--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 08 10:32:55 WET 2017
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS1/ZikaADOPSresults/pr/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -941.72 -979.63
2 -941.91 -984.24
--------------------------------------
TOTAL -941.81 -983.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.284241 0.071519 0.819832 1.798684 1.243649 533.06 719.34 1.002
r(A<->C){all} 0.052870 0.000491 0.014432 0.096465 0.050331 651.63 694.94 1.003
r(A<->G){all} 0.182709 0.003526 0.076589 0.300048 0.176887 362.76 393.55 1.000
r(A<->T){all} 0.016335 0.000170 0.000001 0.040703 0.013252 439.45 587.58 1.000
r(C<->G){all} 0.009389 0.000078 0.000003 0.026448 0.006890 744.40 819.67 1.000
r(C<->T){all} 0.716030 0.005516 0.565985 0.850447 0.720446 333.78 384.20 1.001
r(G<->T){all} 0.022666 0.000152 0.002607 0.047007 0.020660 362.65 614.03 1.000
pi(A){all} 0.261494 0.000570 0.216056 0.308144 0.260412 1076.43 1094.60 1.000
pi(C){all} 0.215484 0.000519 0.173447 0.261379 0.215106 513.09 822.57 1.000
pi(G){all} 0.290855 0.000629 0.239508 0.336884 0.291105 1099.73 1165.36 1.000
pi(T){all} 0.232167 0.000543 0.189275 0.279048 0.231033 968.25 1088.37 1.000
alpha{1,2} 0.160170 0.001649 0.091637 0.245280 0.155157 1114.69 1175.96 1.000
alpha{3} 1.655989 0.479472 0.530707 3.007114 1.530987 996.14 998.82 1.001
pinvar{all} 0.210514 0.009180 0.009376 0.365474 0.216725 893.98 927.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -913.421485
Model 2: PositiveSelection -913.421485
Model 0: one-ratio -915.624986
Model 3: discrete -911.681233
Model 7: beta -912.031149
Model 8: beta&w>1 -912.031209
Model 0 vs 1 4.407002000000148
Model 2 vs 1 0.0
Model 8 vs 7 1.199999999244028E-4
>C1
VEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C2
VEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C3
VEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C4
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C5
AEVTRRGSAYHMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C6
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C7
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C8
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSAWVVYVTCHHKKGEARRSRR
>C9
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YERPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
>C10
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCHIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C11
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRR
>C12
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
>C13
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDIDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C14
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEAQRSRR
>C15
AEVTRRGSAYHMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C16
AEVTRRGSTYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C17
AEITRRGSAYYMYLDRSDAGKAISFATNLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C18
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C19
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCQHKKGEARRSRR
>C20
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHRKKGEARRSRR
>C21
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGETRRSRR
>C22
AEITRRGSAYYMYLDRSDAGKAISFVTTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=22, Len=93
C1 VEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C2 VEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQIMDLGHMCDATMS
C3 VEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKCYIQIMDLGHMCDATMS
C4 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C5 AEVTRRGSAYHMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C6 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C7 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYVQIMDLGHMCDATMS
C8 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C9 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C10 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCHIQIMDLGHMCDATMS
C11 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C12 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C13 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C14 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C15 AEVTRRGSAYHMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C16 AEVTRRGSTYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C17 AEITRRGSAYYMYLDRSDAGKAISFATNLGVNKCHVQIMDLGHMCDATMS
C18 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C19 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C20 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C21 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C22 AEITRRGSAYYMYLDRSDAGKAISFVTTLGVNKCHVQIMDLGHMCDATMS
.*:****.:*:*****.***:**** *.:*:***::**************
C1 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C2 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C3 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C4 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C5 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C6 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C7 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C8 YECPMLDEGVEPDDVDCWCNTTSAWVVYVTCHHKKGEARRSRR
C9 YERPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
