) [-1178.304] (-1177.725) * (-1185.651) (-1182.034) [-1177.624] (-1178.681) -- 0:00:22 690000 -- (-1177.945) [-1179.506] (-1182.867) (-1177.763) * [-1181.812] (-1184.204) (-1178.919) (-1182.385) -- 0:00:22 Average standard deviation of split frequencies: 0.007668 690500 -- (-1180.725) [-1177.913] (-1179.761) (-1180.240) * (-1177.954) (-1179.858) [-1178.878] (-1182.803) -- 0:00:22 691000 -- (-1180.452) (-1179.283) [-1178.643] (-1180.448) * [-1182.250] (-1181.797) (-1178.264) (-1180.457) -- 0:00:22 691500 -- (-1178.595) (-1182.039) [-1179.384] (-1178.136) * [-1180.103] (-1187.771) (-1178.065) (-1179.554) -- 0:00:22 692000 -- (-1179.698) [-1181.732] (-1179.204) (-1180.466) * (-1180.307) [-1183.571] (-1181.338) (-1177.923) -- 0:00:22 692500 -- (-1180.416) [-1181.169] (-1179.071) (-1179.078) * (-1179.108) [-1179.828] (-1179.878) (-1178.027) -- 0:00:22 693000 -- [-1180.175] (-1179.969) (-1182.630) (-1177.846) * (-1179.779) [-1178.125] (-1179.136) (-1179.022) -- 0:00:22 693500 -- (-1179.679) (-1180.203) (-1182.480) [-1178.967] * (-1178.311) [-1181.609] (-1178.894) (-1183.827) -- 0:00:22 694000 -- (-1181.608) (-1178.893) [-1177.864] (-1183.044) * (-1181.688) [-1182.893] (-1182.240) (-1179.661) -- 0:00:22 694500 -- (-1178.324) (-1183.554) [-1178.230] (-1178.885) * [-1180.292] (-1184.180) (-1186.043) (-1179.223) -- 0:00:22 695000 -- (-1178.347) (-1180.461) [-1179.487] (-1180.276) * (-1179.808) [-1178.369] (-1184.020) (-1180.037) -- 0:00:22 Average standard deviation of split frequencies: 0.007809 695500 -- (-1178.603) (-1184.078) (-1179.853) [-1179.676] * (-1177.384) (-1179.130) [-1181.252] (-1179.822) -- 0:00:22 696000 -- (-1179.142) (-1178.680) [-1177.197] (-1180.908) * (-1179.668) (-1179.489) (-1177.577) [-1181.282] -- 0:00:22 696500 -- [-1178.445] (-1178.280) (-1182.042) (-1179.652) * (-1178.917) (-1179.073) [-1180.660] (-1180.653) -- 0:00:22 697000 -- (-1179.596) (-1177.423) (-1180.240) [-1177.844] * (-1177.729) [-1178.885] (-1178.222) (-1177.739) -- 0:00:22 697500 -- (-1179.241) (-1177.734) (-1179.581) [-1178.939] * (-1179.283) [-1179.852] (-1178.566) (-1182.541) -- 0:00:22 698000 -- [-1179.640] (-1179.776) (-1180.063) (-1178.416) * [-1178.975] (-1183.702) (-1178.330) (-1180.477) -- 0:00:22 698500 -- (-1177.510) (-1179.526) (-1179.574) [-1178.514] * [-1179.206] (-1178.219) (-1179.127) (-1177.625) -- 0:00:22 699000 -- [-1177.497] (-1180.204) (-1180.926) (-1177.342) * [-1179.230] (-1180.267) (-1178.261) (-1178.086) -- 0:00:21 699500 -- (-1178.846) (-1181.265) (-1178.138) [-1180.196] * (-1178.246) (-1180.271) (-1178.505) [-1177.021] -- 0:00:21 700000 -- [-1181.588] (-1184.527) (-1179.245) (-1181.461) * (-1178.397) (-1179.676) [-1179.422] (-1179.523) -- 0:00:21 Average standard deviation of split frequencies: 0.007559 700500 -- [-1178.761] (-1180.133) (-1177.601) (-1178.672) * (-1177.541) [-1178.539] (-1180.095) (-1179.067) -- 0:00:21 701000 -- [-1177.258] (-1179.624) (-1179.595) (-1179.627) * (-1178.748) [-1179.679] (-1180.616) (-1178.543) -- 0:00:21 701500 -- (-1180.088) (-1181.568) (-1178.556) [-1177.251] * (-1180.378) (-1179.263) (-1179.030) [-1178.011] -- 0:00:21 702000 -- (-1184.993) [-1181.058] (-1180.699) (-1180.200) * (-1180.676) [-1182.367] (-1179.469) (-1183.477) -- 0:00:21 702500 -- [-1178.678] (-1177.689) (-1179.626) (-1179.525) * (-1181.106) [-1184.129] (-1180.837) (-1180.751) -- 0:00:21 703000 -- (-1178.106) [-1177.520] (-1180.233) (-1183.165) * (-1181.195) [-1182.807] (-1177.898) (-1177.820) -- 0:00:21 703500 -- [-1179.028] (-1179.675) (-1180.225) (-1180.597) * (-1178.547) (-1183.044) (-1178.475) [-1180.675] -- 0:00:21 704000 -- (-1180.104) (-1180.043) (-1177.849) [-1179.173] * (-1178.459) (-1179.957) [-1179.470] (-1178.802) -- 0:00:21 704500 -- (-1178.109) (-1178.934) (-1181.866) [-1178.648] * [-1179.231] (-1180.033) (-1179.430) (-1178.555) -- 0:00:21 705000 -- (-1178.664) (-1181.958) [-1181.441] (-1180.615) * (-1177.109) (-1181.699) (-1178.519) [-1179.820] -- 0:00:21 Average standard deviation of split frequencies: 0.007188 705500 -- (-1178.618) [-1177.067] (-1179.805) (-1177.556) * (-1177.981) (-1180.571) [-1177.847] (-1178.881) -- 0:00:21 706000 -- (-1179.045) [-1178.796] (-1178.633) (-1180.171) * (-1178.597) (-1178.989) [-1177.989] (-1177.758) -- 0:00:21 706500 -- (-1177.493) (-1178.000) (-1184.127) [-1179.344] * [-1179.388] (-1179.093) (-1177.978) (-1179.481) -- 0:00:21 707000 -- (-1177.114) [-1178.947] (-1180.748) (-1178.311) * [-1179.278] (-1180.795) (-1178.494) (-1179.172) -- 0:00:21 707500 -- (-1179.876) (-1178.371) (-1180.493) [-1178.402] * (-1179.382) [-1181.717] (-1180.374) (-1179.442) -- 0:00:21 708000 -- [-1181.072] (-1179.352) (-1180.611) (-1184.202) * (-1179.683) [-1179.501] (-1180.556) (-1182.812) -- 0:00:21 708500 -- (-1178.987) [-1178.467] (-1179.753) (-1179.243) * (-1183.072) (-1177.559) [-1181.437] (-1180.584) -- 0:00:21 709000 -- (-1182.484) (-1177.835) (-1178.692) [-1178.862] * (-1179.943) (-1180.458) [-1178.632] (-1179.436) -- 0:00:21 709500 -- (-1180.319) (-1177.799) [-1179.792] (-1178.562) * (-1179.988) (-1178.586) (-1179.636) [-1178.673] -- 0:00:21 710000 -- (-1177.347) [-1179.323] (-1180.272) (-1182.186) * (-1181.452) [-1180.933] (-1179.918) (-1178.807) -- 0:00:21 Average standard deviation of split frequencies: 0.007375 710500 -- [-1179.927] (-1177.954) (-1179.886) (-1180.969) * (-1180.761) (-1188.270) [-1179.806] (-1181.967) -- 0:00:21 711000 -- (-1179.079) (-1179.578) [-1178.184] (-1177.776) * (-1179.579) (-1178.244) [-1178.940] (-1178.374) -- 0:00:21 711500 -- (-1180.187) [-1180.133] (-1181.244) (-1178.185) * (-1183.559) [-1178.237] (-1178.056) (-1180.806) -- 0:00:21 712000 -- (-1179.324) [-1177.164] (-1179.862) (-1178.137) * (-1179.835) (-1178.892) (-1178.158) [-1179.680] -- 0:00:21 712500 -- (-1181.580) (-1177.700) (-1180.225) [-1181.407] * [-1180.718] (-1180.376) (-1179.728) (-1181.307) -- 0:00:20 713000 -- (-1179.453) (-1177.391) (-1183.326) [-1185.500] * [-1179.374] (-1179.314) (-1184.502) (-1184.349) -- 0:00:20 713500 -- [-1179.437] (-1181.982) (-1178.421) (-1179.831) * (-1179.975) (-1180.941) [-1182.045] (-1186.471) -- 0:00:20 714000 -- (-1179.885) (-1180.406) [-1178.486] (-1184.618) * [-1181.342] (-1179.722) (-1179.077) (-1180.901) -- 0:00:20 714500 -- (-1178.733) [-1177.870] (-1182.333) (-1181.020) * (-1178.789) (-1180.997) (-1181.067) [-1179.603] -- 0:00:20 715000 -- (-1181.314) [-1178.697] (-1183.597) (-1180.536) * (-1182.394) (-1178.865) [-1180.221] (-1183.715) -- 0:00:20 Average standard deviation of split frequencies: 0.007939 715500 -- [-1182.200] (-1183.946) (-1177.436) (-1181.597) * (-1180.354) (-1178.979) [-1179.277] (-1177.801) -- 0:00:20 716000 -- [-1180.204] (-1182.080) (-1179.641) (-1182.293) * [-1178.084] (-1179.025) (-1179.627) (-1177.710) -- 0:00:20 716500 -- (-1180.141) (-1181.342) [-1179.942] (-1183.233) * (-1182.261) (-1179.608) (-1183.667) [-1178.458] -- 0:00:20 717000 -- (-1179.164) (-1180.998) [-1179.298] (-1182.372) * (-1177.111) (-1179.110) [-1179.771] (-1177.660) -- 0:00:20 717500 -- (-1179.486) [-1181.244] (-1178.382) (-1179.447) * [-1179.630] (-1184.881) (-1182.393) (-1178.276) -- 0:00:20 718000 -- (-1180.754) [-1182.855] (-1178.617) (-1179.646) * (-1179.263) (-1179.420) [-1179.515] (-1179.300) -- 0:00:20 718500 -- (-1179.779) (-1179.041) (-1177.800) [-1177.722] * [-1177.354] (-1178.787) (-1177.257) (-1181.153) -- 0:00:20 719000 -- (-1182.002) [-1179.384] (-1180.430) (-1178.976) * (-1177.036) (-1178.815) [-1177.397] (-1180.004) -- 0:00:20 719500 -- (-1179.958) (-1178.656) [-1182.982] (-1178.549) * (-1178.251) [-1178.442] (-1177.684) (-1180.071) -- 0:00:20 720000 -- (-1180.701) [-1181.109] (-1178.046) (-1177.915) * (-1179.564) (-1179.471) [-1179.640] (-1179.499) -- 0:00:20 Average standard deviation of split frequencies: 0.008003 720500 -- (-1181.660) [-1179.057] (-1178.189) (-1181.225) * [-1178.356] (-1180.116) (-1178.430) (-1180.309) -- 0:00:20 721000 -- (-1179.548) (-1179.765) [-1178.023] (-1183.508) * (-1180.565) (-1178.658) [-1178.259] (-1178.642) -- 0:00:20 721500 -- (-1186.379) (-1178.535) [-1178.957] (-1180.257) * (-1181.021) (-1179.073) (-1178.562) [-1179.898] -- 0:00:20 722000 -- (-1177.632) (-1181.539) [-1179.380] (-1180.903) * [-1179.099] (-1179.815) (-1181.057) (-1183.899) -- 0:00:20 722500 -- [-1177.592] (-1180.966) (-1177.362) (-1182.049) * (-1178.183) [-1179.767] (-1177.949) (-1187.456) -- 0:00:20 723000 -- [-1177.244] (-1178.888) (-1178.044) (-1181.037) * (-1177.935) (-1182.663) [-1179.037] (-1182.450) -- 0:00:20 723500 -- (-1179.389) (-1179.924) (-1177.282) [-1183.653] * (-1177.849) (-1179.456) [-1179.037] (-1181.329) -- 0:00:20 724000 -- (-1181.124) (-1182.013) (-1179.164) [-1178.824] * [-1178.026] (-1178.740) (-1180.004) (-1182.252) -- 0:00:20 724500 -- (-1182.407) (-1178.100) (-1180.885) [-1183.618] * (-1179.680) (-1181.806) [-1178.069] (-1180.357) -- 0:00:20 725000 -- (-1179.132) [-1179.005] (-1178.373) (-1183.140) * (-1179.981) [-1181.111] (-1178.375) (-1181.119) -- 0:00:20 Average standard deviation of split frequencies: 0.007830 725500 -- [-1179.560] (-1180.236) (-1179.363) (-1178.935) * [-1183.277] (-1177.624) (-1179.252) (-1180.437) -- 0:00:20 726000 -- [-1178.453] (-1178.183) (-1180.453) (-1179.488) * (-1184.807) (-1178.113) [-1179.397] (-1180.959) -- 0:00:20 726500 -- (-1180.464) (-1180.412) [-1177.303] (-1179.693) * (-1179.119) [-1177.693] (-1178.879) (-1180.856) -- 0:00:19 727000 -- (-1181.022) [-1181.080] (-1177.421) (-1181.845) * (-1179.639) (-1178.485) (-1178.884) [-1184.484] -- 0:00:19 727500 -- (-1181.151) (-1177.588) [-1179.033] (-1178.619) * (-1184.014) [-1179.168] (-1180.667) (-1180.515) -- 0:00:19 728000 -- (-1182.134) (-1177.557) (-1178.157) [-1179.553] * (-1178.691) [-1178.522] (-1181.841) (-1178.982) -- 0:00:19 728500 -- (-1181.507) (-1181.459) (-1183.300) [-1179.785] * (-1178.562) (-1178.716) (-1178.730) [-1178.776] -- 0:00:19 729000 -- (-1180.881) (-1179.463) [-1179.318] (-1181.919) * (-1178.409) [-1180.015] (-1178.763) (-1182.026) -- 0:00:19 729500 -- (-1177.913) (-1181.419) [-1177.230] (-1182.790) * [-1179.154] (-1181.000) (-1182.944) (-1178.664) -- 0:00:19 730000 -- (-1177.808) (-1179.391) [-1182.339] (-1178.149) * (-1178.088) (-1179.890) (-1177.986) [-1177.909] -- 0:00:19 Average standard deviation of split frequencies: 0.007287 730500 -- (-1180.378) (-1183.976) [-1178.285] (-1179.530) * (-1178.177) (-1181.047) [-1179.618] (-1179.319) -- 0:00:19 731000 -- (-1178.194) [-1179.572] (-1179.385) (-1179.305) * (-1178.506) (-1178.957) (-1179.483) [-1177.732] -- 0:00:19 731500 -- (-1181.504) (-1178.124) [-1179.240] (-1182.491) * [-1179.200] (-1180.407) (-1180.735) (-1183.012) -- 0:00:19 732000 -- (-1178.166) (-1181.061) [-1179.420] (-1177.577) * [-1181.333] (-1181.524) (-1181.871) (-1178.397) -- 0:00:19 732500 -- (-1180.498) (-1178.346) [-1179.685] (-1177.912) * (-1180.465) [-1178.323] (-1178.246) (-1181.076) -- 0:00:19 733000 -- (-1179.888) (-1178.347) [-1180.150] (-1179.714) * [-1182.623] (-1180.187) (-1179.731) (-1177.885) -- 0:00:19 733500 -- (-1179.560) [-1178.697] (-1185.621) (-1178.754) * (-1178.639) (-1178.162) [-1179.284] (-1178.240) -- 0:00:19 734000 -- (-1181.099) [-1178.967] (-1182.252) (-1180.319) * [-1183.962] (-1181.127) (-1179.816) (-1177.545) -- 0:00:19 734500 -- (-1178.090) [-1179.088] (-1180.442) (-1178.127) * (-1185.083) [-1178.912] (-1179.026) (-1178.965) -- 0:00:19 735000 -- (-1182.376) [-1180.871] (-1177.478) (-1178.968) * (-1181.146) [-1179.860] (-1183.815) (-1179.768) -- 0:00:19 Average standard deviation of split frequencies: 0.007347 735500 -- (-1183.613) (-1179.807) [-1185.436] (-1179.833) * (-1178.135) [-1180.626] (-1178.913) (-1178.025) -- 0:00:19 736000 -- (-1182.846) (-1180.270) [-1179.495] (-1179.732) * (-1178.159) [-1178.838] (-1179.889) (-1178.558) -- 0:00:19 736500 -- (-1178.780) (-1181.225) (-1180.049) [-1180.691] * (-1180.125) (-1178.797) [-1186.102] (-1184.419) -- 0:00:19 737000 -- [-1177.688] (-1180.806) (-1181.927) (-1179.446) * [-1179.352] (-1180.016) (-1186.076) (-1178.128) -- 0:00:19 737500 -- [-1181.475] (-1180.006) (-1182.324) (-1177.167) * (-1180.105) (-1181.376) (-1181.850) [-1179.583] -- 0:00:19 738000 -- [-1182.204] (-1182.792) (-1182.420) (-1181.300) * [-1179.009] (-1184.727) (-1179.685) (-1179.972) -- 0:00:19 738500 -- (-1181.567) (-1180.663) [-1183.560] (-1178.447) * (-1180.267) [-1179.218] (-1180.583) (-1179.981) -- 0:00:19 739000 -- [-1179.381] (-1181.818) (-1181.165) (-1178.283) * (-1181.163) (-1179.224) [-1179.001] (-1178.681) -- 0:00:19 739500 -- (-1180.523) [-1179.388] (-1182.402) (-1178.018) * (-1179.748) [-1180.027] (-1179.185) (-1179.129) -- 0:00:19 740000 -- (-1178.754) [-1178.536] (-1182.660) (-1177.702) * (-1182.768) (-1177.807) (-1177.808) [-1179.513] -- 0:00:18 Average standard deviation of split frequencies: 0.007600 740500 -- (-1180.823) (-1179.403) [-1178.651] (-1182.643) * [-1179.100] (-1179.294) (-1178.232) (-1179.145) -- 0:00:18 741000 -- [-1180.431] (-1177.938) (-1180.297) (-1178.687) * (-1180.530) [-1180.811] (-1178.035) (-1178.941) -- 0:00:18 741500 -- (-1180.791) [-1177.813] (-1181.484) (-1177.705) * (-1177.697) (-1179.159) (-1177.982) [-1178.392] -- 0:00:18 742000 -- (-1183.679) (-1179.061) [-1179.287] (-1180.007) * (-1178.819) (-1179.121) (-1179.644) [-1180.634] -- 