--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri May 11 08:21:35 WEST 2018 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS1/DNG_N2/NS2B_5/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS1/DNG_N2/NS2B_5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/DNG_N2/NS2B_5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS1/DNG_N2/NS2B_5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3168.78 -3219.36 2 -3174.11 -3238.50 -------------------------------------- TOTAL -3169.47 -3237.81 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS1/DNG_N2/NS2B_5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/DNG_N2/NS2B_5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS1/DNG_N2/NS2B_5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 6.464956 0.286960 5.361593 7.454653 6.450388 756.40 783.53 1.000 r(A<->C){all} 0.091403 0.000252 0.061942 0.122782 0.090629 800.18 842.87 1.000 r(A<->G){all} 0.225273 0.000665 0.174008 0.275537 0.224545 610.43 717.47 1.000 r(A<->T){all} 0.070561 0.000203 0.043853 0.098422 0.070028 825.93 833.53 1.000 r(C<->G){all} 0.061322 0.000230 0.034684 0.093057 0.060055 830.16 838.03 1.000 r(C<->T){all} 0.535033 0.001132 0.471760 0.603235 0.535041 600.58 636.13 1.000 r(G<->T){all} 0.016408 0.000078 0.001770 0.033297 0.015192 848.33 921.91 1.000 pi(A){all} 0.324413 0.000256 0.293237 0.354844 0.324118 878.00 882.38 1.000 pi(C){all} 0.215462 0.000180 0.191008 0.243000 0.215143 948.26 994.41 1.000 pi(G){all} 0.235052 0.000222 0.205547 0.263469 0.234514 831.65 921.38 1.001 pi(T){all} 0.225073 0.000210 0.195362 0.251084 0.224645 738.85 878.96 1.000 alpha{1,2} 0.246740 0.000890 0.189873 0.306422 0.245063 1126.71 1236.53 1.000 alpha{3} 3.306408 0.688366 1.839235 4.939845 3.205929 1393.02 1393.07 1.000 pinvar{all} 0.049240 0.000717 0.000144 0.096613 0.047691 1334.50 1382.26 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2784.604788 Model 2: PositiveSelection -2784.604788 Model 0: one-ratio -2790.901275 Model 3: discrete -2762.313776 Model 7: beta -2763.907279 Model 8: beta&w>1 -2763.907847 Model 0 vs 1 12.59297400000014 Model 2 vs 1 0.0 Model 8 vs 7 0.0011359999998603598
>C1 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADITWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGVFPYSIPATLLVWHTWQKQTQR >C2 SWPLNEGIMAVGVVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C3 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADITWGEEAEQTGVSHMLMITVEDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C4 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWHKQTQR >C5 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C6 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEVEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C7 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C8 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD oTVEKAADVTWoEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C9 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGVFPVSIPITAAAWYLWEVKKQR >C10 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C11 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGVFPVSIPITAAAWYLWEVKKQR >C12 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERATDVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPISIPITAAAWYLWEVKKQR >C13 SWPLNEGVMAIGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETEHILTVLFK TALLIVSGVFPYSIPATLLVWHTWQKQTQR >C14 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPVSIPITAAAWYLWEVKKQR >C15 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERATDVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPVSIPITAAAWYLWEVKKQR >C16 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADITWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C17 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C18 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C19 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERATDVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPISIPITAAAWYLWEVKKQR >C20 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGVFPVSIPITAAAWYLWEVKKQR >C21 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYIWQKKKQR >C22 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C23 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C24 SWPLNEGIMAVGLVSLLGSALLKNDVPLAGPMVAGGLLLAAYVMSGSSAD LSLEKAANVQWDEMADITGSSPIIEVKQDEDGSFSIRDVEETNMITLLVK LALITVSGLYPLAIPVTMTLWYMWQVKTQR >C25 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD oTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIoDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C26 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C27 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C28 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C29 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERAADVRWEEQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPVSIPITAAAWYLWEVKKQR >C30 SWPLNEGIMAVGLVSLLGSALLKNDVPoAGPMVAGGLLLAAYVMSGSSAD LSLEKAANVQWDEMADITGSSPIIEVKQDEDGSFSIRDVEETNMITLLVK LALITVSGLYPLAIPVTMTLWYMWQVKTQR >C31 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C32 SWPLNEGIMAVGLVSLLGSALLKNDVPLAGPMVAGGLLLAAYVMSGSSAD LSLEKAANVQWDEMADITGSSPIIEVKQDEDGSFSIRDVEETNMITLLVK LALITVSGLYPLAIPVTMALWYIWQVKTQR >C33 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTRR >C34 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWLKKKQR >C35 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADITWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C36 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C37 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C38 SWPINEGIMAIGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEQEAEHSGTSHNILVEVQDDGTMRIKDEEKDDTLTILLK ATLLAVSGVYPMSIPATLFVWYFWQKKKQR >C39 SWPLNEAIMAVGMVSILASSLLKNDIPMoGPLVAGoLLTVCYVLTGRSAD LELERATDVKWEDQAEISGSSPIoSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPISIPITAAAWYLWEVKKQR >C40 SWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERATDVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGLFPVSIPITAAAWYLWEVKKQR >C41 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C42 SWPLNEGIMAVGLVSLLGSALLKNDVPLAGPMVAGGLLLAAYVMSGSSAD LSLEKAANVQWDEMADITGSSPIIEVKQDEDGSFSIRDVEETNMITLLVK LALITVSGLYPLAIPITMTLWYMWQVKTQR >C43 SWPLNEAVMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSAD LELERAADVKWEDQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIR TGLLVISGVFPVSIPITAAAWYLWEVKKQR >C44 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C45 SWPLNEGVMAVGLVSMLASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C46 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMRIKDDETENILTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C47 SWPLNEGVMAVGLVSILASSLLRNDVPMAGPLVAGGLLIACYVITGTSAD LTVEKAADVTWEEEAEQTGVSHNLMITVDDDGTMoIKDDETENIoTVLLK TALLIVSGIFPYSIPATLLVWHTWQKQTQR >C48 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C49 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR >C50 SWPLNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSAD LSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLK ATLLAVSGVYPLSIPATLFVWYFWQKKKQR PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 50 SEQUENCES [PROTEIN] Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overa