C10 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C11 YECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRR
C12 YECPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
C13 YECPMLDEGVEPDDIDCWCNTTSTWVVYGTCHHKKGEARRSRR
C14 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEAQRSRR
C15 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C16 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C17 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C18 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C19 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCQHKKGEARRSRR
C20 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHRKKGEARRSRR
C21 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGETRRSRR
C22 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
** ***********:***** **:**** **::****::****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 22 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C20 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C21 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C22 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [42966]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [42966]--->[42966]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 30.089 Mb, Max= 32.270 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C2 VEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQIMDLGHMCDATMS
C3 VEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKCYIQIMDLGHMCDATMS
C4 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C5 AEVTRRGSAYHMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C6 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C7 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYVQIMDLGHMCDATMS
C8 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C9 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C10 AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCHIQIMDLGHMCDATMS
C11 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C12 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C13 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C14 AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C15 AEVTRRGSAYHMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C16 AEVTRRGSTYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
C17 AEITRRGSAYYMYLDRSDAGKAISFATNLGVNKCHVQIMDLGHMCDATMS
C18 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C19 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C20 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C21 AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
C22 AEITRRGSAYYMYLDRSDAGKAISFVTTLGVNKCHVQIMDLGHMCDATMS
.*:****.:*:*****.***:**** *.:*:***::**************
C1 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C2 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C3 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C4 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C5 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C6 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C7 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C8 YECPMLDEGVEPDDVDCWCNTTSAWVVYVTCHHKKGEARRSRR
C9 YERPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
C10 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C11 YECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRR
C12 YECPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
C13 YECPMLDEGVEPDDIDCWCNTTSTWVVYGTCHHKKGEARRSRR
C14 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEAQRSRR
C15 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C16 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C17 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C18 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
C19 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCQHKKGEARRSRR
C20 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHRKKGEARRSRR
C21 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGETRRSRR
C22 YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
** ***********:***** **:**** **::****::****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# SEQ_INDEX C15 14
# SEQ_INDEX C16 15
# SEQ_INDEX C17 16
# SEQ_INDEX C18 17
# SEQ_INDEX C19 18
# SEQ_INDEX C20 19
# SEQ_INDEX C21 20
# SEQ_INDEX C22 21
# PW_SEQ_DISTANCES
BOT 0 1 97.85 C1 C2 97.85
TOP 1 0 97.85 C2 C1 97.85
BOT 0 2 98.92 C1 C3 98.92
TOP 2 0 98.92 C3 C1 98.92
BOT 0 3 98.92 C1 C4 98.92
TOP 3 0 98.92 C4 C1 98.92
BOT 0 4 97.85 C1 C5 97.85
TOP 4 0 97.85 C5 C1 97.85
BOT 0 5 97.85 C1 C6 97.85
TOP 5 0 97.85 C6 C1 97.85
BOT 0 6 97.85 C1 C7 97.85
TOP 6 0 97.85 C7 C1 97.85
BOT 0 7 96.77 C1 C8 96.77
TOP 7 0 96.77 C8 C1 96.77
BOT 0 8 96.77 C1 C9 96.77
TOP 8 0 96.77 C9 C1 96.77
BOT 0 9 97.85 C1 C10 97.85
TOP 9 0 97.85 C10 C1 97.85
BOT 0 10 96.77 C1 C11 96.77
TOP 10 0 96.77 C11 C1 96.77
BOT 0 11 96.77 C1 C12 96.77
TOP 11 0 96.77 C12 C1 96.77
BOT 0 12 96.77 C1 C13 96.77
TOP 12 0 96.77 C13 C1 96.77
BOT 0 13 96.77 C1 C14 96.77
TOP 13 0 96.77 C14 C1 96.77
BOT 0 14 96.77 C1 C15 96.77
TOP 14 0 96.77 C15 C1 96.77
BOT 0 15 97.85 C1 C16 97.85
TOP 15 0 97.85 C16 C1 97.85
BOT 0 16 91.40 C1 C17 91.40
TOP 16 0 91.40 C17 C1 91.40
BOT 0 17 92.47 C1 C18 92.47
TOP 17 0 92.47 C18 C1 92.47
BOT 0 18 91.40 C1 C19 91.40
TOP 18 0 91.40 C19 C1 91.40
BOT 0 19 91.40 C1 C20 91.40
TOP 19 0 91.40 C20 C1 91.40