0:00:18 742500 -- [-1178.922] (-1177.467) (-1178.991) (-1178.229) * (-1180.511) [-1179.269] (-1180.338) (-1179.050) -- 0:00:18 743000 -- (-1178.177) (-1179.473) (-1186.298) [-1177.223] * (-1179.550) (-1179.365) (-1180.943) [-1179.502] -- 0:00:18 743500 -- (-1180.799) (-1179.029) [-1179.586] (-1180.110) * [-1181.025] (-1182.541) (-1177.797) (-1179.132) -- 0:00:18 744000 -- (-1181.374) (-1177.885) [-1177.846] (-1180.886) * [-1178.102] (-1185.486) (-1184.009) (-1179.052) -- 0:00:18 744500 -- (-1179.918) (-1177.467) [-1178.447] (-1177.777) * [-1178.843] (-1185.078) (-1179.284) (-1178.253) -- 0:00:18 745000 -- (-1177.880) [-1177.924] (-1179.645) (-1178.890) * [-1180.386] (-1181.455) (-1181.293) (-1177.585) -- 0:00:18 Average standard deviation of split frequencies: 0.007657 745500 -- [-1177.754] (-1177.240) (-1180.544) (-1180.782) * (-1177.870) [-1181.368] (-1179.914) (-1177.808) -- 0:00:18 746000 -- (-1178.570) (-1182.882) (-1179.651) [-1178.285] * [-1177.990] (-1177.985) (-1180.302) (-1180.200) -- 0:00:18 746500 -- (-1179.189) (-1180.692) [-1178.932] (-1180.632) * (-1179.070) (-1181.792) (-1179.169) [-1178.413] -- 0:00:18 747000 -- [-1180.328] (-1179.993) (-1179.358) (-1179.985) * (-1178.026) (-1181.399) [-1177.988] (-1177.316) -- 0:00:18 747500 -- [-1179.545] (-1178.699) (-1179.851) (-1180.935) * (-1179.571) [-1178.495] (-1182.164) (-1179.972) -- 0:00:18 748000 -- [-1179.153] (-1178.259) (-1189.788) (-1179.131) * [-1177.514] (-1180.098) (-1179.392) (-1181.363) -- 0:00:18 748500 -- (-1179.405) [-1180.330] (-1178.933) (-1179.292) * (-1179.231) (-1179.428) (-1186.419) [-1179.874] -- 0:00:18 749000 -- [-1178.116] (-1181.696) (-1180.793) (-1180.055) * (-1179.002) (-1179.331) [-1179.830] (-1182.736) -- 0:00:18 749500 -- (-1180.072) [-1178.189] (-1177.912) (-1178.867) * (-1178.098) [-1178.604] (-1177.769) (-1180.748) -- 0:00:18 750000 -- (-1180.991) (-1179.123) [-1180.027] (-1178.920) * [-1177.901] (-1184.902) (-1178.379) (-1182.700) -- 0:00:18 Average standard deviation of split frequencies: 0.007240 750500 -- (-1181.243) [-1178.877] (-1181.013) (-1177.875) * [-1183.467] (-1181.292) (-1178.264) (-1178.123) -- 0:00:18 751000 -- (-1180.049) (-1179.875) (-1183.744) [-1177.911] * (-1179.934) (-1181.553) (-1181.292) [-1179.759] -- 0:00:18 751500 -- (-1178.970) (-1178.491) (-1179.654) [-1178.684] * (-1179.746) (-1178.367) [-1183.079] (-1179.986) -- 0:00:18 752000 -- (-1179.468) (-1178.896) [-1178.519] (-1177.949) * (-1179.872) (-1179.320) (-1177.640) [-1178.565] -- 0:00:18 752500 -- (-1180.781) [-1178.063] (-1179.207) (-1178.581) * (-1178.742) (-1178.642) (-1181.799) [-1177.924] -- 0:00:18 753000 -- (-1180.496) (-1177.889) (-1178.911) [-1181.526] * (-1177.805) (-1180.396) [-1178.958] (-1177.483) -- 0:00:18 753500 -- (-1180.958) (-1179.541) (-1186.156) [-1179.872] * (-1178.026) [-1182.124] (-1180.725) (-1179.204) -- 0:00:17 754000 -- [-1182.281] (-1181.039) (-1178.980) (-1179.751) * [-1177.704] (-1181.843) (-1177.961) (-1178.334) -- 0:00:17 754500 -- [-1178.643] (-1179.106) (-1177.978) (-1181.127) * (-1177.734) [-1179.918] (-1178.099) (-1182.252) -- 0:00:17 755000 -- [-1179.513] (-1180.047) (-1181.751) (-1178.693) * [-1180.065] (-1180.220) (-1177.293) (-1178.531) -- 0:00:17 Average standard deviation of split frequencies: 0.007409 755500 -- (-1178.464) (-1178.237) [-1179.176] (-1178.701) * [-1180.496] (-1184.442) (-1177.095) (-1182.024) -- 0:00:17 756000 -- (-1180.438) (-1181.163) (-1177.825) [-1178.743] * (-1181.025) [-1177.180] (-1178.126) (-1182.771) -- 0:00:17 756500 -- (-1178.722) [-1178.648] (-1178.507) (-1179.317) * (-1181.558) (-1178.789) [-1180.169] (-1180.585) -- 0:00:17 757000 -- [-1179.501] (-1180.857) (-1177.348) (-1177.995) * [-1179.210] (-1179.620) (-1178.146) (-1181.341) -- 0:00:17 757500 -- (-1178.471) [-1180.010] (-1180.589) (-1177.708) * (-1178.327) (-1180.514) [-1183.240] (-1181.175) -- 0:00:17 758000 -- [-1178.089] (-1180.597) (-1178.470) (-1180.951) * [-1178.659] (-1183.455) (-1183.989) (-1183.634) -- 0:00:17 758500 -- (-1179.417) [-1183.292] (-1178.753) (-1180.327) * (-1179.862) (-1184.236) [-1177.859] (-1178.828) -- 0:00:17 759000 -- (-1183.338) (-1181.359) (-1178.194) [-1180.757] * (-1177.839) (-1178.404) (-1179.091) [-1177.268] -- 0:00:17 759500 -- (-1177.373) (-1186.750) (-1178.522) [-1178.864] * (-1178.706) (-1178.408) (-1180.934) [-1177.987] -- 0:00:17 760000 -- (-1177.356) (-1179.161) (-1182.379) [-1179.440] * (-1178.554) (-1181.484) (-1182.334) [-1181.185] -- 0:00:17 Average standard deviation of split frequencies: 0.006853 760500 -- (-1177.969) [-1178.211] (-1178.289) (-1179.563) * (-1178.843) (-1178.665) [-1180.767] (-1183.318) -- 0:00:17 761000 -- (-1179.191) (-1178.617) [-1179.317] (-1180.510) * (-1178.941) (-1180.564) (-1177.771) [-1182.824] -- 0:00:17 761500 -- (-1179.867) [-1178.556] (-1178.802) (-1182.450) * [-1178.726] (-1179.901) (-1178.557) (-1179.993) -- 0:00:17 762000 -- (-1180.946) (-1181.017) (-1178.639) [-1178.152] * [-1178.196] (-1179.095) (-1181.373) (-1180.706) -- 0:00:17 762500 -- (-1179.831) [-1182.123] (-1179.279) (-1178.780) * (-1179.183) [-1178.925] (-1182.679) (-1178.680) -- 0:00:17 763000 -- (-1179.737) (-1179.400) [-1180.212] (-1179.699) * (-1181.692) (-1178.617) [-1181.205] (-1181.479) -- 0:00:17 763500 -- [-1179.565] (-1177.805) (-1180.368) (-1181.527) * [-1179.297] (-1178.392) (-1181.259) (-1178.423) -- 0:00:17 764000 -- (-1177.465) [-1178.416] (-1183.701) (-1178.272) * (-1178.945) (-1178.392) (-1185.116) [-1177.330] -- 0:00:17 764500 -- (-1177.734) [-1178.220] (-1178.818) (-1177.205) * (-1181.743) (-1178.236) (-1181.575) [-1177.191] -- 0:00:17 765000 -- (-1179.021) [-1179.918] (-1178.284) (-1178.345) * [-1178.329] (-1179.925) (-1177.492) (-1178.034) -- 0:00:17 Average standard deviation of split frequencies: 0.006770 765500 -- [-1178.543] (-1179.604) (-1179.428) (-1179.086) * [-1179.641] (-1179.849) (-1179.437) (-1177.743) -- 0:00:17 766000 -- (-1179.424) (-1182.169) [-1178.495] (-1177.546) * (-1177.559) (-1177.980) (-1177.334) [-1178.994] -- 0:00:17 766500 -- [-1182.298] (-1179.827) (-1177.671) (-1179.979) * (-1178.228) [-1180.325] (-1177.955) (-1180.922) -- 0:00:17 767000 -- (-1179.325) (-1179.524) (-1178.473) [-1178.401] * (-1179.253) (-1178.470) (-1178.748) [-1179.037] -- 0:00:17 767500 -- (-1181.576) [-1178.450] (-1179.212) (-1183.719) * [-1177.587] (-1179.788) (-1177.066) (-1178.563) -- 0:00:16 768000 -- (-1182.569) (-1180.636) (-1179.432) [-1178.633] * [-1178.303] (-1178.059) (-1178.623) (-1182.346) -- 0:00:16 768500 -- (-1178.389) (-1183.911) [-1179.138] (-1179.102) * (-1179.307) (-1180.349) (-1178.361) [-1179.251] -- 0:00:16 769000 -- (-1179.031) (-1179.855) (-1185.461) [-1178.747] * [-1178.517] (-1178.741) (-1180.457) (-1177.845) -- 0:00:16 769500 -- [-1180.897] (-1181.191) (-1178.865) (-1183.114) * (-1177.825) [-1182.138] (-1178.159) (-1178.279) -- 0:00:16 770000 -- (-1180.945) [-1177.855] (-1177.889) (-1179.442) * (-1183.311) (-1179.380) (-1178.160) [-1179.856] -- 0:00:16 Average standard deviation of split frequencies: 0.006549 770500 -- (-1181.838) (-1179.739) [-1179.695] (-1179.993) * (-1181.458) [-1178.454] (-1181.627) (-1178.292) -- 0:00:16 771000 -- (-1180.512) [-1180.938] (-1180.190) (-1181.889) * [-1179.551] (-1182.379) (-1179.124) (-1178.555) -- 0:00:16 771500 -- (-1183.816) (-1181.907) (-1180.080) [-1179.101] * [-1179.926] (-1181.475) (-1178.538) (-1181.113) -- 0:00:16 772000 -- [-1179.018] (-1183.486) (-1182.641) (-1179.051) * (-1177.746) (-1179.862) (-1180.893) [-1177.172] -- 0:00:16 772500 -- [-1178.676] (-1186.420) (-1180.563) (-1178.651) * (-1178.067) (-1181.551) (-1180.151) [-1177.247] -- 0:00:16 773000 -- [-1181.336] (-1178.699) (-1182.196) (-1178.000) * (-1180.058) (-1180.882) (-1178.225) [-1177.396] -- 0:00:16 773500 -- [-1179.380] (-1177.288) (-1178.993) (-1178.515) * (-1181.164) [-1179.292] (-1180.469) (-1178.399) -- 0:00:16 774000 -- (-1182.090) (-1181.171) (-1177.232) [-1179.399] * (-1182.006) (-1178.602) (-1178.761) [-1178.883] -- 0:00:16 774500 -- (-1181.955) [-1179.575] (-1177.770) (-1179.597) * (-1180.080) [-1178.981] (-1178.700) (-1178.375) -- 0:00:16 775000 -- [-1182.657] (-1179.711) (-1180.141) (-1179.641) * (-1178.779) [-1178.370] (-1177.715) (-1184.585) -- 0:00:16 Average standard deviation of split frequencies: 0.006682 775500 -- [-1180.054] (-1178.483) (-1181.396) (-1181.781) * (-1180.742) (-1179.606) (-1177.789) [-1181.170] -- 0:00:16 776000 -- (-1183.283) (-1182.912) [-1179.842] (-1179.301) * [-1180.194] (-1180.395) (-1182.833) (-1180.323) -- 0:00:16 776500 -- (-1182.156) [-1177.530] (-1181.206) (-1179.911) * (-1178.528) (-1179.762) [-1178.945] (-1183.207) -- 0:00:16 777000 -- (-1178.828) (-1177.719) (-1181.012) [-1180.152] * (-1179.342) (-1182.613) [-1181.679] (-1179.818) -- 0:00:16 777500 -- (-1178.371) (-1179.133) [-1180.512] (-1178.917) * (-1179.748) (-1181.629) [-1179.812] (-1178.461) -- 0:00:16 778000 -- (-1178.067) (-1178.411) [-1179.918] (-1180.500) * (-1178.145) (-1181.330) (-1178.893) [-1178.252] -- 0:00:16 778500 -- (-1177.253) (-1180.712) (-1185.570) [-1178.033] * [-1177.240] (-1181.429) (-1182.828) (-1178.334) -- 0:00:16 779000 -- (-1183.061) (-1183.532) (-1178.983) [-1178.782] * (-1182.594) (-1181.174) (-1179.868) [-1178.960] -- 0:00:16 779500 -- (-1182.661) [-1182.259] (-1178.460) (-1178.495) * (-1181.166) (-1178.659) [-1179.234] (-1180.879) -- 0:00:16 780000 -- (-1180.017) [-1180.304] (-1179.805) (-1179.620) * [-1180.172] (-1177.690) (-1182.266) (-1181.827) -- 0:00:16 Average standard deviation of split frequencies: 0.006642 780500 -- (-1179.263) (-1180.950) [-1178.449] (-1179.190) * (-1180.201) (-1179.596) (-1178.557) [-1180.897] -- 0:00:16 781000 -- [-1178.924] (-1178.258) (-1178.350) (-1180.109) * (-1179.204) (-1178.966) (-1182.589) [-1178.846] -- 0:00:15 781500 -- (-1178.240) [-1178.936] (-1180.493) (-1182.305) * [-1180.060] (-1179.805) (-1182.034) (-1178.234) -- 0:00:15 782000 -- (-1179.412) (-1179.437) [-1179.380] (-1187.063) * (-1182.909) (-1179.817) (-1180.761) [-1178.698] -- 0:00:15 782500 -- [-1180.480] (-1181.197) (-1179.088) (-1185.557) * (-1184.792) (-1178.297) [-1178.522] (-1178.190) -- 0:00:15 783000 -- (-1180.332) (-1180.578) (-1182.023) [-1179.212] * (-1181.583) (-1178.875) (-1178.984) [-1178.711] -- 0:00:15 783500 -- (-1181.658) [-1178.372] (-1180.436) (-1186.771) * [-1179.020] (-1180.151) (-1178.348) (-1181.147) -- 0:00:15 784000 -- (-1181.175) [-1179.683] (-1179.638) (-1181.102) * (-1179.252) (-1181.709) (-1184.484) [-1180.034] -- 0:00:15 784500 -- (-1182.946) (-1178.195) (-1178.735) [-1178.258] * [-1180.527] (-1178.979) (-1179.007) (-1184.813) -- 0:00:15 785000 -- (-1178.445) (-1177.820) (-1182.270) [-1178.173] * (-1180.301) (-1179.341) (-1177.356) [-1183.881] -- 0:00:15 Average standard deviation of split frequencies: 0.006738 785500 -- (-1178.756) (-1180.609) [-1179.286] (-1178.360) * [-1182.845] (-1178.849) (-1180.152) (-1178.556) -- 0:00:15 786000 -- (-1178.980) (-1182.253) [-1178.458] (-1182.248) * (-1184.148) [-1178.157] (-1178.611) (-1179.069) -- 0:00:15 786500 -- [-1180.179] (-1181.161) (-1183.568) (-1178.694) * (-1180.353) [-1177.402] (-1180.315) (-1178.944) -- 0:00:15 787000 -- (-1178.041) [-1180.103] (-1180.120) (-1180.249) * (-1181.492) [-1181.726] (-1179.564) (-1177.470) -- 0:00:15 787500 -- (-1182.156) [-1179.387] (-1181.372) (-1180.561) * [-1181.702] (-1186.500) (-1182.392) (-1177.813) -- 0:00:15 788000 -- (-1178.868) (-1178.582) (-1180.024) [-1178.757] * (-1182.641) (-1179.511) [-1186.727] (-1178.485) -- 0:00:15 788500 -- (-1179.580) (-1179.913) [-1179.552] (-1177.866) * (-1179.451) (-1178.391) [-1179.128] (-1180.852) -- 0:00:15 789000 -- (-1179.148) (-1182.013) (-1177.482) [-1177.655] * (-1184.392) (-1178.457) [-1180.428] (-1183.325) -- 0:00:15 789500 -- (-1180.045) (-1178.660) [-1177.699] (-1179.965) * [-1180.914] (-1178.014) (-1180.291) (-1177.962) -- 0:00:15 790000 -- (-1181.678) (-1178.989) (-1179.922) [-1177.472] * (-1178.398) (-1177.600) [-1180.826] (-1180.368) -- 0:00:15 Average standard deviation of split frequencies: 0.006839 790500 -- (-1179.123) [-1181.280] (-1180.673) (-1180.411) * (-1182.486) [-1178.082] (-1181.746) (-1178.793) -- 0:00:15 791000 -- (-1180.543) [-1182.828] (-1179.034) (-1181.730) * (-1179.239) (-1178.886) (-1177.923) [-1181.268] -- 0:00:15 791500 -- (-1181.564) [-1183.029] (-1179.899) (-1185.644) * [-1179.581] (-1182.356) (-1178.306) (-1178.216) -- 0:00:15 792000 -- (-1178.082) (-1183.716) [-1178.971] (-1182.517) * (-1179.703) (-1179.486) [-1179.918] (-1178.385) -- 0:00:14 792500 -- (-1178.426) (-1183.062) [-1178.979] (-1182.192) * (-1179.839) (-1182.131) (-1181.285) [-1179.207] -- 0:00:15 793000 -- (-1179.446) [-1179.639] (-1179.974) (-1182.256) * (-1178.150) [-1181.967] (-1183.271) (-1178.985) -- 0:00:15 793500 -- (-1178.126) [-1178.453] (-1177.802) (-1177.689) * (-1178.884) (-1178.650) (-1178.700) [-1177.978] -- 0:00:15 794000 -- (-1178.705) (-1181.974) (-1183.067) [-1177.622] * (-1177.821) (-1177.432) (-1181.009) [-1178.549] -- 0:00:15 794500 -- (-1178.751) [-1177.290] (-1186.014) (-1178.902) * [-1178.387] (-1178.508) (-1181.171) (-1185.158) -- 0:00:15 795000 -- (-1182.467) (-1177.468) [-1180.859] (-1182.167) * (-1181.452) (-1182.416) [-1179.647] (-1178.229) -- 