BOT 0 20 91.40 C1 C21 91.40
TOP 20 0 91.40 C21 C1 91.40
BOT 0 21 92.47 C1 C22 92.47
TOP 21 0 92.47 C22 C1 92.47
BOT 1 2 96.77 C2 C3 96.77
TOP 2 1 96.77 C3 C2 96.77
BOT 1 3 96.77 C2 C4 96.77
TOP 3 1 96.77 C4 C2 96.77
BOT 1 4 95.70 C2 C5 95.70
TOP 4 1 95.70 C5 C2 95.70
BOT 1 5 95.70 C2 C6 95.70
TOP 5 1 95.70 C6 C2 95.70
BOT 1 6 95.70 C2 C7 95.70
TOP 6 1 95.70 C7 C2 95.70
BOT 1 7 94.62 C2 C8 94.62
TOP 7 1 94.62 C8 C2 94.62
BOT 1 8 94.62 C2 C9 94.62
TOP 8 1 94.62 C9 C2 94.62
BOT 1 9 95.70 C2 C10 95.70
TOP 9 1 95.70 C10 C2 95.70
BOT 1 10 94.62 C2 C11 94.62
TOP 10 1 94.62 C11 C2 94.62
BOT 1 11 94.62 C2 C12 94.62
TOP 11 1 94.62 C12 C2 94.62
BOT 1 12 94.62 C2 C13 94.62
TOP 12 1 94.62 C13 C2 94.62
BOT 1 13 94.62 C2 C14 94.62
TOP 13 1 94.62 C14 C2 94.62
BOT 1 14 94.62 C2 C15 94.62
TOP 14 1 94.62 C15 C2 94.62
BOT 1 15 95.70 C2 C16 95.70
TOP 15 1 95.70 C16 C2 95.70
BOT 1 16 89.25 C2 C17 89.25
TOP 16 1 89.25 C17 C2 89.25
BOT 1 17 90.32 C2 C18 90.32
TOP 17 1 90.32 C18 C2 90.32
BOT 1 18 89.25 C2 C19 89.25
TOP 18 1 89.25 C19 C2 89.25
BOT 1 19 89.25 C2 C20 89.25
TOP 19 1 89.25 C20 C2 89.25
BOT 1 20 89.25 C2 C21 89.25
TOP 20 1 89.25 C21 C2 89.25
BOT 1 21 90.32 C2 C22 90.32
TOP 21 1 90.32 C22 C2 90.32
BOT 2 3 97.85 C3 C4 97.85
TOP 3 2 97.85 C4 C3 97.85
BOT 2 4 96.77 C3 C5 96.77
TOP 4 2 96.77 C5 C3 96.77
BOT 2 5 96.77 C3 C6 96.77
TOP 5 2 96.77 C6 C3 96.77
BOT 2 6 96.77 C3 C7 96.77
TOP 6 2 96.77 C7 C3 96.77
BOT 2 7 95.70 C3 C8 95.70
TOP 7 2 95.70 C8 C3 95.70
BOT 2 8 95.70 C3 C9 95.70
TOP 8 2 95.70 C9 C3 95.70
BOT 2 9 96.77 C3 C10 96.77
TOP 9 2 96.77 C10 C3 96.77
BOT 2 10 95.70 C3 C11 95.70
TOP 10 2 95.70 C11 C3 95.70
BOT 2 11 95.70 C3 C12 95.70
TOP 11 2 95.70 C12 C3 95.70
BOT 2 12 95.70 C3 C13 95.70
TOP 12 2 95.70 C13 C3 95.70
BOT 2 13 95.70 C3 C14 95.70
TOP 13 2 95.70 C14 C3 95.70
BOT 2 14 95.70 C3 C15 95.70
TOP 14 2 95.70 C15 C3 95.70
BOT 2 15 96.77 C3 C16 96.77
TOP 15 2 96.77 C16 C3 96.77
BOT 2 16 92.47 C3 C17 92.47
TOP 16 2 92.47 C17 C3 92.47
BOT 2 17 93.55 C3 C18 93.55
TOP 17 2 93.55 C18 C3 93.55
BOT 2 18 92.47 C3 C19 92.47
TOP 18 2 92.47 C19 C3 92.47
BOT 2 19 92.47 C3 C20 92.47
TOP 19 2 92.47 C20 C3 92.47
BOT 2 20 92.47 C3 C21 92.47
TOP 20 2 92.47 C21 C3 92.47
BOT 2 21 93.55 C3 C22 93.55
TOP 21 2 93.55 C22 C3 93.55
BOT 3 4 98.92 C4 C5 98.92
TOP 4 3 98.92 C5 C4 98.92
BOT 3 5 98.92 C4 C6 98.92
TOP 5 3 98.92 C6 C4 98.92
BOT 3 6 98.92 C4 C7 98.92
TOP 6 3 98.92 C7 C4 98.92
BOT 3 7 97.85 C4 C8 97.85
TOP 7 3 97.85 C8 C4 97.85
BOT 3 8 97.85 C4 C9 97.85
TOP 8 3 97.85 C9 C4 97.85
BOT 3 9 98.92 C4 C10 98.92
TOP 9 3 98.92 C10 C4 98.92
BOT 3 10 97.85 C4 C11 97.85
TOP 10 3 97.85 C11 C4 97.85
BOT 3 11 97.85 C4 C12 97.85
TOP 11 3 97.85 C12 C4 97.85
BOT 3 12 97.85 C4 C13 97.85
TOP 12 3 97.85 C13 C4 97.85
BOT 3 13 97.85 C4 C14 97.85
TOP 13 3 97.85 C14 C4 97.85
BOT 3 14 97.85 C4 C15 97.85
TOP 14 3 97.85 C15 C4 97.85
BOT 3 15 98.92 C4 C16 98.92
TOP 15 3 98.92 C16 C4 98.92
BOT 3 16 92.47 C4 C17 92.47
TOP 16 3 92.47 C17 C4 92.47
BOT 3 17 93.55 C4 C18 93.55
TOP 17 3 93.55 C18 C4 93.55
BOT 3 18 92.47 C4 C19 92.47
TOP 18 3 92.47 C19 C4 92.47
BOT 3 19 92.47 C4 C20 92.47
TOP 19 3 92.47 C20 C4 92.47
BOT 3 20 92.47 C4 C21 92.47
TOP 20 3 92.47 C21 C4 92.47
BOT 3 21 93.55 C4 C22 93.55
TOP 21 3 93.55 C22 C4 93.55
BOT 4 5 97.85 C5 C6 97.85
TOP 5 4 97.85 C6 C5 97.85
BOT 4 6 97.85 C5 C7 97.85
TOP 6 4 97.85 C7 C5 97.85
BOT 4 7 96.77 C5 C8 96.77
TOP 7 4 96.77 C8 C5 96.77
BOT 4 8 96.77 C5 C9 96.77
TOP 8 4 96.77 C9 C5 96.77
BOT 4 9 97.85 C5 C10 97.85
TOP 9 4 97.85 C10 C5 97.85
BOT 4 10 96.77 C5 C11 96.77
TOP 10 4 96.77 C11 C5 96.77
BOT 4 11 96.77 C5 C12 96.77
TOP 11 4 96.77 C12 C5 96.77
BOT 4 12 96.77 C5 C13 96.77
TOP 12 4 96.77 C13 C5 96.77
BOT 4 13 96.77 C5 C14 96.77
TOP 13 4 96.77 C14 C5 96.77
BOT 4 14 98.92 C5 C15 98.92
TOP 14 4 98.92 C15 C5 98.92
BOT 4 15 97.85 C5 C16 97.85
TOP 15 4 97.85 C16 C5 97.85
BOT 4 16 91.40 C5 C17 91.40
TOP 16 4 91.40 C17 C5 91.40
BOT 4 17 92.47 C5 C18 92.47
TOP 17 4 92.47 C18 C5 92.47
BOT 4 18 91.40 C5 C19 91.40
TOP 18 4 91.40 C19 C5 91.40
BOT 4 19 91.40 C5 C20 91.40
TOP 19 4 91.40 C20 C5 91.40
BOT 4 20 91.40 C5 C21 91.40
TOP 20 4 91.40 C21 C5 91.40
BOT 4 21 92.47 C5 C22 92.47
TOP 21 4 92.47 C22 C5 92.47
BOT 5 6 97.85 C6 C7 97.85
TOP 6 5 97.85 C7 C6 97.85
BOT 5 7 96.77 C6 C8 96.77
TOP 7 5 96.77 C8 C6 96.77
BOT 5 8 96.77 C6 C9 96.77
TOP 8 5 96.77 C9 C6 96.77
BOT 5 9 97.85 C6 C10 97.85
TOP 9 5 97.85 C10 C6 97.85
BOT 5 10 98.92 C6 C11 98.92
TOP 10 5 98.92 C11 C6 98.92
BOT 5 11 98.92 C6 C12 98.92
TOP 11 5 98.92 C12 C6 98.92
BOT 5 12 98.92 C6 C13 98.92
TOP 12 5 98.92 C13 C6 98.92
BOT 5 13 98.92 C6 C14 98.92
TOP 13 5 98.92 C14 C6 98.92
BOT 5 14 98.92 C6 C15 98.92
TOP 14 5 98.92 C15 C6 98.92
BOT 5 15 97.85 C6 C16 97.85
TOP 15 5 97.85 C16 C6 97.85
BOT 5 16 91.40 C6 C17 91.40
TOP 16 5 91.40 C17 C6 91.40
BOT 5 17 92.47 C6 C18 92.47
TOP 17 5 92.47 C18 C6 92.47
BOT 5 18 91.40 C6 C19 91.40
TOP 18 5 91.40 C19 C6 91.40
BOT 5 19 91.40 C6 C20 91.40
TOP 19 5 91.40 C20 C6 91.40
BOT 5 20 91.40 C6 C21 91.40
TOP 20 5 91.40 C21 C6 91.40
BOT 5 21 92.47 C6 C22 92.47
TOP 21 5 92.47 C22 C6 92.47
BOT 6 7 96.77 C7 C8 96.77
TOP 7 6 96.77 C8 C7 96.77
BOT 6 8 96.77 C7 C9 96.77
TOP 8 6 96.77 C9 C7 96.77
BOT 6 9 97.85 C7 C10 97.85
TOP 9 6 97.85 C10 C7 97.85
BOT 6 10 96.77 C7 C11 96.77
TOP 10 6 96.77 C11 C7 96.77