0:00:14 Average standard deviation of split frequencies: 0.007350 795500 -- (-1181.496) (-1186.160) [-1178.406] (-1182.934) * [-1181.402] (-1183.848) (-1179.012) (-1181.041) -- 0:00:14 796000 -- (-1181.755) (-1186.183) [-1179.913] (-1180.567) * (-1181.274) (-1183.456) [-1179.795] (-1179.023) -- 0:00:14 796500 -- [-1180.035] (-1180.594) (-1177.928) (-1177.541) * (-1183.565) [-1178.247] (-1181.366) (-1178.489) -- 0:00:14 797000 -- [-1178.134] (-1179.824) (-1178.339) (-1179.911) * (-1183.782) [-1179.853] (-1179.883) (-1178.469) -- 0:00:14 797500 -- (-1181.047) (-1179.359) (-1178.207) [-1178.580] * [-1178.758] (-1179.374) (-1178.375) (-1178.299) -- 0:00:14 798000 -- (-1179.271) [-1179.687] (-1181.768) (-1179.750) * (-1179.775) (-1179.306) (-1178.180) [-1179.230] -- 0:00:14 798500 -- (-1178.972) [-1178.840] (-1177.742) (-1183.797) * [-1179.242] (-1179.884) (-1178.479) (-1178.145) -- 0:00:14 799000 -- (-1177.978) (-1178.060) [-1182.032] (-1178.423) * (-1180.865) (-1178.687) [-1179.533] (-1180.023) -- 0:00:14 799500 -- (-1182.491) (-1183.611) [-1179.397] (-1180.410) * [-1179.496] (-1178.992) (-1178.578) (-1178.806) -- 0:00:14 800000 -- [-1178.804] (-1180.532) (-1179.254) (-1179.584) * (-1178.395) (-1181.348) [-1178.569] (-1181.798) -- 0:00:14 Average standard deviation of split frequencies: 0.007550 800500 -- (-1177.961) (-1182.520) (-1185.622) [-1179.166] * (-1180.138) (-1185.980) [-1178.882] (-1180.278) -- 0:00:14 801000 -- (-1178.630) [-1179.046] (-1188.217) (-1178.241) * (-1178.208) [-1180.421] (-1185.759) (-1178.332) -- 0:00:14 801500 -- [-1180.316] (-1181.452) (-1179.862) (-1184.413) * [-1178.080] (-1180.376) (-1181.937) (-1177.836) -- 0:00:14 802000 -- (-1178.939) (-1179.939) [-1180.818] (-1181.071) * (-1181.367) (-1179.874) (-1180.636) [-1177.300] -- 0:00:14 802500 -- (-1179.566) [-1178.086] (-1179.380) (-1182.711) * [-1179.548] (-1177.431) (-1181.729) (-1179.111) -- 0:00:14 803000 -- (-1180.250) (-1179.329) (-1180.125) [-1181.784] * [-1181.508] (-1178.936) (-1177.776) (-1180.428) -- 0:00:14 803500 -- (-1178.962) (-1178.819) [-1180.097] (-1182.924) * (-1181.918) [-1181.577] (-1177.685) (-1178.520) -- 0:00:14 804000 -- (-1177.896) (-1178.692) [-1178.902] (-1179.278) * (-1178.195) (-1180.859) (-1177.305) [-1182.586] -- 0:00:14 804500 -- [-1178.142] (-1179.446) (-1182.382) (-1179.603) * (-1179.289) (-1179.012) [-1178.970] (-1178.802) -- 0:00:14 805000 -- (-1180.040) [-1177.832] (-1178.505) (-1180.417) * (-1180.710) [-1184.084] (-1180.274) (-1178.366) -- 0:00:14 Average standard deviation of split frequencies: 0.007982 805500 -- (-1177.815) [-1177.321] (-1178.969) (-1180.630) * (-1178.633) (-1179.089) [-1177.961] (-1185.370) -- 0:00:14 806000 -- (-1180.710) [-1184.064] (-1179.945) (-1181.966) * (-1182.155) (-1181.661) (-1181.018) [-1181.351] -- 0:00:13 806500 -- [-1180.623] (-1182.298) (-1180.653) (-1184.676) * [-1179.648] (-1181.468) (-1178.813) (-1178.824) -- 0:00:13 807000 -- [-1179.481] (-1181.269) (-1180.173) (-1180.679) * [-1179.743] (-1177.594) (-1179.591) (-1179.944) -- 0:00:13 807500 -- [-1178.242] (-1179.022) (-1178.929) (-1180.849) * (-1178.340) (-1179.121) [-1178.501] (-1178.514) -- 0:00:14 808000 -- (-1181.005) (-1181.583) [-1178.955] (-1181.305) * [-1178.339] (-1181.211) (-1178.739) (-1177.763) -- 0:00:14 808500 -- (-1178.244) (-1177.450) (-1178.661) [-1177.735] * (-1179.225) (-1178.259) [-1179.369] (-1179.542) -- 0:00:13 809000 -- [-1177.505] (-1177.848) (-1179.218) (-1180.703) * (-1180.594) (-1178.245) (-1179.445) [-1178.668] -- 0:00:13 809500 -- (-1177.342) (-1181.250) (-1178.603) [-1177.817] * (-1180.349) (-1179.218) (-1178.306) [-1178.324] -- 0:00:13 810000 -- (-1178.106) (-1180.395) (-1179.235) [-1178.549] * (-1181.039) (-1179.116) (-1178.176) [-1180.592] -- 0:00:13 Average standard deviation of split frequencies: 0.007560 810500 -- [-1177.371] (-1180.688) (-1180.573) (-1179.082) * [-1178.513] (-1180.474) (-1181.229) (-1177.822) -- 0:00:13 811000 -- (-1181.996) [-1177.636] (-1179.047) (-1178.683) * (-1180.303) (-1181.757) [-1182.288] (-1178.147) -- 0:00:13 811500 -- (-1180.111) [-1177.592] (-1179.616) (-1181.351) * (-1185.935) (-1179.534) [-1179.848] (-1178.686) -- 0:00:13 812000 -- (-1178.887) (-1185.566) (-1179.823) [-1178.467] * (-1181.181) [-1184.126] (-1182.131) (-1179.287) -- 0:00:13 812500 -- (-1178.882) [-1179.081] (-1182.800) (-1179.772) * (-1181.893) (-1179.090) (-1179.560) [-1179.328] -- 0:00:13 813000 -- (-1178.867) (-1182.509) [-1178.907] (-1178.062) * (-1180.574) [-1179.676] (-1179.471) (-1180.579) -- 0:00:13 813500 -- (-1178.540) (-1178.835) (-1178.166) [-1181.571] * (-1184.968) (-1180.674) [-1178.355] (-1179.212) -- 0:00:13 814000 -- [-1180.742] (-1178.640) (-1179.321) (-1182.257) * (-1186.211) (-1179.263) [-1178.303] (-1180.714) -- 0:00:13 814500 -- (-1177.764) (-1179.436) [-1179.734] (-1178.873) * [-1185.018] (-1185.183) (-1179.475) (-1182.858) -- 0:00:13 815000 -- (-1180.927) [-1181.818] (-1179.685) (-1177.421) * [-1181.709] (-1182.623) (-1181.625) (-1180.500) -- 0:00:13 Average standard deviation of split frequencies: 0.007816 815500 -- [-1182.247] (-1179.618) (-1182.576) (-1182.647) * (-1181.368) (-1179.856) [-1177.952] (-1179.908) -- 0:00:13 816000 -- (-1178.606) (-1184.730) [-1180.020] (-1178.348) * [-1177.543] (-1179.553) (-1178.033) (-1179.098) -- 0:00:13 816500 -- [-1179.051] (-1180.838) (-1184.186) (-1177.864) * [-1182.198] (-1182.318) (-1178.908) (-1177.330) -- 0:00:13 817000 -- (-1179.397) (-1180.723) (-1177.852) [-1177.955] * (-1179.297) (-1181.580) (-1179.931) [-1177.351] -- 0:00:13 817500 -- (-1179.125) (-1184.747) [-1178.417] (-1179.743) * (-1179.541) (-1180.507) (-1177.830) [-1178.384] -- 0:00:13 818000 -- (-1181.954) [-1179.560] (-1181.965) (-1179.260) * (-1181.887) (-1181.095) [-1181.590] (-1178.269) -- 0:00:13 818500 -- (-1182.026) (-1179.813) (-1184.365) [-1179.292] * [-1180.629] (-1180.909) (-1177.362) (-1179.949) -- 0:00:13 819000 -- [-1178.830] (-1179.918) (-1181.823) (-1178.046) * (-1183.094) (-1183.308) [-1181.195] (-1179.484) -- 0:00:13 819500 -- [-1178.197] (-1178.950) (-1182.843) (-1178.714) * (-1182.547) (-1179.677) (-1179.065) [-1180.241] -- 0:00:12 820000 -- [-1178.352] (-1178.437) (-1180.457) (-1178.653) * [-1179.760] (-1179.630) (-1178.004) (-1180.317) -- 0:00:12 Average standard deviation of split frequencies: 0.007704 820500 -- (-1181.007) [-1178.700] (-1179.434) (-1178.836) * (-1179.745) (-1177.993) [-1180.302] (-1180.137) -- 0:00:12 821000 -- (-1179.810) (-1180.931) (-1177.268) [-1177.898] * (-1182.136) (-1177.305) (-1180.865) [-1179.500] -- 0:00:12 821500 -- (-1181.345) (-1182.229) (-1178.014) [-1179.384] * [-1184.321] (-1180.796) (-1179.393) (-1177.677) -- 0:00:12 822000 -- (-1179.568) (-1178.275) [-1181.237] (-1177.370) * [-1185.171] (-1181.918) (-1182.728) (-1179.100) -- 0:00:12 822500 -- (-1185.877) (-1178.687) [-1182.700] (-1180.985) * (-1182.090) (-1183.375) (-1183.332) [-1181.126] -- 0:00:12 823000 -- (-1181.326) [-1178.094] (-1181.610) (-1179.499) * (-1182.570) (-1180.875) (-1181.852) [-1178.106] -- 0:00:12 823500 -- (-1180.230) (-1177.715) [-1179.491] (-1178.608) * (-1178.228) (-1185.283) [-1178.419] (-1177.662) -- 0:00:12 824000 -- (-1178.301) (-1181.466) [-1179.562] (-1178.025) * [-1178.708] (-1181.138) (-1177.914) (-1179.745) -- 0:00:12 824500 -- (-1177.649) (-1178.009) [-1177.148] (-1179.237) * (-1180.510) (-1177.865) [-1177.775] (-1179.039) -- 0:00:12 825000 -- [-1177.511] (-1177.423) (-1177.208) (-1179.370) * (-1179.337) (-1178.133) (-1181.691) [-1177.612] -- 0:00:12 Average standard deviation of split frequencies: 0.007721 825500 -- (-1177.667) (-1179.366) [-1177.609] (-1181.697) * [-1187.450] (-1181.547) (-1180.108) (-1184.829) -- 0:00:12 826000 -- (-1178.609) (-1180.299) [-1179.286] (-1179.440) * (-1188.980) (-1180.661) (-1177.893) [-1180.400] -- 0:00:12 826500 -- (-1178.124) (-1184.903) (-1179.366) [-1179.372] * [-1180.124] (-1180.415) (-1178.678) (-1180.064) -- 0:00:12 827000 -- (-1182.078) [-1179.581] (-1178.645) (-1179.848) * (-1178.283) (-1179.222) [-1178.703] (-1178.825) -- 0:00:12 827500 -- [-1183.700] (-1178.637) (-1178.124) (-1179.675) * (-1179.005) (-1181.368) (-1179.248) [-1178.710] -- 0:00:12 828000 -- (-1184.416) [-1177.836] (-1181.564) (-1179.219) * (-1178.694) (-1178.703) [-1177.777] (-1179.554) -- 0:00:12 828500 -- (-1184.517) [-1178.438] (-1178.641) (-1180.952) * (-1178.724) (-1179.068) [-1179.014] (-1178.995) -- 0:00:12 829000 -- (-1183.445) (-1179.289) [-1178.929] (-1182.700) * [-1179.629] (-1178.850) (-1179.054) (-1178.236) -- 0:00:12 829500 -- (-1179.242) [-1180.853] (-1183.901) (-1183.418) * (-1180.193) (-1181.967) [-1177.076] (-1178.236) -- 0:00:12 830000 -- (-1177.739) (-1180.036) (-1178.135) [-1180.059] * [-1183.910] (-1179.970) (-1185.450) (-1179.004) -- 0:00:12 Average standard deviation of split frequencies: 0.008012 830500 -- (-1178.313) (-1179.982) [-1177.474] (-1179.983) * (-1177.560) [-1178.399] (-1185.733) (-1180.421) -- 0:00:12 831000 -- (-1181.081) [-1181.975] (-1178.861) (-1178.655) * (-1178.923) (-1178.420) [-1179.849] (-1179.063) -- 0:00:12 831500 -- (-1179.232) (-1179.485) (-1179.858) [-1179.473] * (-1178.504) (-1177.772) [-1180.740] (-1180.144) -- 0:00:12 832000 -- [-1177.338] (-1179.946) (-1179.753) (-1178.095) * (-1185.100) [-1178.158] (-1179.744) (-1177.980) -- 0:00:12 832500 -- [-1179.707] (-1178.710) (-1177.206) (-1177.826) * (-1179.531) (-1183.137) [-1177.561] (-1177.221) -- 0:00:12 833000 -- (-1178.234) (-1178.674) (-1178.447) [-1177.821] * (-1181.981) (-1177.635) [-1177.760] (-1180.276) -- 0:00:12 833500 -- [-1181.790] (-1178.979) (-1177.959) (-1183.033) * (-1178.708) [-1179.688] (-1178.691) (-1180.978) -- 0:00:11 834000 -- (-1177.746) (-1184.167) (-1179.261) [-1177.748] * (-1178.165) [-1181.748] (-1178.915) (-1181.767) -- 0:00:11 834500 -- (-1180.978) [-1180.013] (-1179.086) (-1178.219) * (-1182.287) (-1178.599) (-1178.436) [-1178.784] -- 0:00:11 835000 -- (-1178.682) [-1181.109] (-1180.706) (-1182.898) * (-1189.550) [-1177.383] (-1178.181) (-1178.682) -- 0:00:11 Average standard deviation of split frequencies: 0.008359 835500 -- (-1180.280) [-1179.232] (-1180.345) (-1182.899) * (-1181.997) (-1178.450) [-1178.465] (-1178.140) -- 0:00:11 836000 -- [-1179.035] (-1178.737) (-1183.230) (-1180.583) * (-1180.580) (-1178.671) [-1180.310] (-1177.861) -- 0:00:11 836500 -- [-1182.663] (-1179.025) (-1181.910) (-1179.590) * (-1179.079) (-1183.657) [-1179.479] (-1179.476) -- 0:00:11 837000 -- (-1182.900) (-1179.801) (-1178.554) [-1178.575] * (-1178.984) (-1179.238) [-1178.978] (-1183.276) -- 0:00:11 837500 -- [-1177.932] (-1179.306) (-1178.000) (-1180.898) * [-1177.907] (-1178.890) (-1177.595) (-1183.604) -- 0:00:11 838000 -- (-1178.948) [-1177.778] (-1178.233) (-1188.694) * (-1179.454) [-1180.407] (-1177.061) (-1178.815) -- 0:00:11 838500 -- (-1179.697) (-1178.856) [-1178.463] (-1179.835) * [-1178.628] (-1178.400) (-1177.382) (-1183.158) -- 0:00:11 839000 -- (-1182.828) (-1179.631) (-1180.315) [-1180.796] * [-1177.337] (-1181.302) (-1177.885) (-1181.778) -- 0:00:11 839500 -- [-1180.750] (-1183.414) (-1181.873) (-1182.689) * (-1178.690) (-1180.524) (-1187.526) [-1177.997] -- 0:00:11 840000 -- (-1179.074) (-1180.479) [-1182.177] (-1180.523) * (-1179.055) [-1179.300] (-1185.718) (-1177.553) -- 0:00:11 Average standard deviation of split frequencies: 0.008378 840500 -- (-1179.571) (-1181.505) [-1178.000] (-1180.176) * [-1179.467] (-1179.210) (-1179.949) (-1177.647) -- 0:00:11 841000 -- [-1177.627] (-1184.155) (-1180.366) (-1180.602) * (-1179.403) (-1180.895) [-1177.335] (-1179.672) -- 0:00:11 841500 -- (-1180.724) (-1178.255) [-1180.031] (-1180.617) * (-1178.824) [-1178.211] (-1179.589) (-1179.739) -- 0:00:11 842000 -- [-1178.652] (-1179.997) (-1178.929) (-1178.927) * (-1179.001) (-1184.477) [-1179.006] (-1177.888) -- 0:00:11 842500 -- (-1178.280) [-1179.644] (-1178.943) (-1181.056) * (-1183.950) (-1182.264) (-1181.270) [-1177.995] -- 0:00:11 843000 -- (-1177.645) (-1184.381) [-1181.094] (-1182.022) * (-1180.249) (-1181.552) [-1178.918] (-1178.014) -- 0:00:11 843500 -- (-1178.882) (-1179.326) [-1180.615] (-1178.373) * (-1179.378) [-1179.060] (-1179.557) (-1177.655) -- 0:00:11 844000 -- [-1179.832] (-1184.834) (-1182.285) (-1179.703) * (-1180.646) [-1179.591] (-1178.784) (-1177.767) -- 0:00:11 844500 -- (-1177.705) (-1177.589) [-1179.308] (-1178.635) * (-1177.851) (-1180.316) [-1178.696] (-1178.358) -- 0:00:11 845000 -- (-1182.253) (-1178.673) [-1180.520] (-1180.217) * [-1178.482] (-1178.024) (-1180.022) (-1178.596) -- 0:00:11 Average standard deviation of split frequencies: 0.008391 845500 -- [-1177.958] (-1178.830) (-1181.648) (-1181.352) * [-1177.795] (-1179.845) (-1184.377) (-1178.634) -- 0:00:11 846000 -- (-1178.111) [-1179.309] (-1179.416) (-1177.996) * (-1178.424) (-1178.322) (-1178.170) [-1177.739] -- 0:00:11 846500 -- [-1177.495] (-1179.443) (-1182.434) (-1181.111) * (-1178.545) (-1178.532) [-1177.649] (-1178.545) -- 0:00:11 847000 -- [-1177.410] (-1179.632) (-1181.275) (-1182.668) * [-1180.377] (-1180.904) (-1180.367) (-1177.952) -- 0:00:11 847500 -- [-1178.448] (-1177.577) (-1179.412) (-1181.286) * (-1182.234) [-1178.973] (-1181.503) (-1178.137) -- 0:00:10 848000 -- (-1182.779) (-1178.276) (-1181.311) [-1182.331] * [-1178.815] (-1181.381) (-1180.084) (-1179.175) -- 0:00:10 848500 -- (-1180.004) (-1178.629) (-1178.286) [-1179.494] * (-1178.598) (-1178.311) (-1178.223) [-1179.324] -- 0:00:10 849000 -- (-1181.040) (-1179.484) [-1177.488] (-1182.335) * [-1177.662] (-1179.940) (-1179.890) (-1180.341) -- 0:00:10 849500 -- (-1179.712) (-1184.174) [-1181.021] (-1179.625) * (-1178.310) (-1182.453) (-1182.718) [-1182.677] -- 0:00:10 850000 -- (-1181.195) (-1180.828) [-1181.424] (-1180.735) * (-1179.043) (-1179.573) (-1177.998) [-1180.992] -- 0:00:10 Average standard deviation of split frequencies: 0.008215 850500 -- (-1184.144) (-1179.083) [-1179.996] (-1182.828) * (-1178.919) [-1178.505] (-1179.981) (-1181.045) -- 0:00:10 851000 -- [-1183.873] (-1180.637) (-1178.260) (-1182.885) * (-1178.298) [-1178.727] (-1180.451) (-1177.287) -- 0:00:10 851500 -- (-1179.662) (-1178.706) [-1178.249] (-1180.522) * (-1180.241) (-1183.375) [-1178.851] (-1178.014) -- 0:00:10 852000 -- (-1180.366) [-1177.693] (-1178.133) (-1182.352) * (-1178.424) [-1176.972] (-1180.695) (-1177.744) -- 0:00:10 852500 -- [-1179.370] (-1177.503) (-1177.744) (-1179.774) * (-1178.126) [-1178.391] (-1181.282) (-1181.128) -- 0:00:10 853000 -- (-1180.901) (-1178.385) [-1181.302] (-1180.369) * [-1180.022] (-1178.149) (-1179.705) (-1181.579) -- 0:00:10 853500 -- (-1179.814) (-1178.875) (-1178.438) [-1182.609] * (-1182.283) (-1178.187) (-1180.672) [-1179.507] -- 0:00:10 854000 -- (-1177.917) [-1178.266] (-1178.573) (-1186.286) * (-1180.617) (-1180.058) (-1178.503) [-1179.242] -- 0:00:10 854500 -- [-1178.379] (-1178.814) (-1179.889) (-1181.963) * [-1179.229] (-1179.376) (-1182.569) (-1178.365) -- 0:00:10 855000 -- (-1179.544) [-1179.984] (-1184.462) (-1178.993) * [-1178.347] (-1178.922) (-1181.870) (-1179.565) -- 0:00:10 Average standard deviation of split frequencies: 0.008131 855500 -- [-1178.272] (-1182.557) (-1180.724) (-1181.297) * (-1178.333) (-1179.641) (-1179.553) [-1180.313] -- 0:00:10 856000 -- (-1178.100) (-1177.964) (-1177.187) [-1180.421] * [-1178.692] (-1179.772) (-1178.479) (-1180.635) -- 0:00:10 856500 -- (-1177.852) (-1177.630) (-1177.857) [-1180.583] * [-1177.852] (-1177.731) (-1192.302) (-1182.840) -- 0:00:10 857000 -- (-1183.940) [-1178.677] (-1178.056) (-1178.883) * (-1178.230) (-1177.473) (-1180.914) [-1182.170] -- 0:00:10 857500 -- (-1180.447) [-1177.977] (-1181.169) (-1178.350) * [-1178.059] (-1179.906) (-1181.016) (-1179.214) -- 0:00:10 858000 -- (-1183.946) (-1180.230) [-1183.108] (-1179.935) * (-1178.059) (-1179.378) [-1179.903] (-1181.183) -- 0:00:10 858500 -- (-1181.903) (-1183.843) (-1179.846) [-1177.877] * (-1180.336) [-1178.511] (-1182.366) (-1181.588) -- 0:00:10 859000 -- (-1181.240) (-1180.272) [-1181.124] (-1178.729) * (-1179.801) (-1179.466) (-1180.409) [-1179.659] -- 0:00:10 859500 -- (-1180.322) (-1180.786) [-1180.994] (-1179.042) * [-1179.843] (-1179.043) (-1182.283) (-1178.512) -- 0:00:10 860000 -- [-1178.782] (-1180.205) (-1179.458) (-1179.324) * [-1178.855] (-1178.841) (-1181.063) (-1180.309) -- 0:00:10 Average standard deviation of split frequencies: 0.007765 860500 -- (-1179.691) [-1177.883] (-1179.479) (-1182.012) * [-1178.194] (-1178.888) (-1179.602) (-1181.126) -- 0:00:10 861000 -- (-1179.933) (-1179.417) (-1180.446) [-1178.220] * [-1179.106] (-1178.582) (-1178.637) (-1180.724) -- 0:00:10 861500 -- (-1177.527) (-1178.673) [-1179.288] (-1179.794) * [-1178.473] (-1179.547) (-1178.229) (-1178.759) -- 0:00:09 862000 -- (-1178.454) [-1177.812] (-1180.642) (-1179.379) * [-1186.176] (-1178.930) (-1177.945) (-1178.017) -- 0:00:09 862500 -- (-1179.157) (-1179.172) (-1184.497) [-1179.624] * [-1178.796] (-1177.867) (-1179.659) (-1180.650) -- 0:00:09 863000 -- (-1182.291) (-1181.257) (-1178.884) [-1179.386] * (-1180.451) (-1178.084) (-1180.599) [-1178.750] -- 0:00:09 863500 -- (-1182.453) (-1179.443) [-1178.402] (-1180.826) * (-1178.621) (-1177.861) (-1180.037) [-1177.262] -- 0:00:09 864000 -- (-1183.265) [-1177.386] (-1180.394) (-1181.305) * [-1179.775] (-1178.889) (-1179.163) (-1177.512) -- 0:00:09 864500 -- (-1180.708) (-1179.267) [-1177.809] (-1177.703) * (-1179.775) (-1177.955) [-1178.520] (-1177.536) -- 0:00:09 865000 -- [-1178.530] (-1181.213) (-1180.757) (-1178.114) * (-1178.731) (-1179.405) [-1178.091] (-1177.688) -- 0:00:09 Average standard deviation of split frequencies: 0.007813 865500 -- (-1179.062) [-1178.492] (-1179.087) (-1178.283) * [-1178.814] (-1180.813) (-1181.495) (-1177.949) -- 0:00:09 866000 -- (-1182.003) [-1178.075] (-1177.386) (-1180.246) * (-1179.328) (-1182.694) [-1179.128] (-1178.193) -- 0:00:09 866500 -- (-1180.105) [-1177.949] (-1179.029) (-1178.102) * [-1179.617] (-1179.711) (-1178.378) (-1178.248) -- 0:00:09 867000 -- [-1180.105] (-1178.788) (-1180.109) (-1177.773) * (-1180.124) (-1179.541) [-1179.711] (-1178.376) -- 0:00:09 867500 -- (-1180.159) (-1181.405) [-1177.370] (-1182.194) * (-1181.687) (-1177.874) [-1181.264] (-1180.349) -- 0:00:09 868000 -- [-1180.307] (-1179.036) (-1177.963) (-1180.827) * (-1178.292) (-1181.575) [-1178.412] (-1182.363) -- 0:00:09 868500 -- [-1179.399] (-1181.389) (-1177.040) (-1179.388) * (-1178.426) (-1177.786) [-1180.242] (-1179.875) -- 0:00:09 869000 -- (-1178.706) (-1183.091) [-1177.835] (-1178.544) * (-1182.396) (-1183.177) (-1182.102) [-1181.073] -- 0:00:09 869500 -- (-1178.893) (-1178.086) (-1178.437) [-1180.637] * (-1181.312) (-1183.333) (-1182.291) [-1178.354] -- 0:00:09 870000 -- (-1180.295) (-1178.658) (-1177.556) [-1183.328] * (-1178.761) (-1178.765) [-1183.359] (-1179.770) -- 0:00:09 Average standard deviation of split frequencies: 0.007676 870500 -- (-1177.535) [-1181.163] (-1181.958) (-1180.749) * (-1178.440) (-1179.416) [-1181.295] (-1179.344) -- 0:00:09 871000 -- [-1177.748] (-1177.676) (-1177.782) (-1182.640) * [-1180.973] (-1178.238) (-1185.153) (-1177.779) -- 0:00:09 871500 -- (-1178.747) (-1178.604) (-1180.310) [-1179.494] * [-1178.210] (-1180.768) (-1181.399) (-1179.247) -- 0:00:09 872000 -- (-1180.190) [-1179.379] (-1180.445) (-1178.629) * (-1178.151) [-1179.504] (-1180.293) (-1180.580) -- 0:00:09 872500 -- (-1180.773) (-1178.024) (-1180.557) [-1178.471] * (-1177.646) (-1179.222) (-1178.126) [-1177.486] -- 0:00:09 873000 -- [-1180.186] (-1178.992) (-1177.511) (-1179.751) * (-1180.324) (-1178.732) [-1178.122] (-1180.709) -- 0:00:09 873500 -- (-1180.052) (-1179.574) (-1179.735) [-1178.410] * (-1180.518) (-1181.127) [-1181.775] (-1179.936) -- 0:00:09 874000 -- (-1180.030) [-1179.062] (-1179.586) (-1177.651) * (-1179.922) (-1179.539) [-1179.901] (-1178.348) -- 0:00:09 874500 -- (-1178.147) (-1181.833) [-1179.509] (-1177.673) * (-1177.529) (-1180.208) (-1178.001) [-1177.509] -- 0:00:09 875000 -- (-1181.367) [-1180.075] (-1177.360) (-1181.059) * [-1178.938] (-1185.164) (-1177.852) (-1180.685) -- 0:00:09 Average standard deviation of split frequencies: 0.007787 875500 -- (-1178.526) [-1192.748] (-1180.981) (-1186.245) * (-1178.918) (-1180.901) (-1178.148) [-1180.019] -- 0:00:08 876000 -- [-1178.980] (-1185.794) (-1182.263) (-1179.363) * (-1182.095) [-1177.526] (-1177.398) (-1177.588) -- 0:00:08 876500 -- (-1184.715) (-1181.139) [-1177.813] (-1178.993) * (-1180.061) (-1179.291) [-1177.729] (-1178.248) -- 0:00:08 877000 -- (-1179.721) (-1177.359) [-1179.383] (-1180.305) * (-1177.741) [-1178.278] (-1177.537) (-1179.461) -- 0:00:08 877500 -- [-1178.018] (-1177.088) (-1180.285) (-1181.961) * (-1180.040) (-1177.647) (-1179.818) [-1180.156] -- 0:00:08 878000 -- (-1181.034) [-1177.957] (-1177.730) (-1179.369) * [-1178.547] (-1178.850) (-1180.566) (-1181.126) -- 0:00:08 878500 -- (-1179.610) [-1177.369] (-1178.168) (-1179.357) * (-1178.721) [-1179.616] (-1179.934) (-1182.721) -- 0:00:08 879000 -- (-1179.005) [-1178.424] (-1179.432) (-1177.238) * (-1178.025) (-1178.908) [-1177.913] (-1182.101) -- 0:00:08 879500 -- [-1178.104] (-1178.548) (-1179.559) (-1178.768) * (-1177.175) [-1177.894] (-1178.567) (-1181.799) -- 0:00:08 880000 -- (-1179.939) (-1178.556) [-1177.811] (-1179.440) * [-1177.235] (-1180.536) (-1177.334) (-1180.748) -- 0:00:08 Average standard deviation of split frequencies: 0.007728 880500 -- (-1179.165) (-1178.026) (-1179.881) [-1177.876] * (-1178.074) [-1179.523] (-1177.681) (-1179.233) -- 0:00:08 881000 -- (-1178.566) (-1179.770) (-1179.002) [-1177.640] * (-1182.194) [-1178.001] (-1181.887) (-1180.666) -- 0:00:08 881500 -- (-1183.254) (-1177.978) [-1178.525] (-1185.505) * (-1178.523) [-1177.761] (-1180.218) (-1180.214) -- 0:00:08 882000 -- [-1179.073] (-1181.223) (-1179.473) (-1182.335) * (-1189.080) (-1178.270) [-1181.365] (-1182.885) -- 0:00:08 882500 -- (-1177.383) (-1178.852) [-1179.336] (-1180.563) * (-1179.348) (-1177.442) [-1178.792] (-1181.317) -- 0:00:08 883000 -- (-1180.527) (-1178.776) (-1178.818) [-1181.043] * [-1179.157] (-1179.733) (-1179.865) (-1179.153) -- 0:00:08 883500 -- (-1179.606) [-1185.798] (-1179.785) (-1179.878) * (-1178.343) (-1178.700) [-1178.958] (-1177.226) -- 0:00:08 884000 -- (-1178.828) (-1181.899) [-1182.505] (-1177.441) * [-1179.868] (-1178.700) (-1179.144) (-1179.157) -- 0:00:08 884500 -- [-1178.680] (-1179.275) (-1180.501) (-1177.773) * (-1177.513) (-1180.047) [-1178.414] (-1179.918) -- 0:00:08 885000 -- (-1181.994) (-1179.728) (-1182.897) [-1178.932] * (-1176.975) (-1180.630) [-1178.202] (-1178.195) -- 0:00:08 Average standard deviation of split frequencies: 0.007881 885500 -- (-1178.758) (-1181.320) (-1183.755) [-1177.446] * (-1179.834) (-1179.383) (-1178.749) [-1178.832] -- 0:00:08 886000 -- (-1179.398) (-1178.953) [-1178.695] (-1177.667) * (-1183.437) [-1180.390] (-1178.817) (-1178.439) -- 0:00:08 886500 -- [-1178.794] (-1178.375) (-1183.767) (-1177.995) * (-1183.887) [-1177.667] (-1178.887) (-1179.082) -- 0:00:08 887000 -- [-1183.328] (-1178.800) (-1180.397) (-1182.119) * (-1182.132) (-1177.981) [-1183.614] (-1182.317) -- 0:00:08 887500 -- (-1182.632) (-1178.294) [-1178.628] (-1179.224) * (-1182.624) (-1179.237) [-1177.228] (-1181.170) -- 0:00:08 888000 -- (-1185.992) (-1178.555) [-1180.082] (-1180.828) * (-1177.593) (-1178.103) (-1179.142) [-1179.765] -- 0:00:08 888500 -- (-1184.292) (-1180.049) [-1178.999] (-1181.634) * (-1182.691) [-1179.579] (-1183.504) (-1181.454) -- 0:00:08 889000 -- (-1178.131) (-1180.163) (-1179.207) [-1178.372] * (-1182.165) (-1184.681) (-1181.171) [-1177.464] -- 0:00:07 889500 -- (-1181.097) (-1178.589) (-1182.591) [-1179.288] * (-1178.790) [-1178.133] (-1182.031) (-1180.582) -- 0:00:07 890000 -- (-1179.522) (-1179.217) [-1181.912] (-1180.284) * (-1181.988) (-1180.834) [-1184.179] (-1181.235) -- 0:00:07 Average standard deviation of split frequencies: 0.008138 890500 -- (-1181.224) (-1178.277) (-1177.799) [-1178.388] * [-1180.875] (-1178.781) (-1179.488) (-1177.797) -- 0:00:07 891000 -- (-1182.001) [-1178.788] (-1179.844) (-1181.771) * (-1179.928) [-1177.797] (-1179.966) (-1179.632) -- 0:00:07 891500 -- (-1180.602) (-1180.736) [-1178.033] (-1180.385) * (-1180.110) [-1179.177] (-1181.220) (-1177.912) -- 0:00:07 892000 -- (-1177.471) (-1181.694) [-1182.806] (-1179.899) * (-1178.351) (-1179.204) (-1179.279) [-1177.412] -- 0:00:07 892500 -- (-1180.752) (-1181.782) (-1180.542) [-1177.655] * (-1177.874) [-1179.226] (-1178.152) (-1179.634) -- 0:00:07 893000 -- (-1183.671) (-1178.920) (-1178.507) [-1178.711] * [-1178.320] (-1178.285) (-1178.788) (-1179.511) -- 0:00:07 893500 -- (-1180.769) [-1177.962] (-1180.314) (-1180.608) * [-1177.871] (-1178.313) (-1182.141) (-1181.756) -- 0:00:07 894000 -- [-1180.518] (-1180.128) (-1179.611) (-1178.924) * (-1179.787) [-1177.452] (-1180.159) (-1180.246) -- 0:00:07 894500 -- (-1180.966) (-1182.121) (-1178.973) [-1177.855] * (-1181.472) (-1178.190) [-1179.568] (-1180.280) -- 0:00:07 895000 -- (-1178.102) (-1181.487) (-1179.341) [-1177.741] * (-1178.140) (-1177.971) [-1179.460] (-1179.758) -- 0:00:07 Average standard deviation of split frequencies: 0.008319 895500 -- (-1183.385) (-1179.713) (-1178.401) [-1178.647] * [-1177.936] (-1178.058) (-1178.146) (-1179.990) -- 0:00:07 896000 -- (-1182.887) (-1178.555) [-1180.499] (-1178.812) * (-1179.044) (-1179.222) (-1181.397) [-1178.913] -- 0:00:07 896500 -- (-1178.263) (-1177.998) (-1181.581) [-1177.238] * [-1177.618] (-1181.312) (-1183.380) (-1181.466) -- 0:00:07 897000 -- (-1178.493) (-1178.974) (-1180.911) [-1178.244] * (-1178.134) (-1179.038) (-1178.858) [-1183.953] -- 0:00:07 897500 -- (-1180.952) (-1178.780) (-1179.469) [-1178.586] * (-1179.204) (-1178.441) [-1178.786] (-1182.239) -- 0:00:07 898000 -- [-1183.981] (-1179.092) (-1181.864) (-1179.827) * (-1177.725) (-1177.633) [-1179.515] (-1181.769) -- 0:00:07 898500 -- [-1179.648] (-1178.869) (-1182.751) (-1179.984) * (-1178.365) (-1181.015) (-1179.330) [-1177.523] -- 0:00:07 899000 -- (-1178.650) [-1178.626] (-1180.251) (-1179.823) * (-1178.023) [-1178.118] (-1179.106) (-1179.488) -- 0:00:07 899500 -- (-1178.634) [-1177.822] (-1185.157) (-1179.872) * [-1178.149] (-1181.841) (-1178.231) (-1180.510) -- 0:00:07 900000 -- (-1181.524) (-1179.403) (-1181.544) [-1178.660] * [-1178.496] (-1181.017) (-1178.212) (-1179.476) -- 0:00:07 Average standard deviation of split frequencies: 0.008080 900500 -- [-1178.462] (-1178.613) (-1181.556) (-1179.441) * (-1177.211) [-1177.211] (-1178.851) (-1182.181) -- 0:00:07 901000 -- (-1178.240) [-1179.318] (-1181.007) (-1179.127) * (-1178.162) (-1180.501) (-1178.129) [-1182.209] -- 0:00:07 901500 -- (-1179.566) [-1178.986] (-1178.907) (-1179.593) * (-1180.714) [-1180.661] (-1182.500) (-1179.485) -- 0:00:07 902000 -- (-1183.218) (-1183.626) (-1179.830) [-1180.061] * [-1178.941] (-1182.065) (-1179.720) (-1182.709) -- 0:00:07 902500 -- [-1180.335] (-1187.426) (-1178.270) (-1179.778) * (-1177.495) (-1183.192) (-1179.180) [-1177.511] -- 0:00:07 903000 -- (-1178.649) [-1189.434] (-1179.179) (-1183.702) * (-1180.593) [-1179.252] (-1178.971) (-1178.399) -- 0:00:06 903500 -- [-1177.393] (-1181.454) (-1177.666) (-1186.413) * (-1184.406) [-1179.398] (-1179.391) (-1178.292) -- 0:00:06 904000 -- [-1177.600] (-1178.837) (-1178.753) (-1184.864) * (-1179.179) (-1179.533) (-1182.278) [-1178.352] -- 0:00:06 904500 -- (-1179.948) [-1180.262] (-1178.333) (-1180.343) * (-1178.976) [-1178.320] (-1181.387) (-1180.820) -- 0:00:06 905000 -- (-1178.532) [-1178.412] (-1183.480) (-1179.975) * (-1178.600) [-1178.012] (-1177.882) (-1178.780) -- 0:00:06 Average standard deviation of split frequencies: 0.007740 905500 -- (-1178.791) (-1179.417) (-1182.057) [-1178.159] * (-1179.564) (-1177.628) [-1180.177] (-1181.607) -- 0:00:06 906000 -- (-1179.570) [-1181.399] (-1181.082) (-1178.417) * (-1180.201) (-1180.416) (-1179.552) [-1180.646] -- 0:00:06 906500 -- (-1179.851) (-1177.868) (-1184.988) [-1178.458] * (-1179.330) (-1178.953) (-1178.833) [-1178.916] -- 0:00:06 907000 -- (-1187.816) [-1177.996] (-1186.426) (-1179.763) * (-1181.381) (-1178.201) [-1178.761] (-1179.867) -- 0:00:06 907500 -- (-1188.384) (-1180.204) [-1179.701] (-1180.060) * (-1179.033) (-1179.743) [-1179.216] (-1178.610) -- 0:00:06 908000 -- (-1179.027) (-1180.948) (-1181.764) [-1179.482] * [-1179.868] (-1181.377) (-1179.492) (-1180.418) -- 0:00:06 908500 -- (-1178.932) [-1177.679] (-1185.253) (-1178.761) * (-1178.770) [-1179.100] (-1179.805) (-1178.331) -- 0:00:06 909000 -- (-1184.857) (-1177.728) (-1183.925) [-1180.487] * (-1177.697) [-1179.374] (-1180.663) (-1178.288) -- 0:00:06 909500 -- (-1177.939) [-1178.319] (-1186.008) (-1178.408) * [-1179.244] (-1178.162) (-1177.059) (-1178.031) -- 0:00:06 910000 -- (-1177.382) [-1178.998] (-1182.428) (-1178.277) * [-1180.807] (-1180.792) (-1182.158) (-1178.162) -- 0:00:06 Average standard deviation of split frequencies: 0.007603 910500 -- (-1177.781) (-1180.829) [-1182.031] (-1178.229) * (-1178.992) (-1178.387) [-1178.620] (-1178.794) -- 0:00:06 911000 -- (-1178.563) (-1179.845) [-1184.091] (-1179.188) * (-1178.362) (-1180.141) [-1181.769] (-1177.244) -- 0:00:06 911500 -- (-1181.091) (-1179.446) [-1183.073] (-1180.967) * (-1177.431) (-1177.729) (-1180.550) [-1178.973] -- 0:00:06 912000 -- (-1180.039) (-1181.865) [-1180.418] (-1177.201) * (-1178.470) (-1179.099) (-1181.323) [-1178.215] -- 0:00:06 912500 -- [-1179.563] (-1181.303) (-1178.623) (-1177.327) * [-1184.045] (-1178.813) (-1183.293) (-1185.040) -- 0:00:06 913000 -- (-1178.140) (-1179.359) [-1183.451] (-1178.861) * (-1181.390) (-1179.295) (-1181.052) [-1180.404] -- 0:00:06 913500 -- [-1178.470] (-1183.000) (-1180.025) (-1178.562) * (-1179.259) (-1179.440) [-1179.135] (-1183.035) -- 0:00:06 914000 -- (-1178.798) [-1178.306] (-1179.041) (-1179.444) * [-1180.312] (-1177.378) (-1182.408) (-1183.347) -- 0:00:06 914500 -- (-1182.688) (-1177.782) [-1179.044] (-1177.488) * [-1178.743] (-1178.109) (-1179.290) (-1180.247) -- 0:00:06 915000 -- (-1178.132) (-1179.374) (-1178.738) [-1178.338] * (-1180.158) [-1177.818] (-1178.808) (-1178.809) -- 0:00:06 Average standard deviation of split frequencies: 0.007623 915500 -- [-1177.474] (-1180.805) (-1179.020) (-1178.222) * (-1180.414) (-1178.889) (-1178.946) [-1180.582] -- 0:00:06 916000 -- (-1177.509) (-1179.708) [-1179.570] (-1177.482) * (-1180.495) (-1178.992) [-1178.663] (-1182.937) -- 0:00:06 916500 -- (-1178.254) (-1178.745) [-1179.822] (-1178.883) * (-1177.570) (-1179.260) [-1180.594] (-1179.666) -- 0:00:06 917000 -- (-1178.135) (-1180.619) [-1177.794] (-1178.332) * (-1177.704) (-1182.145) (-1177.660) [-1177.405] -- 0:00:05 917500 -- (-1177.475) [-1178.358] (-1178.892) (-1179.803) * (-1178.995) (-1178.852) [-1178.072] (-1178.057) -- 0:00:05 918000 -- (-1177.987) (-1177.753) (-1178.746) [-1179.062] * (-1181.420) (-1178.797) (-1181.176) [-1178.519] -- 0:00:05 918500 -- [-1177.760] (-1184.810) (-1177.316) (-1180.183) * (-1183.106) [-1177.717] (-1186.572) (-1178.157) -- 0:00:05 919000 -- (-1180.219) (-1181.251) [-1180.331] (-1179.165) * (-1180.228) (-1178.179) (-1179.026) [-1183.019] -- 0:00:05 919500 -- (-1177.440) (-1179.468) (-1181.815) [-1181.524] * [-1178.442] (-1178.754) (-1181.358) (-1182.500) -- 0:00:05 920000 -- (-1180.228) (-1178.325) (-1180.532) [-1180.811] * (-1182.534) (-1179.636) [-1180.271] (-1179.288) -- 0:00:05 Average standard deviation of split frequencies: 0.008096 920500 -- (-1178.958) [-1178.730] (-1179.507) (-1179.380) * (-1181.432) (-1183.632) (-1180.223) [-1178.541] -- 0:00:05 921000 -- (-1181.692) [-1177.891] (-1178.313) (-1180.384) * [-1178.441] (-1177.781) (-1179.131) (-1178.831) -- 0:00:05 921500 -- (-1183.362) (-1178.962) [-1180.324] (-1181.562) * (-1180.523) (-1178.316) (-1180.740) [-1179.225] -- 0:00:05 922000 -- [-1179.145] (-1181.726) (-1178.548) (-1183.496) * (-1180.175) (-1178.323) [-1177.757] (-1178.552) -- 0:00:05 922500 -- (-1180.858) (-1179.435) (-1180.958) [-1181.424] * (-1179.870) (-1179.401) (-1183.349) [-1181.036] -- 0:00:05 923000 -- [-1180.638] (-1180.267) (-1179.358) (-1184.408) * (-1177.946) [-1178.664] (-1177.303) (-1181.417) -- 0:00:05 923500 -- (-1179.029) (-1178.009) (-1177.524) [-1179.287] * (-1177.542) (-1182.574) [-1177.312] (-1179.047) -- 0:00:05 924000 -- (-1177.728) (-1183.105) [-1179.599] (-1179.388) * (-1180.106) (-1179.407) (-1178.482) [-1182.160] -- 0:00:05 924500 -- (-1179.279) [-1177.852] (-1178.433) (-1180.645) * (-1181.030) (-1179.252) [-1179.032] (-1182.689) -- 0:00:05 925000 -- (-1179.925) (-1180.719) (-1179.518) [-1182.144] * (-1179.993) [-1179.554] (-1179.260) (-1178.599) -- 0:00:05 Average standard deviation of split frequencies: 0.008082 925500 -- (-1184.699) [-1178.297] (-1180.138) (-1181.637) * (-1178.435) [-1177.944] (-1180.552) (-1180.505) -- 0:00:05 926000 -- (-1187.318) [-1178.140] (-1180.066) (-1184.140) * (-1177.983) [-1180.032] (-1178.949) (-1178.734) -- 0:00:05 926500 -- (-1182.860) (-1180.128) (-1181.875) [-1181.405] * (-1178.281) (-1177.581) [-1179.756] (-1182.735) -- 0:00:05 927000 -- (-1179.254) [-1178.694] (-1178.819) (-1177.834) * [-1183.970] (-1178.376) (-1179.307) (-1184.581) -- 0:00:05 927500 -- [-1179.268] (-1178.878) (-1179.869) (-1178.650) * (-1178.863) (-1180.986) [-1179.274] (-1181.239) -- 0:00:05 928000 -- (-1178.765) [-1179.074] (-1178.307) (-1178.617) * (-1183.007) (-1184.414) (-1178.978) [-1178.903] -- 0:00:05 928500 -- (-1179.556) (-1179.031) (-1183.574) [-1177.766] * (-1181.577) (-1181.718) [-1179.560] (-1179.730) -- 0:00:05 929000 -- (-1182.304) (-1181.808) [-1179.875] (-1179.665) * (-1178.356) (-1177.361) (-1179.397) [-1181.133] -- 0:00:05 929500 -- [-1179.829] (-1180.070) (-1178.367) (-1178.592) * (-1178.243) (-1178.488) (-1177.438) [-1178.934] -- 0:00:05 930000 -- (-1181.153) [-1179.222] (-1181.800) (-1184.507) * (-1178.515) (-1178.990) (-1178.242) [-1178.286] -- 0:00:05 Average standard deviation of split frequencies: 0.007819 930500 -- (-1180.243) (-1180.218) [-1183.234] (-1178.720) * [-1178.191] (-1183.376) (-1179.408) (-1180.009) -- 0:00:05 931000 -- (-1179.390) (-1178.898) (-1182.639) [-1178.683] * (-1182.707) (-1179.343) (-1179.456) [-1178.934] -- 0:00:04 931500 -- (-1182.625) (-1180.521) [-1179.974] (-1180.080) * [-1179.096] (-1177.479) (-1178.007) (-1180.201) -- 0:00:04 932000 -- (-1178.760) (-1180.870) (-1182.751) [-1177.765] * [-1178.849] (-1178.347) (-1178.033) (-1177.495) -- 0:00:04 932500 -- (-1178.876) (-1182.367) (-1181.077) [-1177.698] * (-1179.013) [-1177.520] (-1178.427) (-1181.349) -- 0:00:04 933000 -- (-1182.431) (-1177.839) (-1177.733) [-1179.958] * (-1178.641) (-1177.543) (-1181.768) [-1180.515] -- 0:00:04 933500 -- [-1181.890] (-1178.833) (-1178.044) (-1178.769) * (-1180.032) (-1177.926) [-1179.637] (-1179.822) -- 0:00:04 934000 -- [-1178.982] (-1186.131) (-1180.757) (-1179.331) * (-1177.356) (-1180.124) [-1181.096] (-1178.810) -- 0:00:04 934500 -- [-1180.645] (-1180.473) (-1177.988) (-1179.821) * (-1184.021) (-1182.816) [-1178.928] (-1178.323) -- 0:00:04 935000 -- (-1181.780) (-1178.320) (-1180.559) [-1180.917] * (-1180.463) [-1180.779] (-1179.413) (-1179.847) -- 0:00:04 Average standard deviation of split frequencies: 0.007743 935500 -- [-1178.998] (-1178.311) (-1180.050) (-1178.958) * [-1182.367] (-1178.044) (-1178.211) (-1178.632) -- 0:00:04 936000 -- [-1177.516] (-1178.320) (-1179.875) (-1180.568) * (-1181.819) (-1177.522) (-1180.934) [-1179.583] -- 0:00:04 936500 -- [-1177.697] (-1178.476) (-1180.422) (-1180.213) * (-1181.962) (-1179.978) [-1180.320] (-1178.446) -- 0:00:04 937000 -- (-1177.227) [-1177.956] (-1179.977) (-1178.260) * [-1177.557] (-1178.678) (-1177.764) (-1181.839) -- 0:00:04 937500 -- (-1178.032) (-1179.264) (-1183.022) [-1177.556] * (-1178.568) (-1183.283) [-1179.796] (-1186.445) -- 0:00:04 938000 -- (-1180.227) (-1179.947) (-1182.312) [-1178.105] * (-1181.075) [-1179.994] (-1177.758) (-1180.080) -- 0:00:04 938500 -- (-1180.564) [-1178.519] (-1185.388) (-1178.314) * (-1178.866) (-1178.254) [-1178.191] (-1178.510) -- 0:00:04 939000 -- (-1180.504) (-1179.848) (-1182.155) [-1178.252] * (-1179.245) (-1177.774) (-1178.205) [-1178.080] -- 0:00:04 939500 -- (-1178.385) (-1181.138) (-1179.432) [-1177.147] * [-1179.965] (-1178.830) (-1177.838) (-1181.614) -- 0:00:04 940000 -- [-1177.926] (-1185.245) (-1183.528) (-1178.188) * [-1178.258] (-1178.426) (-1177.785) (-1179.120) -- 0:00:04 Average standard deviation of split frequencies: 0.007423 940500 -- (-1181.567) (-1179.578) [-1179.579] (-1177.514) * (-1178.147) (-1179.570) (-1177.551) [-1179.481] -- 0:00:04 941000 -- [-1178.021] (-1184.837) (-1178.742) (-1178.107) * (-1179.916) (-1181.326) [-1182.688] (-1181.739) -- 0:00:04 941500 -- [-1178.698] (-1179.254) (-1179.825) (-1180.364) * (-1179.436) [-1179.423] (-1178.188) (-1180.346) -- 0:00:04 942000 -- (-1179.305) (-1178.222) [-1180.165] (-1179.788) * [-1179.207] (-1179.127) (-1178.055) (-1180.406) -- 0:00:04 942500 -- (-1182.176) (-1177.908) [-1178.777] (-1178.837) * [-1178.848] (-1177.320) (-1177.716) (-1178.857) -- 0:00:04 943000 -- (-1183.933) (-1178.740) (-1186.687) [-1185.876] * [-1180.367] (-1180.344) (-1179.426) (-1180.049) -- 0:00:04 943500 -- (-1181.056) (-1179.749) (-1180.402) [-1180.510] * [-1178.582] (-1179.594) (-1177.819) (-1179.829) -- 0:00:04 944000 -- [-1181.420] (-1178.471) (-1181.656) (-1181.936) * (-1179.657) (-1180.623) [-1178.869] (-1181.513) -- 0:00:04 944500 -- (-1190.409) [-1181.267] (-1185.580) (-1182.730) * (-1179.002) (-1179.258) [-1179.272] (-1179.366) -- 0:00:03 945000 -- (-1184.217) (-1178.740) [-1180.993] (-1181.328) * (-1179.074) (-1178.360) [-1178.688] (-1183.867) -- 0:00:03 Average standard deviation of split frequencies: 0.007537 945500 -- [-1184.146] (-1180.469) (-1183.473) (-1184.542) * (-1179.935) [-1182.233] (-1179.212) (-1183.274) -- 0:00:03 946000 -- (-1179.768) (-1181.019) [-1180.342] (-1180.065) * (-1179.897) (-1178.264) (-1178.150) [-1178.847] -- 0:00:03 946500 -- [-1179.697] (-1178.936) (-1178.984) (-1179.767) * (-1178.172) [-1179.063] (-1178.438) (-1179.390) -- 0:00:03 947000 -- (-1181.359) (-1179.233) (-1178.685) [-1179.360] * (-1183.915) [-1178.804] (-1179.637) (-1179.196) -- 0:00:03 947500 -- (-1187.862) (-1181.240) [-1179.168] (-1178.619) * [-1182.341] (-1182.810) (-1178.309) (-1184.514) -- 0:00:03 948000 -- [-1181.224] (-1178.610) (-1179.515) (-1178.314) * (-1180.875) (-1178.305) (-1181.324) [-1182.128] -- 0:00:03 948500 -- (-1180.962) (-1179.530) (-1179.358) [-1177.884] * (-1179.826) [-1178.566] (-1178.073) (-1181.183) -- 0:00:03 949000 -- (-1180.183) [-1180.883] (-1178.311) (-1178.390) * (-1177.235) [-1179.841] (-1179.261) (-1178.931) -- 0:00:03 949500 -- (-1178.455) (-1183.161) [-1178.108] (-1179.000) * [-1177.446] (-1177.085) (-1178.614) (-1178.098) -- 0:00:03 950000 -- [-1180.586] (-1181.417) (-1179.541) (-1180.134) * (-1180.350) [-1178.706] (-1178.190) (-1180.534) -- 0:00:03 Average standard deviation of split frequencies: 0.007407 950500 -- [-1180.954] (-1180.713) (-1178.249) (-1178.607) * [-1179.722] (-1179.512) (-1178.195) (-1179.393) -- 0:00:03 951000 -- (-1177.615) (-1178.564) [-1179.675] (-1178.329) * (-1178.227) [-1178.837] (-1180.563) (-1177.571) -- 0:00:03 951500 -- (-1178.358) (-1178.142) [-1179.846] (-1179.658) * (-1179.826) [-1179.212] (-1179.318) (-1177.538) -- 0:00:03 952000 -- (-1179.810) (-1180.522) (-1177.846) [-1179.797] * (-1180.869) (-1177.954) [-1178.263] (-1177.474) -- 0:00:03 952500 -- (-1178.534) (-1178.536) (-1179.186) [-1181.534] * (-1177.581) [-1179.481] (-1178.698) (-1178.909) -- 0:00:03 953000 -- [-1178.062] (-1177.816) (-1183.683) (-1178.711) * (-1177.429) (-1178.400) [-1180.394] (-1178.514) -- 0:00:03 953500 -- (-1178.246) [-1177.684] (-1181.183) (-1178.300) * (-1181.167) [-1177.225] (-1181.578) (-1179.937) -- 