BOT 6 11 96.77 C7 C12 96.77
TOP 11 6 96.77 C12 C7 96.77
BOT 6 12 96.77 C7 C13 96.77
TOP 12 6 96.77 C13 C7 96.77
BOT 6 13 96.77 C7 C14 96.77
TOP 13 6 96.77 C14 C7 96.77
BOT 6 14 96.77 C7 C15 96.77
TOP 14 6 96.77 C15 C7 96.77
BOT 6 15 97.85 C7 C16 97.85
TOP 15 6 97.85 C16 C7 97.85
BOT 6 16 93.55 C7 C17 93.55
TOP 16 6 93.55 C17 C7 93.55
BOT 6 17 94.62 C7 C18 94.62
TOP 17 6 94.62 C18 C7 94.62
BOT 6 18 93.55 C7 C19 93.55
TOP 18 6 93.55 C19 C7 93.55
BOT 6 19 93.55 C7 C20 93.55
TOP 19 6 93.55 C20 C7 93.55
BOT 6 20 93.55 C7 C21 93.55
TOP 20 6 93.55 C21 C7 93.55
BOT 6 21 94.62 C7 C22 94.62
TOP 21 6 94.62 C22 C7 94.62
BOT 7 8 97.85 C8 C9 97.85
TOP 8 7 97.85 C9 C8 97.85
BOT 7 9 96.77 C8 C10 96.77
TOP 9 7 96.77 C10 C8 96.77
BOT 7 10 95.70 C8 C11 95.70
TOP 10 7 95.70 C11 C8 95.70
BOT 7 11 97.85 C8 C12 97.85
TOP 11 7 97.85 C12 C8 97.85
BOT 7 12 95.70 C8 C13 95.70
TOP 12 7 95.70 C13 C8 95.70
BOT 7 13 95.70 C8 C14 95.70
TOP 13 7 95.70 C14 C8 95.70
BOT 7 14 95.70 C8 C15 95.70
TOP 14 7 95.70 C15 C8 95.70
BOT 7 15 96.77 C8 C16 96.77
TOP 15 7 96.77 C16 C8 96.77
BOT 7 16 90.32 C8 C17 90.32
TOP 16 7 90.32 C17 C8 90.32
BOT 7 17 91.40 C8 C18 91.40
TOP 17 7 91.40 C18 C8 91.40
BOT 7 18 90.32 C8 C19 90.32
TOP 18 7 90.32 C19 C8 90.32
BOT 7 19 90.32 C8 C20 90.32
TOP 19 7 90.32 C20 C8 90.32
BOT 7 20 90.32 C8 C21 90.32
TOP 20 7 90.32 C21 C8 90.32
BOT 7 21 91.40 C8 C22 91.40
TOP 21 7 91.40 C22 C8 91.40
BOT 8 9 96.77 C9 C10 96.77
TOP 9 8 96.77 C10 C9 96.77
BOT 8 10 95.70 C9 C11 95.70
TOP 10 8 95.70 C11 C9 95.70
BOT 8 11 97.85 C9 C12 97.85
TOP 11 8 97.85 C12 C9 97.85
BOT 8 12 95.70 C9 C13 95.70
TOP 12 8 95.70 C13 C9 95.70
BOT 8 13 95.70 C9 C14 95.70
TOP 13 8 95.70 C14 C9 95.70
BOT 8 14 95.70 C9 C15 95.70
TOP 14 8 95.70 C15 C9 95.70
BOT 8 15 96.77 C9 C16 96.77
TOP 15 8 96.77 C16 C9 96.77
BOT 8 16 90.32 C9 C17 90.32
TOP 16 8 90.32 C17 C9 90.32
BOT 8 17 91.40 C9 C18 91.40
TOP 17 8 91.40 C18 C9 91.40
BOT 8 18 90.32 C9 C19 90.32
TOP 18 8 90.32 C19 C9 90.32
BOT 8 19 90.32 C9 C20 90.32
TOP 19 8 90.32 C20 C9 90.32
BOT 8 20 90.32 C9 C21 90.32
TOP 20 8 90.32 C21 C9 90.32
BOT 8 21 91.40 C9 C22 91.40
TOP 21 8 91.40 C22 C9 91.40
BOT 9 10 96.77 C10 C11 96.77
TOP 10 9 96.77 C11 C10 96.77
BOT 9 11 96.77 C10 C12 96.77
TOP 11 9 96.77 C12 C10 96.77
BOT 9 12 96.77 C10 C13 96.77
TOP 12 9 96.77 C13 C10 96.77
BOT 9 13 96.77 C10 C14 96.77
TOP 13 9 96.77 C14 C10 96.77
BOT 9 14 96.77 C10 C15 96.77
TOP 14 9 96.77 C15 C10 96.77
BOT 9 15 97.85 C10 C16 97.85
TOP 15 9 97.85 C16 C10 97.85
BOT 9 16 93.55 C10 C17 93.55
TOP 16 9 93.55 C17 C10 93.55
BOT 9 17 94.62 C10 C18 94.62
TOP 17 9 94.62 C18 C10 94.62
BOT 9 18 93.55 C10 C19 93.55
TOP 18 9 93.55 C19 C10 93.55
BOT 9 19 93.55 C10 C20 93.55
TOP 19 9 93.55 C20 C10 93.55
BOT 9 20 93.55 C10 C21 93.55
TOP 20 9 93.55 C21 C10 93.55
BOT 9 21 94.62 C10 C22 94.62
TOP 21 9 94.62 C22 C10 94.62
BOT 10 11 97.85 C11 C12 97.85
TOP 11 10 97.85 C12 C11 97.85
BOT 10 12 97.85 C11 C13 97.85
TOP 12 10 97.85 C13 C11 97.85
BOT 10 13 97.85 C11 C14 97.85
TOP 13 10 97.85 C14 C11 97.85
BOT 10 14 97.85 C11 C15 97.85
TOP 14 10 97.85 C15 C11 97.85
BOT 10 15 96.77 C11 C16 96.77
TOP 15 10 96.77 C16 C11 96.77
BOT 10 16 90.32 C11 C17 90.32
TOP 16 10 90.32 C17 C11 90.32
BOT 10 17 91.40 C11 C18 91.40
TOP 17 10 91.40 C18 C11 91.40
BOT 10 18 90.32 C11 C19 90.32
TOP 18 10 90.32 C19 C11 90.32
BOT 10 19 90.32 C11 C20 90.32
TOP 19 10 90.32 C20 C11 90.32
BOT 10 20 90.32 C11 C21 90.32
TOP 20 10 90.32 C21 C11 90.32
BOT 10 21 91.40 C11 C22 91.40
TOP 21 10 91.40 C22 C11 91.40
BOT 11 12 97.85 C12 C13 97.85
TOP 12 11 97.85 C13 C12 97.85
BOT 11 13 97.85 C12 C14 97.85
TOP 13 11 97.85 C14 C12 97.85
BOT 11 14 97.85 C12 C15 97.85
TOP 14 11 97.85 C15 C12 97.85
BOT 11 15 96.77 C12 C16 96.77
TOP 15 11 96.77 C16 C12 96.77
BOT 11 16 90.32 C12 C17 90.32
TOP 16 11 90.32 C17 C12 90.32
BOT 11 17 91.40 C12 C18 91.40
TOP 17 11 91.40 C18 C12 91.40
BOT 11 18 90.32 C12 C19 90.32
TOP 18 11 90.32 C19 C12 90.32
BOT 11 19 90.32 C12 C20 90.32
TOP 19 11 90.32 C20 C12 90.32
BOT 11 20 90.32 C12 C21 90.32
TOP 20 11 90.32 C21 C12 90.32
BOT 11 21 91.40 C12 C22 91.40
TOP 21 11 91.40 C22 C12 91.40
BOT 12 13 97.85 C13 C14 97.85
TOP 13 12 97.85 C14 C13 97.85
BOT 12 14 97.85 C13 C15 97.85
TOP 14 12 97.85 C15 C13 97.85
BOT 12 15 96.77 C13 C16 96.77
TOP 15 12 96.77 C16 C13 96.77
BOT 12 16 90.32 C13 C17 90.32
TOP 16 12 90.32 C17 C13 90.32
BOT 12 17 91.40 C13 C18 91.40
TOP 17 12 91.40 C18 C13 91.40
BOT 12 18 90.32 C13 C19 90.32
TOP 18 12 90.32 C19 C13 90.32
BOT 12 19 90.32 C13 C20 90.32
TOP 19 12 90.32 C20 C13 90.32
BOT 12 20 90.32 C13 C21 90.32
TOP 20 12 90.32 C21 C13 90.32
BOT 12 21 91.40 C13 C22 91.40
TOP 21 12 91.40 C22 C13 91.40
BOT 13 14 97.85 C14 C15 97.85
TOP 14 13 97.85 C15 C14 97.85
BOT 13 15 96.77 C14 C16 96.77
TOP 15 13 96.77 C16 C14 96.77
BOT 13 16 90.32 C14 C17 90.32
TOP 16 13 90.32 C17 C14 90.32
BOT 13 17 91.40 C14 C18 91.40
TOP 17 13 91.40 C18 C14 91.40
BOT 13 18 90.32 C14 C19 90.32
TOP 18 13 90.32 C19 C14 90.32
BOT 13 19 90.32 C14 C20 90.32
TOP 19 13 90.32 C20 C14 90.32
BOT 13 20 90.32 C14 C21 90.32
TOP 20 13 90.32 C21 C14 90.32
BOT 13 21 91.40 C14 C22 91.40
TOP 21 13 91.40 C22 C14 91.40
BOT 14 15 96.77 C15 C16 96.77
TOP 15 14 96.77 C16 C15 96.77
BOT 14 16 90.32 C15 C17 90.32
TOP 16 14 90.32 C17 C15 90.32
BOT 14 17 91.40 C15 C18 91.40
TOP 17 14 91.40 C18 C15 91.40
BOT 14 18 90.32 C15 C19 90.32
TOP 18 14 90.32 C19 C15 90.32
BOT 14 19 90.32 C15 C20 90.32
TOP 19 14 90.32 C20 C15 90.32
BOT 14 20 90.32 C15 C21 90.32
TOP 20 14 90.32 C21 C15 90.32
BOT 14 21 91.40 C15 C22 91.40
TOP 21 14 91.40 C22 C15 91.40
BOT 15 16 91.40 C16 C17 91.40
TOP 16 15 91.40 C17 C16 91.40
BOT 15 17 92.47 C16 C18 92.47
TOP 17 15 92.47 C18 C16 92.47
BOT 15 18 91.40 C16 C19 91.40
TOP 18 15 91.40 C19 C16 91.40
BOT 15 19 91.40 C16 C20 91.40
TOP 19 15 91.40 C20 C16 91.40
BOT 15 20 91.40 C16 C21 91.40
TOP 20 15 91.40 C21 C16 91.40
BOT 15 21 92.47 C16 C22 92.47
TOP 21 15 92.47 C22 C16 92.47
BOT 16 17 98.92 C17 C18 98.92
TOP 17 16 98.92 C18 C17 98.92
BOT 16 18 97.85 C17 C19 97.85
TOP 18 16 97.85 C19 C17 97.85
BOT 16 19 97.85 C17 C20 97.85
TOP 19 16 97.85 C20 C17 97.85
BOT 16 20 97.85 C17 C21 97.85
TOP 20 16 97.85 C21 C17 97.85
BOT 16 21 97.85 C17 C22 97.85
TOP 21 16 97.85 C22 C17 97.85
BOT 17 18 98.92 C18 C19 98.92
TOP 18 17 98.92 C19 C18 98.92
BOT 17 19 98.92 C18 C20 98.92
TOP 19 17 98.92 C20 C18 98.92
BOT 17 20 98.92 C18 C21 98.92
TOP 20 17 98.92 C21 C18 98.92
BOT 17 21 98.92 C18 C22 98.92
TOP 21 17 98.92 C22 C18 98.92
BOT 18 19 97.85 C19 C20 97.85
TOP 19 18 97.85 C20 C19 97.85
BOT 18 20 97.85 C19 C21 97.85
TOP 20 18 97.85 C21 C19 97.85
BOT 18 21 97.85 C19 C22 97.85
TOP 21 18 97.85 C22 C19 97.85
BOT 19 20 97.85 C20 C21 97.85
TOP 20 19 97.85 C21 C20 97.85
BOT 19 21 97.85 C20 C22 97.85
TOP 21 19 97.85 C22 C20 97.85
BOT 20 21 97.85 C21 C22 97.85
TOP 21 20 97.85 C22 C21 97.85
AVG 0 C1 * 95.85
AVG 1 C2 * 93.80
AVG 2 C3 * 95.44
AVG 3 C4 * 96.67
AVG 4 C5 * 95.75
AVG 5 C6 * 96.16
AVG 6 C7 * 96.26
AVG 7 C8 * 94.83
AVG 8 C9 * 94.83
AVG 9 C10 * 96.26
AVG 10 C11 * 95.14
AVG 11 C12 * 95.34
AVG 12 C13 * 95.14
AVG 13 C14 * 95.14
AVG 14 C15 * 95.24
AVG 15 C16 * 95.65
AVG 16 C17 * 92.83
AVG 17 C18 * 93.86
AVG 18 C19 * 92.83
AVG 19 C20 * 92.83
AVG 20 C21 * 92.83
AVG 21 C22 * 93.65
TOT TOT * 94.83
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
C2 GTGGAGGTCACTAGACGTGGGAATGCATACTATATGTACTTGGACAGAAG
C3 GTGGAGGTCACCAGACGTGGGAGTGCATACTATATGTACTTAGACAGAAG
C4 GCGGAGGTCACTAGACGTGGGAGTGCGTACTATATGTACTTGGACAGAAG
C5 GCGGAGGTCACTAGACGTGGGAGTGCATATCATATGTACTTGGACAGAAG
C6 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGATAGAAA
C7 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
C8 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
C9 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
C10 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
C11 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAA
C12 GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAA
C13 GCGGAGGTCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGAAA
C14 GCGGAGGTCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGAAA
C15 GCGGAGGTCACTAGACGTGGGAGTGCATACCACATGTACTTGGACAGAAA
C16 GCGGAGGTCACTAGACGTGGGAGTACATACTATATGTACTTGGACAGAAG
C17 GCGGAGATTACCAGACGTGGAAGTGCATACTACATGTACTTGGACAGGAG
C18 GCCGAGATCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGGAG
C19 GCCGAGATCACCAGACGTGGGAGTGCATACTACATGTACTTGGACAGGAG
C20 GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGATAGGAG
C21 GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGATAGGAG
C22 GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGACAGGAG
* ***.* ** ***** **.*.*.*.** * ********.** **.*.
C1 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C2 CGATGCTGGGGAGGCCATATCTTTTCCAACCACAATGGGGATGAATAAGT
C3 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGGTGAATAAGT
C4 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C5 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C6 CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
C7 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C8 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C9 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C10 CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
C11 CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
C12 CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
C13 CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
C14 CGATGCTGGGGAGGCCATATCTTTCCCAACCACATTGGGGATGAATAAGT
C15 CGATGCTGGGGAGGCCATATCTTTCCCAACCACATTGGGGATGAATAAGT
C16 CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
C17 CGATGCTGGGAAGGCCATCTCCTTTGCTACCAACTTGGGAGTTAACAAAT
C18 CGATGCTGGTAAGGCCATTTCTTTTGCCACCACATTGGGGGTGAACAAAT
C19 CGATGCTGGTAAGGCCATTTCTTTTGCTACCACATTGGGGGTGAACAAAT
C20 CGATGCCGGGAAGGCCATTTCGTTTGCTACCACATTGGGAGTGAACAAGT
C21 CGATGCCGGGAAGGCCATTTCGTTTGCTACCACATTGGGAGTGAACAAGT
C22 CGATGCTGGTAAGGCCATTTCTTTCGTTACCACACTGGGGGTGAACAAAT
****** ** .******* ** ** ****.. ****..* ** **.*
C1 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C2 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C3 GTTACATACAGATCATGGATCTTGGACACATGTGTGATGCCACAATGAGC
C4 GTTATATACAGATCATGGATCTTGGACATATGTGTGATGCCACCATGAGC
C5 GTTACATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C6 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C7 GTTATGTACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C8 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C9 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C10 GTCATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C11 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C12 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C13 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C14 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C15 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C16 GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