0:00:03 954000 -- [-1178.655] (-1180.283) (-1179.895) (-1181.867) * (-1178.097) [-1178.863] (-1181.888) (-1178.232) -- 0:00:03 954500 -- (-1179.093) [-1179.172] (-1181.012) (-1178.524) * [-1180.678] (-1181.491) (-1180.329) (-1178.641) -- 0:00:03 955000 -- (-1179.120) (-1181.037) [-1180.406] (-1178.520) * (-1178.780) [-1179.405] (-1181.988) (-1178.147) -- 0:00:03 Average standard deviation of split frequencies: 0.007612 955500 -- (-1179.826) (-1181.682) (-1178.691) [-1179.775] * [-1177.541] (-1179.029) (-1179.094) (-1177.901) -- 0:00:03 956000 -- (-1181.127) [-1189.929] (-1180.538) (-1178.585) * (-1177.165) (-1179.483) [-1179.094] (-1178.482) -- 0:00:03 956500 -- (-1183.127) (-1177.973) (-1178.642) [-1179.066] * (-1178.990) (-1181.517) [-1178.166] (-1180.404) -- 0:00:03 957000 -- (-1181.580) (-1178.792) [-1178.859] (-1180.301) * (-1179.982) (-1179.558) (-1178.629) [-1179.496] -- 0:00:03 957500 -- (-1180.066) (-1181.849) [-1178.459] (-1179.345) * (-1183.658) (-1179.561) (-1183.486) [-1177.537] -- 0:00:03 958000 -- (-1180.353) [-1177.871] (-1182.263) (-1179.656) * (-1180.158) [-1178.850] (-1179.552) (-1177.382) -- 0:00:03 958500 -- (-1180.252) (-1178.409) (-1180.048) [-1182.709] * (-1184.230) [-1177.564] (-1178.280) (-1177.630) -- 0:00:02 959000 -- (-1181.708) [-1182.310] (-1180.143) (-1180.234) * (-1178.271) [-1178.832] (-1178.631) (-1180.758) -- 0:00:02 959500 -- [-1182.070] (-1181.840) (-1182.810) (-1181.954) * (-1180.902) [-1179.661] (-1180.165) (-1178.761) -- 0:00:02 960000 -- (-1179.892) (-1177.378) (-1183.159) [-1180.014] * [-1178.676] (-1180.338) (-1182.895) (-1177.803) -- 0:00:02 Average standard deviation of split frequencies: 0.007637 960500 -- (-1177.307) (-1178.470) (-1181.721) [-1179.098] * (-1180.102) [-1178.196] (-1185.419) (-1183.687) -- 0:00:02 961000 -- [-1177.577] (-1178.314) (-1181.657) (-1177.727) * [-1179.155] (-1178.283) (-1178.064) (-1178.525) -- 0:00:02 961500 -- (-1180.900) [-1178.809] (-1181.072) (-1179.902) * [-1181.297] (-1179.191) (-1178.572) (-1178.624) -- 0:00:02 962000 -- (-1183.096) (-1178.002) (-1179.675) [-1178.013] * (-1179.788) (-1179.951) (-1178.583) [-1181.653] -- 0:00:02 962500 -- (-1178.751) [-1179.131] (-1180.504) (-1179.868) * [-1181.568] (-1177.306) (-1183.269) (-1182.769) -- 0:00:02 963000 -- (-1179.048) (-1179.747) [-1179.505] (-1181.190) * (-1180.996) (-1177.487) (-1188.006) [-1178.285] -- 0:00:02 963500 -- (-1177.889) (-1179.602) (-1178.503) [-1178.651] * (-1179.041) [-1177.946] (-1184.690) (-1180.491) -- 0:00:02 964000 -- (-1180.372) (-1178.068) (-1178.830) [-1179.928] * [-1179.982] (-1182.073) (-1180.697) (-1180.027) -- 0:00:02 964500 -- (-1179.651) [-1178.633] (-1178.713) (-1179.497) * (-1179.597) [-1179.184] (-1178.722) (-1178.812) -- 0:00:02 965000 -- (-1178.551) [-1177.927] (-1178.288) (-1179.292) * (-1182.990) (-1180.895) (-1178.882) [-1177.889] -- 0:00:02 Average standard deviation of split frequencies: 0.007625 965500 -- (-1183.147) [-1179.333] (-1178.015) (-1179.319) * (-1179.917) [-1179.163] (-1178.354) (-1177.365) -- 0:00:02 966000 -- (-1179.197) (-1177.790) [-1177.979] (-1177.534) * [-1180.250] (-1180.013) (-1177.677) (-1180.515) -- 0:00:02 966500 -- (-1178.203) (-1178.432) [-1177.565] (-1179.808) * [-1180.206] (-1181.935) (-1179.571) (-1177.289) -- 0:00:02 967000 -- [-1178.719] (-1178.788) (-1178.048) (-1182.207) * [-1177.529] (-1180.864) (-1180.315) (-1177.906) -- 0:00:02 967500 -- (-1178.567) [-1178.360] (-1185.123) (-1180.502) * [-1181.272] (-1179.998) (-1180.093) (-1178.531) -- 0:00:02 968000 -- [-1178.281] (-1177.577) (-1179.409) (-1183.213) * (-1181.886) [-1178.992] (-1177.759) (-1178.227) -- 0:00:02 968500 -- (-1178.188) (-1178.985) [-1179.367] (-1177.457) * (-1181.703) [-1180.228] (-1179.717) (-1179.444) -- 0:00:02 969000 -- [-1179.925] (-1178.402) (-1178.371) (-1178.328) * (-1178.403) [-1179.291] (-1177.960) (-1183.579) -- 0:00:02 969500 -- (-1183.384) [-1179.301] (-1179.255) (-1180.036) * (-1177.987) [-1179.596] (-1179.380) (-1184.054) -- 0:00:02 970000 -- (-1179.005) (-1178.513) (-1179.361) [-1180.482] * [-1177.677] (-1180.177) (-1179.377) (-1179.572) -- 0:00:02 Average standard deviation of split frequencies: 0.007406 970500 -- (-1179.757) (-1178.239) [-1180.082] (-1179.991) * [-1178.967] (-1178.165) (-1180.417) (-1177.720) -- 0:00:02 971000 -- [-1179.882] (-1178.709) (-1180.825) (-1179.409) * (-1178.858) (-1179.597) [-1179.673] (-1177.277) -- 0:00:02 971500 -- (-1178.264) (-1187.663) [-1178.811] (-1179.139) * [-1179.925] (-1180.007) (-1181.379) (-1177.701) -- 0:00:02 972000 -- (-1179.759) (-1180.681) (-1179.229) [-1177.953] * (-1178.266) [-1178.167] (-1177.968) (-1179.197) -- 0:00:02 972500 -- (-1181.075) (-1181.835) (-1178.524) [-1180.324] * [-1181.546] (-1179.232) (-1182.704) (-1178.460) -- 0:00:01 973000 -- (-1182.257) [-1178.871] (-1177.816) (-1178.328) * [-1178.802] (-1178.301) (-1177.850) (-1180.042) -- 0:00:01 973500 -- [-1181.984] (-1177.168) (-1178.062) (-1178.406) * (-1178.643) (-1178.989) [-1177.747] (-1179.749) -- 0:00:01 974000 -- (-1179.593) (-1179.780) (-1180.497) [-1179.450] * (-1180.024) (-1178.499) [-1181.585] (-1177.284) -- 0:00:01 974500 -- (-1179.122) [-1177.907] (-1180.881) (-1180.413) * (-1180.226) (-1180.838) [-1179.619] (-1180.106) -- 0:00:01 975000 -- [-1178.300] (-1179.576) (-1179.979) (-1180.380) * (-1178.023) (-1179.689) [-1179.788] (-1180.659) -- 0:00:01 Average standard deviation of split frequencies: 0.007336 975500 -- [-1178.221] (-1178.393) (-1181.408) (-1183.613) * (-1181.588) [-1178.751] (-1179.366) (-1184.554) -- 0:00:01 976000 -- (-1181.337) (-1181.319) [-1178.674] (-1182.384) * (-1178.183) (-1178.498) (-1179.287) [-1179.240] -- 0:00:01 976500 -- (-1180.090) [-1181.400] (-1177.985) (-1180.933) * (-1179.490) (-1178.902) (-1179.288) [-1177.774] -- 0:00:01 977000 -- [-1180.922] (-1180.907) (-1179.463) (-1179.317) * (-1178.145) [-1178.951] (-1183.357) (-1182.430) -- 0:00:01 977500 -- [-1180.775] (-1181.664) (-1181.121) (-1179.251) * (-1179.057) (-1178.980) (-1183.810) [-1178.063] -- 0:00:01 978000 -- (-1179.150) (-1181.233) (-1179.034) [-1179.190] * [-1179.418] (-1185.139) (-1178.454) (-1178.661) -- 0:00:01 978500 -- [-1179.493] (-1178.708) (-1178.580) (-1181.001) * (-1180.285) (-1185.434) (-1177.788) [-1178.973] -- 0:00:01 979000 -- (-1178.762) (-1178.811) [-1178.758] (-1180.748) * (-1179.148) [-1181.612] (-1179.597) (-1178.528) -- 0:00:01 979500 -- [-1179.297] (-1179.667) (-1181.034) (-1178.657) * [-1178.702] (-1178.761) (-1178.246) (-1178.507) -- 0:00:01 980000 -- (-1178.516) [-1177.443] (-1180.448) (-1180.577) * (-1178.593) [-1177.648] (-1177.306) (-1177.976) -- 0:00:01 Average standard deviation of split frequencies: 0.007180 980500 -- (-1178.195) (-1179.969) [-1179.226] (-1178.629) * (-1180.893) (-1179.817) (-1177.556) [-1181.909] -- 0:00:01 981000 -- (-1177.645) (-1178.559) (-1183.352) [-1181.067] * (-1177.272) (-1178.156) (-1177.341) [-1178.195] -- 0:00:01 981500 -- (-1178.958) (-1177.525) (-1177.817) [-1178.070] * (-1177.609) [-1180.616] (-1181.321) (-1180.515) -- 0:00:01 982000 -- (-1178.812) (-1178.258) (-1178.274) [-1178.240] * [-1178.890] (-1179.789) (-1180.560) (-1180.775) -- 0:00:01 982500 -- (-1182.228) (-1178.496) (-1181.689) [-1177.824] * [-1178.198] (-1178.990) (-1183.498) (-1179.788) -- 0:00:01 983000 -- [-1179.288] (-1178.834) (-1182.049) (-1178.914) * (-1179.445) (-1179.155) [-1182.704] (-1178.775) -- 0:00:01 983500 -- (-1179.062) (-1179.878) (-1179.906) [-1177.549] * [-1178.083] (-1182.662) (-1182.074) (-1179.475) -- 0:00:01 984000 -- (-1178.978) (-1178.248) (-1177.324) [-1178.580] * (-1178.283) (-1178.843) (-1184.556) [-1177.825] -- 0:00:01 984500 -- [-1177.723] (-1178.105) (-1180.779) (-1181.719) * [-1179.435] (-1178.960) (-1179.114) (-1178.150) -- 0:00:01 985000 -- [-1180.879] (-1177.629) (-1180.172) (-1178.397) * (-1181.957) (-1177.873) [-1177.892] (-1180.208) -- 0:00:01 Average standard deviation of split frequencies: 0.007411 985500 -- (-1178.003) (-1179.314) [-1178.788] (-1177.521) * (-1180.137) (-1178.100) (-1180.712) [-1180.609] -- 0:00:01 986000 -- [-1179.339] (-1180.587) (-1179.462) (-1184.070) * [-1177.742] (-1180.942) (-1180.690) (-1178.078) -- 0:00:01 986500 -- (-1181.524) (-1180.232) [-1179.750] (-1178.513) * (-1178.852) (-1181.322) [-1177.971] (-1178.527) -- 0:00:00 987000 -- (-1180.594) (-1178.115) [-1180.797] (-1178.501) * (-1179.068) (-1179.109) [-1185.065] (-1179.678) -- 0:00:00 987500 -- [-1179.487] (-1182.800) (-1180.545) (-1178.966) * (-1178.296) (-1178.921) [-1180.959] (-1179.789) -- 0:00:00 988000 -- (-1177.877) (-1178.996) [-1182.168] (-1179.835) * (-1179.698) [-1181.074] (-1179.262) (-1180.251) -- 0:00:00 988500 -- [-1177.646] (-1179.502) (-1179.423) (-1178.063) * [-1177.782] (-1179.942) (-1180.948) (-1180.285) -- 0:00:00 989000 -- [-1177.839] (-1182.131) (-1179.440) (-1178.207) * (-1178.215) (-1178.967) [-1179.298] (-1180.488) -- 0:00:00 989500 -- (-1177.274) [-1179.568] (-1177.806) (-1179.417) * [-1179.843] (-1182.776) (-1178.341) (-1179.918) -- 0:00:00 990000 -- (-1178.005) (-1179.721) (-1181.578) [-1180.310] * (-1178.138) (-1180.114) [-1178.756] (-1180.635) -- 0:00:00 Average standard deviation of split frequencies: 0.007614 990500 -- (-1177.799) (-1179.303) (-1178.364) [-1180.234] * (-1178.306) [-1178.526] (-1178.931) (-1180.072) -- 0:00:00 991000 -- (-1183.307) (-1182.304) (-1178.029) [-1178.507] * (-1179.710) (-1179.056) (-1178.639) [-1179.435] -- 0:00:00 991500 -- [-1177.447] (-1180.551) (-1178.177) (-1180.753) * [-1179.615] (-1180.167) (-1178.483) (-1183.669) -- 0:00:00 992000 -- (-1179.714) (-1178.594) [-1178.888] (-1178.773) * [-1177.822] (-1178.638) (-1178.502) (-1179.944) -- 0:00:00 992500 -- (-1181.652) (-1178.819) [-1178.836] (-1178.132) * (-1181.673) (-1183.040) [-1177.970] (-1181.160) -- 0:00:00 993000 -- [-1179.534] (-1181.156) (-1177.799) (-1177.843) * (-1180.245) (-1184.026) [-1183.485] (-1184.055) -- 0:00:00 993500 -- (-1179.441) [-1178.775] (-1177.801) (-1181.018) * (-1178.790) [-1178.880] (-1180.061) (-1181.589) -- 0:00:00 994000 -- (-1178.492) (-1179.342) [-1178.787] (-1178.991) * [-1179.012] (-1180.467) (-1178.890) (-1179.208) -- 0:00:00 994500 -- (-1179.363) (-1179.817) [-1178.596] (-1178.910) * (-1181.410) [-1178.541] (-1178.380) (-1178.820) -- 0:00:00 995000 -- [-1177.856] (-1180.082) (-1181.095) (-1180.261) * [-1179.137] (-1183.768) (-1178.863) (-1179.827) -- 0:00:00 Average standard deviation of split frequencies: 0.007957 995500 -- [-1180.320] (-1179.619) (-1179.883) (-1179.074) * (-1179.421) (-1181.320) [-1181.085] (-1180.836) -- 0:00:00 996000 -- [-1179.508] (-1179.269) (-1177.844) (-1180.771) * (-1184.131) (-1177.867) [-1182.140] (-1183.832) -- 0:00:00 996500 -- (-1179.227) [-1185.033] (-1180.229) (-1180.744) * (-1183.588) [-1177.649] (-1185.438) (-1183.759) -- 0:00:00 997000 -- (-1178.785) (-1181.022) [-1178.683] (-1179.390) * (-1178.449) (-1178.390) (-1180.537) [-1178.579] -- 0:00:00 997500 -- [-1178.917] (-1180.094) (-1177.537) (-1181.006) * (-1178.564) (-1177.663) (-1178.762) [-1177.379] -- 0:00:00 998000 -- (-1179.054) [-1180.095] (-1177.672) (-1178.977) * [-1180.186] (-1179.069) (-1177.414) (-1178.227) -- 0:00:00 998500 -- (-1181.031) [-1179.808] (-1179.346) (-1179.136) * (-1181.865) (-1179.455) [-1177.690] (-1179.864) -- 0:00:00 999000 -- (-1180.837) (-1178.360) (-1182.058) [-1177.998] * (-1177.418) (-1180.773) [-1178.397] (-1178.706) -- 0:00:00 999500 -- (-1180.638) [-1180.783] (-1182.955) (-1178.955) * (-1179.583) (-1178.331) (-1180.726) [-1183.434] -- 0:00:00 1000000 -- (-1179.020) (-1181.943) [-1177.428] (-1180.857) * (-1179.810) [-1177.860] (-1182.097) (-1178.134) -- 0:00:00 Average standard deviation of split frequencies: 0.008215 Analysis completed in 1 mins 12 seconds Analysis used 70.64 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1176.96 Likelihood of best state for "cold" chain of run 2 was -1176.96 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.3 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.7 % ( 18 %) Dirichlet(Pi{all}) 27.9 % ( 21 %) Slider(Pi{all}) 79.0 % ( 48 %) Multiplier(Alpha{1,2}) 77.7 % ( 56 %) Multiplier(Alpha{3}) 18.6 % ( 27 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 86 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 28 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.4 % ( 29 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.5 % ( 55 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.5 % ( 24 %) Dirichlet(Pi{all}) 28.1 % ( 26 %) Slider(Pi{all}) 78.9 % ( 59 %) Multiplier(Alpha{1,2}) 77.9 % ( 56 %) Multiplier(Alpha{3}) 18.4 % ( 22 %) Slider(Pinvar{all}) 98.7 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 73 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.3 % ( 25 %) Multiplier(V{all}) 97.5 % ( 98 %) Nodeslider(V{all}) 30.3 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166166 0.82 0.67 3 | 167497 166300 0.84 4 | 167167 166379 166491 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166746 0.82 0.67 3 | 167233 166542 0.84 4 | 166873 166592 166014 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1178.77 | 1 1 2 | | 1 22 1 2 1 22 | | 1 2 2 2 1 2 | |12 1 2 2 * 2 1 1 1 11 | | 1 21 21 2 2 2 2 * 2 | |2 2 1 2 2 11 1 1 12 1 221| | 1 1 1 2 1 * 2 21 2| | 1 2 * 1 1 1 1 2 | | 22 1 1 1 2 1 1 1 2 | | 222 2 11 1 21 2122 2 2 1 1 | | 2 1 1 22 | | 22 1 | | 1 1 2 1 | | 12 | | 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1180.35 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1178.64 -1185.59 2 -1178.69 -1182.08 -------------------------------------- TOTAL -1178.67 -1184.92 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.894920 0.083277 0.352425 1.473108 0.868756 1370.73 1435.86 1.000 r(A<->C){all} 0.162241 0.020190 0.000024 0.452551 0.120783 219.08 243.26 1.001 r(A<->G){all} 0.151702 0.018117 0.000336 0.428449 0.112129 155.96 204.63 1.000 r(A<->T){all} 0.169382 0.020450 0.000066 0.460797 0.130601 199.58 239.40 1.000 r(C<->G){all} 0.168068 0.019582 0.000043 0.445092 0.134116 220.85 241.69 1.003 r(C<->T){all} 0.182686 0.022926 0.000004 0.481845 0.148375 107.39 191.34 1.000 r(G<->T){all} 0.165920 0.018122 0.000004 0.427007 0.133609 238.67 249.37 1.000 pi(A){all} 0.158843 0.000153 0.132640 0.181802 0.158867 1319.30 1342.32 1.000 pi(C){all} 0.287905 0.000238 0.258293 0.317823 0.287503 1027.57 1142.46 1.000 pi(G){all} 0.308764 0.000249 0.277273 0.339178 0.308835 1156.24 1265.61 1.000 pi(T){all} 0.244487 0.000222 0.216045 0.274771 0.244279 1096.97 1134.20 1.000 alpha{1,2} 0.425112 0.220144 0.000180 1.374521 0.259582 1242.46 1243.19 1.000 alpha{3} 0.461816 0.247694 0.000259 1.448051 0.292578 1234.00 1306.59 1.002 pinvar{all} 0.998264 0.000004 0.994559 1.000000 0.998898 943.49 1021.42 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ...**. 8 -- ....** 9 -- .**... 10 -- ...*.* 11 -- .*.*.. 12 -- .****. 13 -- ..*.*. 14 -- .***.* 15 -- ..*..* 16 -- .**.** 17 -- ..**** 18 -- ..**.. 19 -- .*...* 20 -- .*.*** 21 -- .*..*. 22 -- .**..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 461 0.153564 0.009893 0.146569 0.160560 2 8 447 0.148901 0.006124 0.144570 0.153231 2 9 443 0.147568 0.009893 0.140573 0.154564 2 10 439 0.146236 0.002355 0.144570 0.147901 2 11 435 0.144903 0.005182 0.141239 0.148568 2 12 433 0.144237 0.008951 0.137908 0.150566 2 13 431 0.143571 0.008009 0.137908 0.149234 2 14 431 0.143571 0.010835 0.135909 0.151233 2 15 426 0.141905 0.016017 0.130580 0.153231 2 16 424 0.141239 0.002827 0.139241 0.143238 2 17 424 0.141239 0.003769 0.138574 0.143904 2 18 418 0.139241 0.002827 0.137242 0.141239 2 19 413 0.137575 0.001413 0.136576 0.138574 2 20 401 0.133578 0.006124 0.129247 0.137908 2 21 390 0.129913 0.014133 0.119920 0.139907 2 22 283 0.094270 0.023083 0.077948 0.110593 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099947 0.009614 0.000005 0.294728 0.071518 1.000 2 length{all}[2] 0.099916 0.010285 0.000002 0.304211 0.068693 1.000 2 length{all}[3] 0.098058 0.009542 0.000023 0.298540 0.067988 1.000 2 length{all}[4] 0.099173 0.009749 0.000002 0.293713 0.070132 1.001 2 length{all}[5] 0.098851 0.009530 0.000002 0.297404 0.068596 1.000 2 length{all}[6] 0.098579 0.009425 0.000025 0.291396 0.069942 1.000 2 length{all}[7] 0.094018 0.009387 0.000224 0.263725 0.062037 1.008 2 length{all}[8] 0.098269 0.009607 0.000208 0.278081 0.066695 1.001 2 length{all}[9] 0.106100 0.010677 0.000209 0.305341 0.073357 0.998 2 length{all}[10] 0.102078 0.009489 0.000279 0.297153 0.075685 1.002 2 length{all}[11] 0.100448 0.010234 0.000034 0.286484 0.069297 1.000 2 length{all}[12] 0.094517 0.008644 0.000014 0.270877 0.065789 0.998 2 length{all}[13] 0.097634 0.011211 0.000204 0.268525 0.065281 0.999 2 length{all}[14] 0.098327 0.008238 0.000054 0.271648 0.070158 0.998 2 length{all}[15] 0.100386 0.009693 0.000077 0.302934 0.073255 1.000 2 length{all}[16] 0.097720 0.009478 0.000144 0.295197 0.064829 0.998 2 length{all}[17] 0.102382 0.010607 0.000815 0.327675 0.068847 0.998 2 length{all}[18] 0.097200 0.007889 0.000740 0.284607 0.072903 1.000 2 length{all}[19] 0.102522 0.009078 0.000332 0.286344 0.072624 0.999 2 length{all}[20] 0.102752 0.009677 0.000104 0.291054 0.073826 0.998 2 length{all}[21] 0.098708 0.010456 0.000304 0.306132 0.061424 1.003 2 length{all}[22] 0.106917 0.011477 0.000275 0.333287 0.074453 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008215 Maximum standard deviation of split frequencies = 0.023083 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.008 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |--------------------------------------------------------------------- C2 (2) | |-------------------------------------------------------------------- C3 (3) + |----------------------------------------------------------------------- C4 (4) | |--------------------------------------------------------------------- C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 867 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 56 patterns at 289 / 289 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 56 patterns at 289 / 289 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 54656 bytes for conP 4928 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.066927 0.083083 0.063630 0.055768 0.035280 0.052928 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1220.282774 Iterating by ming2 Initial: fx= 1220.282774 x= 0.06693 0.08308 0.06363 0.05577 0.03528 0.05293 0.30000 1.30000 1 h-m-p 0.0000 0.0001 692.8672 ++ 1160.492695 m 0.0001 13 | 1/8 2 h-m-p 0.0007 0.0033 100.1446 ++ 1151.646780 m 0.0033 24 | 2/8 3 h-m-p 0.0000 0.0000 1688.7690 ++ 1147.878383 m 0.0000 35 | 3/8 4 h-m-p 0.0000 0.0002 412.1443 ++ 1142.321072 m 0.0002 46 | 4/8 5 h-m-p 0.0001 0.0005 227.7386 ++ 1139.925665 m 0.0005 57 | 5/8 6 h-m-p 0.0000 0.0001 429.4853 ++ 1135.860073 m 0.0001 68 | 6/8 7 h-m-p 0.0013 0.0387 28.9057 +++ 1128.908422 m 0.0387 80 | 7/8 8 h-m-p 0.0216 0.1079 0.3546 ++ 1118.581483 m 0.1079 91 | 8/8 9 h-m-p 0.0160 8.0000 0.0000 N 1118.581483 0 0.0160 103 Out.. lnL = -1118.581483 104 lfun, 104 eigenQcodon, 624 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.094303 0.036925 0.064889 0.060088 0.016433 0.099167 0.000100 0.537897 0.499170 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 10.371465 np = 9 lnL0 = -1221.959856 Iterating by ming2 Initial: fx= 1221.959856 x= 0.09430 0.03692 0.06489 0.06009 0.01643 0.09917 0.00011 0.53790 0.49917 1 h-m-p 0.0000 0.0000 669.0697 ++ 1220.959460 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 387.2771 +++ 1194.358344 m 0.0002 27 | 2/9 3 h-m-p 0.0000 0.0002 182.1380 ++ 1171.989916 m 0.0002 39 | 3/9 4 h-m-p 0.0003 0.0024 114.1551 ++ 1130.571322 m 0.0024 51 | 4/9 5 h-m-p 0.0000 0.0000 158271.2355 ++ 1129.645790 m 0.0000 63 | 5/9 6 h-m-p 0.0000 0.0001 874.4668 ++ 1121.461949 m 0.0001 75 | 6/9 7 h-m-p 0.0000 0.0000 63861.5580 ++ 1118.581616 m 0.0000 87 | 7/9 8 h-m-p 1.6000 8.0000 0.0002 ++ 1118.581616 m 8.0000 99 | 7/9 9 h-m-p 0.0094 4.7115 0.2141 ----------Y 1118.581616 0 0.0000 123 | 7/9 10 h-m-p 0.0160 8.0000 0.0003 +++++ 1118.581615 m 8.0000 140 | 7/9 11 h-m-p 0.0050 2.0889 0.4360 ---------Y 1118.581615 0 0.0000 163 | 7/9 12 h-m-p 0.0160 8.0000 0.0004 -------------.. | 7/9 13 h-m-p 0.0160 8.0000 0.0003 +++++ 1118.581614 m 8.0000 205 | 7/9 14 h-m-p 0.0134 5.2454 0.2075 ----------C 1118.581614 0 0.0000 229 | 7/9 15 h-m-p 0.0160 8.0000 0.0005 +++++ 1118.581613 m 8.0000 246 | 7/9 16 h-m-p 0.0116 2.9101 0.3156 ----------Y 1118.581613 0 0.0000 270 | 7/9 17 h-m-p 0.0106 5.3058 0.0162 +++++ 1118.581589 m 5.3058 287 | 8/9 18 h-m-p 0.2984 8.0000 0.0158 ---------------.. | 8/9 19 h-m-p 0.0160 8.0000 0.0004 +++++ 1118.581588 m 8.0000 330 | 8/9 20 h-m-p 0.0116 3.1257 0.2626 ----------Y 1118.581588 0 0.0000 353 | 8/9 21 h-m-p 0.0160 8.0000 0.0000 ----Y 1118.581588 0 0.0000 370 | 8/9 22 h-m-p 0.0160 8.0000 0.0000 +++++ 1118.581588 m 8.0000 386 | 8/9 23 h-m-p 0.0065 3.2552 0.2522 ---------C 1118.581588 0 0.0000 408 | 8/9 24 h-m-p 0.0160 8.0000 0.0002 +++++ 1118.581587 m 8.0000 424 | 8/9 25 h-m-p 0.0063 3.1297 0.2627 ---------Y 1118.581587 0 0.0000 446 | 8/9 26 h-m-p 0.0160 8.0000 0.0001 +++++ 1118.581587 m 8.0000 462 | 8/9 27 h-m-p 0.0063 3.1444 0.2617 ------------.. | 8/9 28 h-m-p 0.0160 8.0000 0.0004 +++++ 1118.581586 m 8.0000 501 | 8/9 29 h-m-p 0.0119 3.1717 0.2604 ----------C 1118.581586 0 0.0000 524 | 8/9 30 h-m-p 0.0160 8.0000 0.0000 +++++ 1118.581586 m 8.0000 540 | 8/9 31 h-m-p 0.0067 3.3711 0.2451 ----------C 1118.581586 0 0.0000 563 | 8/9 32 h-m-p 0.0160 8.0000 0.0000 -----------C 1118.581586 0 0.0000 587 | 8/9 33 h-m-p 0.0160 8.0000 0.0000 -------C 1118.581586 0 0.0000 607 Out.. lnL = -1118.581586 608 lfun, 1824 eigenQcodon, 7296 P(t) Time used: 0:03 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M2:NSpselection reset. 0.068766 0.092022 0.083982 0.105103 0.051266 0.017394 0.000100 1.468650 0.105675 0.485920 2.792062 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 8.733474 np = 11 lnL0 = -1226.708563 Iterating by ming2 Initial: fx= 1226.708563 x= 0.06877 0.09202 0.08398 0.10510 0.05127 0.01739 0.00011 1.46865 0.10568 0.48592 2.79206 1 h-m-p 0.0000 0.0000 583.8095 ++ 1226.111494 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0004 290.5006 +++ 1196.628964 m 0.0004 31 | 2/11 3 h-m-p 0.0001 0.0004 221.9669 ++ 1158.510144 m 0.0004 45 | 3/11 4 h-m-p 0.0007 0.0037 69.1488 ++ 1132.596172 m 0.0037 59 | 4/11 5 h-m-p 0.0000 0.0000 5263.3993 ++ 1123.798325 m 0.0000 73 | 5/11 6 h-m-p 0.0002 0.0008 6.5353 ----------.. | 5/11 7 h-m-p 0.0000 0.0000 475.6772 ++ 1122.794256 m 0.0000 109 | 6/11 8 h-m-p 0.0005 0.1281 3.5436 -----------.. | 6/11 9 h-m-p 0.0000 0.0000 390.0198 ++ 1120.487410 m 0.0000 146 | 7/11 10 h-m-p 0.0160 8.0000 2.6194 -------------.. | 7/11 11 h-m-p 0.0000 0.0000 279.1505 ++ 1118.581666 m 0.0000 185 | 8/11 12 h-m-p 0.0298 8.0000 0.0000 +++++ 1118.581666 m 8.0000 202 | 8/11 13 h-m-p 0.0190 8.0000 0.0071 +++++ 1118.581665 m 8.0000 222 | 8/11 14 h-m-p 0.0015 0.0495 37.5929 +++ 1118.581638 m 0.0495 240 | 9/11 15 h-m-p 0.8874 8.0000 0.8788 +C 1118.581602 0 3.5497 255 | 9/11 16 h-m-p 1.6000 8.0000 0.2535 C 1118.581602 0 1.6000 271 | 9/11 17 h-m-p 1.6000 8.0000 0.0162 Y 1118.581602 0 0.9180 287 | 9/11 18 h-m-p 1.6000 8.0000 0.0002 ++ 1118.581602 m 8.0000 303 | 9/11 19 h-m-p 0.0256 8.0000 0.0758 +++C 1118.581602 0 1.4717 322 | 9/11 20 h-m-p 1.6000 8.0000 0.0034 ++ 1118.581601 m 8.0000 338 | 9/11 21 h-m-p 0.0160 8.0000 3.1933 +++Y 1118.581553 0 1.0240 357 | 9/11 22 h-m-p 1.6000 8.0000 1.1013 ++ 1118.581483 m 8.0000 371 | 9/11 23 h-m-p 1.6000 8.0000 0.0081 ++ 1118.581483 m 8.0000 385 | 9/11 24 h-m-p 1.6000 8.0000 0.0151 ++ 1118.581483 m 8.0000 401 | 9/11 25 h-m-p 0.0253 8.0000 4.7647 ++++Y 1118.581483 0 6.4797 421 | 9/11 26 h-m-p 1.6000 8.0000 0.0000 N 1118.581483 0 1.6000 435 | 9/11 27 h-m-p 0.0160 8.0000 0.0000 Y 1118.581483 0 0.0160 451 Out.. lnL = -1118.581483 452 lfun, 1808 eigenQcodon, 8136 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1118.631505 S = -1118.582495 -0.018930 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:06 did 20 / 56 patterns 0:06 did 30 / 56 patterns 0:06 did 40 / 56 patterns 0:06 did 50 / 56 patterns 0:06 did 56 / 56 patterns 0:06 Time used: 0:06 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.100493 0.051976 0.076190 0.067896 0.101879 0.068548 0.000100 0.659834 1.250318 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 16.212630 np = 9 lnL0 = -1242.706751 Iterating by ming2 Initial: fx= 1242.706751 x= 0.10049 0.05198 0.07619 0.06790 0.10188 0.06855 0.00011 0.65983 1.25032 1 h-m-p 0.0000 0.0000 615.0912 ++ 1242.268502 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0064 102.5605 +++++ 1184.331710 m 0.0064 29 | 2/9 3 h-m-p 0.0001 0.0006 184.2091 ++ 1165.924065 m 0.0006 41 | 3/9 4 h-m-p 0.0000 0.0001 57.6327 ++ 1163.663812 m 0.0001 53 | 4/9 5 h-m-p 0.0004 0.0070 8.7469 ----------.. | 4/9 6 h-m-p 0.0000 0.0001 525.9442 ++ 1132.660973 m 0.0001 85 | 5/9 7 h-m-p 0.0274 8.0000 1.8247 --------------.. | 5/9 8 h-m-p 0.0000 0.0000 468.2751 ++ 1124.748755 m 0.0000 121 | 6/9 9 h-m-p 0.0160 8.0000 1.3977 -------------.. | 6/9 10 h-m-p 0.0000 0.0000 384.8649 ++ 1124.285732 m 0.0000 156 | 7/9 11 h-m-p 0.0160 8.0000 0.8974 -------------.. | 7/9 12 h-m-p 0.0000 0.0001 269.2318 ++ 1118.581483 m 0.0001 193 | 8/9 13 h-m-p 1.6000 8.0000 0.0000 N 1118.581483 0 1.6000 205 | 8/9 14 h-m-p 0.0160 8.0000 0.0000 Y 1118.581483 0 0.0160 218 Out.. lnL = -1118.581483 219 lfun, 2409 eigenQcodon, 13140 P(t) Time used: 0:10 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M8:NSbetaw>1 reset. 0.031205 0.023863 0.037778 0.010743 0.018346 0.086255 0.000100 0.900000 0.531490 1.716131 2.480107 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 13.896026 np = 11 lnL0 = -1172.114877 Iterating by ming2 Initial: fx= 1172.114877 x= 0.03121 0.02386 0.03778 0.01074 0.01835 0.08625 0.00011 0.90000 0.53149 1.71613 2.48011 1 h-m-p 0.0000 0.0000 582.9858 ++ 1171.087413 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 201.8036 +++ 1154.731306 m 0.0005 31 | 2/11 3 h-m-p 0.0000 0.0001 660.9325 ++ 1144.959236 m 0.0001 45 | 3/11 4 h-m-p 0.0005 0.0027 36.9221 ++ 1142.329376 m 0.0027 59 | 4/11 5 h-m-p 0.0000 0.0000 340905.1939 ++ 1139.692709 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 2647.2350 ++ 1137.396683 m 0.0000 87 | 6/11 7 h-m-p 0.0008 0.0039 43.3801 ++ 1118.581651 m 0.0039 101 | 7/11 8 h-m-p 1.6000 8.0000 0.0057 ++ 1118.581645 m 8.0000 115 | 7/11 9 h-m-p 0.0420 0.3484 1.0778 -------------N 1118.581645 0 0.0000 146 | 7/11 10 h-m-p 0.0160 8.0000 0.0029 +++++ 1118.581642 m 8.0000 163 | 7/11 11 h-m-p 0.0305 0.4528 0.7605 -----------Y 1118.581642 0 0.0000 192 | 7/11 12 h-m-p 0.0160 8.0000 0.0000 ------N 1118.581642 0 0.0000 216 | 7/11 13 h-m-p 0.0160 8.0000 0.0000 N 1118.581642 0 0.0040 234 Out.. lnL = -1118.581642 235 lfun, 2820 eigenQcodon, 15510 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1118.609210 S = -1118.578512 -0.013538 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:15 did 20 / 56 patterns 0:15 did 30 / 56 patterns 0:16 did 40 / 56 patterns 0:16 did 50 / 56 patterns 0:16 did 56 / 56 patterns 0:16 Time used: 0:16 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=289 NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL NC_002677_1_NP_302655_1_1527_yrbE1B MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL ************************************************** NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL NC_002677_1_NP_302655_1_1527_yrbE1B SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL ************************************************** NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE NC_002677_1_NP_302655_1_1527_yrbE1B GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE ************************************************** NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY NC_002677_1_NP_302655_1_1527_yrbE1B IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY ************************************************** NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV NC_002677_1_NP_302655_1_1527_yrbE1B GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV ************************************************** NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV NC_002677_1_NP_302655_1_1527_yrbE1B GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV ***************************************
>NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >NC_002677_1_NP_302655_1_1527_yrbE1B ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA >NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 ATGTCGACCGCTGCCGTGTTGCGCGCCCGTTTTCCGCGGGCTGCCGCCAA TCTGAATCGTTATGGCGGAGCCGCGGCCCGCGGAATTGACGACATCGGCC AAATGAGCTGGTTTGGCCTGATCGCCCTCGGAAACATCCCTAATGCCCTG AGCCGCTATCGCAAGGAAACGCTGCGCCTGATAGCCCAGATCGGGATGGG TACTGGTGCAATGGCTGTCGTTGGTGGCACCGCCGCGATCGTCGGGTTCG TCACGCTCTCCGGTAGCTCTCTGGTCGCTATCCAGGGTTTCGCGTCGCTG GGGGCCATCGGTGTCGAGGCGTTTACCGGCTTCTTCGCTGCACTGATCAA CGTGCGCATCGCTGCCCCCGTGATCACAGGTATCGTCATGGCGGCCACCG TCGGCGCCGGCGCCACCGCCGAACTAGGGGCGATGCGTATCAGCGAAGAG ATTGATGCCCTGGAAGTGATGAGCATCAAGTCGATCTCGTTTCTGGTGAC TACTCGGATTTTGGCCGGGCTGGTCGTGATCGTTCCACTTTACGCGGTGG CGATGATCATGGCGTTTCTGTCTCCACATATCATCACGACGGTGCTCTAC GGGCAGTCGAATGGCACGTATGAGCACTACTTCCGAACATTCCTGCGCCC CGATGACGTTTTCTGGTCGTTCTTGGAGGCCGTGATCATCACGGCGGTTG TGATGATCACGCATTGCTACTACGGGTATACCGCCAACGGCGGACCTGTC GGCGTCGGTGAGGCCGTCGGGCGGTCGATGCGTTTCTCTTTGGTGTCAGT GCAGGTTGTAGTTTTATCCGCCACGTTGGCGCTCTACGGCGTAGATCCCA ACTTCGCTTTGACGGTA
>NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >NC_002677_1_NP_302655_1_1527_yrbE1B MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV >NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 MSTAAVLRARFPRAAANLNRYGGAAARGIDDIGQMSWFGLIALGNIPNAL SRYRKETLRLIAQIGMGTGAMAVVGGTAAIVGFVTLSGSSLVAIQGFASL GAIGVEAFTGFFAALINVRIAAPVITGIVMAATVGAGATAELGAMRISEE IDALEVMSIKSISFLVTTRILAGLVVIVPLYAVAMIMAFLSPHIITTVLY GQSNGTYEHYFRTFLRPDDVFWSFLEAVIITAVVMITHCYYGYTANGGPV GVGEAVGRSMRFSLVSVQVVVLSATLALYGVDPNFALTV
#NEXUS [ID: 0082402755] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 NC_002677_1_NP_302655_1_1527_yrbE1B NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 ; end; begin trees; translate 1 NC_011896_1_WP_010908974_1_2770_MLBR_RS13180, 2 NC_002677_1_NP_302655_1_1527_yrbE1B, 3 NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830, 4 NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350, 5 NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250, 6 NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07151785,2:0.06869279,3:0.06798828,4:0.07013175,5:0.06859642,6:0.06994208); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07151785,2:0.06869279,3:0.06798828,4:0.07013175,5:0.06859642,6:0.06994208); end;
Estimated marginal likelihoods for runs sampled in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1178.64 -1185.59 2 -1178.69 -1182.08 -------------------------------------- TOTAL -1178.67 -1184.92 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/12res/yrbE1B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.894920 0.083277 0.352425 1.473108 0.868756 1370.73 1435.86 1.000 r(A<->C){all} 0.162241 0.020190 0.000024 0.452551 0.120783 219.08 243.26 1.001 r(A<->G){all} 0.151702 0.018117 0.000336 0.428449 0.112129 155.96 204.63 1.000 r(A<->T){all} 0.169382 0.020450 0.000066 0.460797 0.130601 199.58 239.40 1.000 r(C<->G){all} 0.168068 0.019582 0.000043 0.445092 0.134116 220.85 241.69 1.003 r(C<->T){all} 0.182686 0.022926 0.000004 0.481845 0.148375 107.39 191.34 1.000 r(G<->T){all} 0.165920 0.018122 0.000004 0.427007 0.133609 238.67 249.37 1.000 pi(A){all} 0.158843 0.000153 0.132640 0.181802 0.158867 1319.30 1342.32 1.000 pi(C){all} 0.287905 0.000238 0.258293 0.317823 0.287503 1027.57 1142.46 1.000 pi(G){all} 0.308764 0.000249 0.277273 0.339178 0.308835 1156.24 1265.61 1.000 pi(T){all} 0.244487 0.000222 0.216045 0.274771 0.244279 1096.97 1134.20 1.000 alpha{1,2} 0.425112 0.220144 0.000180 1.374521 0.259582 1242.46 1243.19 1.000 alpha{3} 0.461816 0.247694 0.000259 1.448051 0.292578 1234.00 1306.59 1.002 pinvar{all} 0.998264 0.000004 0.994559 1.000000 0.998898 943.49 1021.42 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/yrbE1B/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 289 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 5 5 5 5 5 5 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0 TTC 10 10 10 10 10 10 | TCC 2 2 2 2 2 2 | TAC 6 6 6 6 6 6 | TGC 1 1 1 1 1 1 Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 6 6 6 6 6 6 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4 CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7 CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1 CTG 13 13 13 13 13 13 | CCG 1 1 1 1 1 1 | CAG 4 4 4 4 4 4 | CGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 4 4 4 4 4 4 | Ser AGT 0 0 0 0 0 0 ATC 21 21 21 21 21 21 | ACC 6 6 6 6 6 6 | AAC 4 4 4 4 4 4 | AGC 5 5 5 5 5 5 ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0 Met ATG 11 11 11 11 11 11 | ACG 9 9 9 9 9 9 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 6 6 6 | Ala GCT 7 7 7 7 7 7 | Asp GAT 3 3 3 3 3 3 | Gly GGT 8 8 8 8 8 8 GTC 11 11 11 11 11 11 | GCC 22 22 22 22 22 22 | GAC 3 3 3 3 3 3 | GGC 11 11 11 11 11 11 GTA 3 3 3 3 3 3 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 4 4 4 4 4 4 GTG 12 12 12 12 12 12 | GCG 11 11 11 11 11 11 | GAG 5 5 5 5 5 5 | GGG 8 8 8 8 8 8 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908974_1_2770_MLBR_RS13180 position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 #2: NC_002677_1_NP_302655_1_1527_yrbE1B position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 #3: NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830 position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 #4: NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350 position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 #5: NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250 position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 #6: NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590 position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 30 | Ser S TCT 18 | Tyr Y TAT 24 | Cys C TGT 0 TTC 60 | TCC 12 | TAC 36 | TGC 6 Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 36 | TCG 42 | TAG 0 | Trp W TGG 12 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 24 CTC 24 | CCC 18 | CAC 6 | CGC 42 CTA 6 | CCA 12 | Gln Q CAA 6 | CGA 6 CTG 78 | CCG 6 | CAG 24 | CGG 18 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 24 | Ser S AGT 0 ATC 126 | ACC 36 | AAC 24 | AGC 30 ATA 6 | ACA 12 | Lys K AAA 0 | Arg R AGA 0 Met M ATG 66 | ACG 54 | AAG 12 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 36 | Ala A GCT 42 | Asp D GAT 18 | Gly G GGT 48 GTC 66 | GCC 132 | GAC 18 | GGC 66 GTA 18 | GCA 12 | Glu E GAA 24 | GGA 24 GTG 72 | GCG 66 | GAG 30 | GGG 48 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16609 C:0.17301 A:0.24567 G:0.41522 position 2: T:0.37716 C:0.28720 A:0.14879 G:0.18685 position 3: T:0.19031 C:0.40484 A:0.07958 G:0.32526 Average T:0.24452 C:0.28835 A:0.15802 G:0.30911 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1118.581483 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908974_1_2770_MLBR_RS13180: 0.000004, NC_002677_1_NP_302655_1_1527_yrbE1B: 0.000004, NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830: 0.000004, NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350: 0.000004, NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250: 0.000004, NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 0.00010 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 646.2 220.8 0.0001 0.0000 0.0000 0.0 0.0 7..2 0.000 646.2 220.8 0.0001 0.0000 0.0000 0.0 0.0 7..3 0.000 646.2 220.8 0.0001 0.0000 0.0000 0.0 0.0 7..4 0.000 646.2 220.8 0.0001 0.0000 0.0000 0.0 0.0 7..5 0.000 646.2 220.8 0.0001 0.0000 0.0000 0.0 0.0 7..6 0.000 646.2 220.8 0.0001 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1118.581586 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.173873 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908974_1_2770_MLBR_RS13180: 0.000004, NC_002677_1_NP_302655_1_1527_yrbE1B: 0.000004, NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830: 0.000004, NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350: 0.000004, NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250: 0.000004, NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.17387 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 646.2 220.8 0.1739 0.0000 0.0000 0.0 0.0 7..2 0.000 646.2 220.8 0.1739 0.0000 0.0000 0.0 0.0 7..3 0.000 646.2 220.8 0.1739 0.0000 0.0000 0.0 0.0 7..4 0.000 646.2 220.8 0.1739 0.0000 0.0000 0.0 0.0 7..5 0.000 646.2 220.8 0.1739 0.0000 0.0000 0.0 0.0 7..6 0.000 646.2 220.8 0.1739 0.0000 0.0000 0.0 0.0 Time used: 0:03 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1118.581483 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908974_1_2770_MLBR_RS13180: 0.000004, NC_002677_1_NP_302655_1_1527_yrbE1B: 0.000004, NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830: 0.000004, NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350: 0.000004, NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250: 0.000004, NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908974_1_2770_MLBR_RS13180) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:06 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1118.581483 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.266008 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908974_1_2770_MLBR_RS13180: 0.000004, NC_002677_1_NP_302655_1_1527_yrbE1B: 0.000004, NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830: 0.000004, NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350: 0.000004, NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250: 0.000004, NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.26601 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 646.2 220.8 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:10 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1118.581642 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.900846 0.279542 1.734759 2.541155 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908974_1_2770_MLBR_RS13180: 0.000004, NC_002677_1_NP_302655_1_1527_yrbE1B: 0.000004, NZ_LVXE01000045_1_WP_010908974_1_1919_A3216_RS10830: 0.000004, NZ_LYPH01000051_1_WP_010908974_1_1956_A8144_RS09350: 0.000004, NZ_CP029543_1_WP_010908974_1_2799_DIJ64_RS14250: 0.000004, NZ_AP014567_1_WP_010908974_1_2867_JK2ML_RS14590: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.90085 p = 0.27954 q = 1.73476 (p1 = 0.09915) w = 2.54116 MLEs of dN/dS (w) for site classes (K=11) p: 0.09008 0.09008 0.09008 0.09008 0.09008 0.09008 0.09008 0.09008 0.09008 0.09008 0.09915 w: 0.00001 0.00055 0.00346 0.01157 0.02871 0.05993 0.11236 0.19734 0.33712 0.60019 2.54116 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 646.2 220.8 0.3737 0.0000 0.0000 0.0 0.0 7..2 0.000 646.2 220.8 0.3737 0.0000 0.0000 0.0 0.0 7..3 0.000 646.2 220.8 0.3737 0.0000 0.0000 0.0 0.0 7..4 0.000 646.2 220.8 0.3737 0.0000 0.0000 0.0 0.0 7..5 0.000 646.2 220.8 0.3737 0.0000 0.0000 0.0 0.0 7..6 0.000 646.2 220.8 0.3737 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908974_1_2770_MLBR_RS13180) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908974_1_2770_MLBR_RS13180) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Time used: 0:16
Model 1: NearlyNeutral -1118.581586 Model 2: PositiveSelection -1118.581483 Model 0: one-ratio -1118.581483 Model 7: beta -1118.581483 Model 8: beta&w>1 -1118.581642 Model 0 vs 1 2.0600000016202102E-4 Model 2 vs 1 2.0600000016202102E-4 Model 8 vs 7 3.1800000033399556E-4