C17 GCCATGTACAGATCATGGATCTCGGGCACATGTGTGACGCCACCATGAGT
C18 GCCATGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
C19 GCCATGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
C20 GCCACGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
C21 GCCACGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
C22 GCCATGTGCAGATCATGGACCTCGGGCATATGTGTGACGCCACCATGAGT
* * .*.*********** ** **.** ******** *****.*****
C1 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C2 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C3 TATGAATGCCCTATGTTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C4 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C5 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C6 TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
C7 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C8 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C9 TATGAACGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C10 TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
C11 TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
C12 TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
C13 TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACATCGATTG
C14 TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
C15 TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
C16 TATGAATGCCCTATGCTAGATGAGGGGGTAGAACCAGATGACGTCGATTG
C17 TATGAGTGCCCTATGTTGGACGAGGGAGTGGAACCAGATGATGTCGATTG
C18 TATGAGTGCCCCATGCTAGACGAGGGAGTGGAGCCAGATGACGTCGATTG
C19 TATGAGTGCCCCATGCTGGACGAGGGAGTGGAGCCAGATGACGTCGATTG
C20 TATGAGTGCCCTATGCTGGATGAGGGAGTGGAACCAGATGATGTCGATTG
C21 TATGAGTGCCCTATGCTGGATGAGGGAGTGGAACCAGATGATGTCGATTG
C22 TATGAGTGCCCCATGCTGGACGAGGGAGTGGAGCCAGATGACGTCGATTG
*****. **** *** *.** *****.**.**.******** .*******
C1 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C2 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA
C3 CTGGTGCAACACGACATCGACTTGGGTTGTGTACGGAACCTGCCATCACA
C4 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C5 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA
C6 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C7 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C8 TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGTAACCTGCCATCACA
C9 TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGGAACCTGCCATCACA
C10 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGTCATCACA
C11 TTGGTGCAACATGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C12 TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGGAACCTGCCATCACA
C13 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C14 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C15 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
C16 TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA
C17 CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCACA
C18 CTGGTGCAACACGACATCGACTTGGGTTGTGTACGGAACCTGTCATCATA
C19 CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCAACATA
C20 CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCGCA
C21 CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCACA
C22 CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCATA
********** ***.**..*************** ****** ** *. *
C1 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C2 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C3 AAAAAGGTGAGGCACGGAGATCTAGAAGA
C4 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C5 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C6 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C7 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C8 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C9 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C10 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C11 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C12 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C13 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C14 AAAAAGGTGAAGCACAGAGATCTAGAAGA
C15 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C16 AAAAAGGTGAAGCACGGAGATCTAGAAGA
C17 AAAAAGGTGAAGCACGGCGATCTAGAAGA
C18 AAAAAGGTGAAGCACGACGATCCAGAAGA
C19 AAAAAGGTGAAGCACGACGATCCAGAAGA
C20 AAAAAGGTGAGGCACGGCGATCTAGAAGA
C21 AAAAAGGTGAGACACGGCGATCTAGAAGA
C22 AAAAAGGTGAAGCACGACGATCCAGAAGA
**********..***...**** ******
>C1
GTGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C2
GTGGAGGTCACTAGACGTGGGAATGCATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACAATGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C3
GTGGAGGTCACCAGACGTGGGAGTGCATACTATATGTACTTAGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGGTGAATAAGT
GTTACATACAGATCATGGATCTTGGACACATGTGTGATGCCACAATGAGC
TATGAATGCCCTATGTTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
CTGGTGCAACACGACATCGACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAGGCACGGAGATCTAGAAGA
>C4
GCGGAGGTCACTAGACGTGGGAGTGCGTACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACATATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C5
GCGGAGGTCACTAGACGTGGGAGTGCATATCATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTTACATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C6
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGATAGAAA
CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C7
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTTATGTACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C8
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGTAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C9
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAACGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C10
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT
GTCATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGTCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C11
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAA
CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
TTGGTGCAACATGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C12
GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAA
CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C13
GCGGAGGTCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGAAA
CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACATCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C14
GCGGAGGTCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGAAA
CGATGCTGGGGAGGCCATATCTTTCCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACAGAGATCTAGAAGA
>C15
GCGGAGGTCACTAGACGTGGGAGTGCATACCACATGTACTTGGACAGAAA
CGATGCTGGGGAGGCCATATCTTTCCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C16
GCGGAGGTCACTAGACGTGGGAGTACATACTATATGTACTTGGACAGAAG
CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT
GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC
TATGAATGCCCTATGCTAGATGAGGGGGTAGAACCAGATGACGTCGATTG
TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA
AAAAAGGTGAAGCACGGAGATCTAGAAGA
>C17
GCGGAGATTACCAGACGTGGAAGTGCATACTACATGTACTTGGACAGGAG
CGATGCTGGGAAGGCCATCTCCTTTGCTACCAACTTGGGAGTTAACAAAT
GCCATGTACAGATCATGGATCTCGGGCACATGTGTGACGCCACCATGAGT
TATGAGTGCCCTATGTTGGACGAGGGAGTGGAACCAGATGATGTCGATTG
CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCACA
AAAAAGGTGAAGCACGGCGATCTAGAAGA
>C18
GCCGAGATCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGGAG
CGATGCTGGTAAGGCCATTTCTTTTGCCACCACATTGGGGGTGAACAAAT
GCCATGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
TATGAGTGCCCCATGCTAGACGAGGGAGTGGAGCCAGATGACGTCGATTG
CTGGTGCAACACGACATCGACTTGGGTTGTGTACGGAACCTGTCATCATA
AAAAAGGTGAAGCACGACGATCCAGAAGA
>C19
GCCGAGATCACCAGACGTGGGAGTGCATACTACATGTACTTGGACAGGAG
CGATGCTGGTAAGGCCATTTCTTTTGCTACCACATTGGGGGTGAACAAAT
GCCATGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
TATGAGTGCCCCATGCTGGACGAGGGAGTGGAGCCAGATGACGTCGATTG
CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCAACATA
AAAAAGGTGAAGCACGACGATCCAGAAGA
>C20
GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGATAGGAG
CGATGCCGGGAAGGCCATTTCGTTTGCTACCACATTGGGAGTGAACAAGT
GCCACGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
TATGAGTGCCCTATGCTGGATGAGGGAGTGGAACCAGATGATGTCGATTG
CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCGCA
AAAAAGGTGAGGCACGGCGATCTAGAAGA
>C21
GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGATAGGAG
CGATGCCGGGAAGGCCATTTCGTTTGCTACCACATTGGGAGTGAACAAGT
GCCACGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT
TATGAGTGCCCTATGCTGGATGAGGGAGTGGAACCAGATGATGTCGATTG
CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCACA
AAAAAGGTGAGACACGGCGATCTAGAAGA
>C22
GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGACAGGAG
CGATGCTGGTAAGGCCATTTCTTTCGTTACCACACTGGGGGTGAACAAAT
GCCATGTGCAGATCATGGACCTCGGGCATATGTGTGACGCCACCATGAGT
TATGAGTGCCCCATGCTGGACGAGGGAGTGGAGCCAGATGACGTCGATTG
CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCATA
AAAAAGGTGAAGCACGACGATCCAGAAGA
>C1
VEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C2
VEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C3
VEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C4
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C5
AEVTRRGSAYHMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C6
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C7
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C8
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSAWVVYVTCHHKKGEARRSRR
>C9
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YERPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
>C10
AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCHIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C11
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRR
>C12
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
>C13
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDIDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C14
AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEAQRSRR
>C15
AEVTRRGSAYHMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C16
AEVTRRGSTYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C17
AEITRRGSAYYMYLDRSDAGKAISFATNLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C18
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
>C19
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCQHKKGEARRSRR
>C20
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHRKKGEARRSRR
>C21
AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGETRRSRR
>C22
AEITRRGSAYYMYLDRSDAGKAISFVTTLGVNKCHVQIMDLGHMCDATMS
YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 22 taxa and 279 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Taxon 13 -> C13
Taxon 14 -> C14
Taxon 15 -> C15
Taxon 16 -> C16
Taxon 17 -> C17
Taxon 18 -> C18
Taxon 19 -> C19
Taxon 20 -> C20
Taxon 21 -> C21
Taxon 22 -> C22
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1510136084
Setting output file names to "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 479903788
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8231515016
Seed = 959525523
Swapseed = 1510136084
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 18 unique site patterns
Division 2 has 13 unique site patterns
Division 3 has 47 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2233.289534 -- -32.750545
Chain 2 -- -2238.084759 -- -32.750545
Chain 3 -- -2214.034406 -- -32.750545
Chain 4 -- -2272.596033 -- -32.750545
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2180.492574 -- -32.750545
Chain 2 -- -2227.855376 -- -32.750545
Chain 3 -- -2264.156764 -- -32.750545
Chain 4 -- -2152.878237 -- -32.750545
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2233.290] (-2238.085) (-2214.034) (-2272.596) * [-2180.493] (-2227.855) (-2264.157) (-2152.878)
500 -- (-1136.946) (-1120.383) [-1088.562] (-1107.881) * (-1056.580) (-1090.614) (-1093.310) [-1055.124] -- 0:00:00
1000 -- [-1037.125] (-1058.933) (-1036.032) (-1043.687) * (-1024.942) (-1040.352) [-1002.451] (-1031.754) -- 0:16:39
1500 -- [-982.897] (-1023.201) (-1038.163) (-1020.826) * (-1037.209) (-1010.191) [-1002.382] (-1012.210) -- 0:11:05
2000 -- [-980.980] (-1000.495) (-1010.182) (-1008.933) * (-1038.632) (-998.360) [-987.594] (-1013.490) -- 0:08:19
2500 -- [-970.582] (-984.664) (-1012.210) (-1000.028) * (-1008.886) [-992.022] (-1008.882) (-1003.675) -- 0:06:39
3000 -- [-959.353] (-967.704) (-1009.643) (-995.314) * (-1009.943) [-968.064] (-1004.757) (-1010.490) -- 0:05:32
3500 -- (-964.346) [-976.105] (-982.625) (-1009.417) * (-991.585) (-970.150) (-983.874) [-987.569] -- 0:09:29
4000 -- [-971.832] (-966.308) (-1009.985) (-976.980) * (-981.160) [-962.550] (-974.847) (-984.162) -- 0:08:18
4500 -- (-971.820) [-953.929] (-991.417) (-975.846) * (-997.045) [-970.771] (-986.428) (-979.824) -- 0:07:22
5000 -- (-962.152) [-962.333] (-988.019) (-952.191) * (-1003.163) [-965.014] (-990.934) (-982.943) -- 0:06:38
Average standard deviation of split frequencies: 0.104003
5500 -- [-962.942] (-959.099) (-979.716) (-966.930) * (-993.035) [-961.390] (-966.391) (-991.088) -- 0:09:02
6000 -- [-950.645] (-981.644) (-984.789) (-963.135) * (-981.555) [-952.718] (-981.488) (-969.683) -- 0:08:17
6500 -- (-970.514) [-969.562] (-963.243) (-963.453) * (-988.996) [-950.335] (-974.951) (-978.085) -- 0:07:38
7000 -- (-983.536) [-974.455] (-970.549) (-965.573) * (-984.079) (-950.873) [-966.860] (-970.373) -- 0:07:05
7500 -- (-976.122) [-956.995] (-978.197) (-960.650) * (-996.595) (-964.903) [-951.730] (-967.874) -- 0:06:37
8000 -- (-972.801) (-972.171) (-975.486) [-953.743] * (-996.981) (-976.112) [-947.537] (-956.242) -- 0:08:16
8500 -- (-997.115) (-966.742) [-964.802] (-989.001) * (-971.657) (-988.836) [-959.484] (-961.403) -- 0:07:46
9000 -- (-988.809) (-995.132) [-958.413] (-964.009) * (-970.502) (-985.398) [-948.919] (-963.081) -- 0:07:20
9500 -- [-971.552] (-981.104) (-963.603) (-972.536) * (-973.723) (-966.587) (-960.755) [-960.185] -- 0:06:57
10000 -- (-976.963) (-973.481) [-964.815] (-976.449) * (-963.496) (-988.917) (-965.707) [-959.112] -- 0:08:15
Average standard deviation of split frequencies: 0.104070
10500 -- (-967.220) (-967.456) [-948.586] (-983.814) * (-962.891) (-986.874) [-964.145] (-970.967) -- 0:07:51
11000 -- (-954.846) (-984.383) [-946.642] (-984.085) * (-949.438) (-980.224) (-977.731) [-955.633] -- 0:07:29
11500 -- (-972.353) [-951.550] (-958.335) (-982.360) * (-972.655) (-954.999) (-962.428) [-964.716] -- 0:07:09
12000 -- (-971.428) [-947.022] (-948.005) (-959.165) * (-963.299) [-956.122] (-964.089) (-984.123) -- 0:08:14
12500 -- (-975.080) (-963.099) (-963.364) [-968.808] * (-979.753) [-958.212] (-968.773) (-970.291) -- 0:07:54
13000 -- (-972.067) (-982.794) (-975.791) [-963.444] * (-972.052) [-950.361] (-971.435) (-984.550) -- 0:07:35
13500 -- (-988.126) [-962.088] (-994.014) (-958.573) * (-967.941) [-959.212] (-961.359) (-986.037) -- 0:07:18
14000 -- (-982.185) [-953.474] (-977.782) (-960.814) * (-994.011) (-969.046) [-955.825] (-973.282) -- 0:07:02
14500 -- (-966.413) [-955.887] (-994.188) (-968.081) * (-976.474) (-976.558) [-948.589] (-967.996) -- 0:07:55
15000 -- (-981.642) [-956.770] (-984.431) (-963.402) * [-970.878] (-983.335) (-956.089) (-991.519) -- 0:07:39
Average standard deviation of split frequencies: 0.076257
15500 -- (-972.912) [-950.258] (-997.838) (-964.692) * [-953.174] (-961.108) (-990.256) (-961.276) -- 0:07:24
16000 -- (-964.622) [-959.119] (-981.727) (-962.896) * (-960.377) (-962.030) (-972.534) [-966.344] -- 0:07:10
16500 -- (-963.946) (-981.487) (-979.202) [-964.862] * (-965.388) [-956.183] (-966.454) (-962.027) -- 0:07:56
17000 -- [-951.118] (-972.150) (-958.297) (-977.885) * (-979.746) (-963.265) [-952.764] (-976.978) -- 0:07:42
17500 -- (-969.018) [-951.641] (-986.096) (-954.170) * (-971.285) (-984.499) [-955.718] (-989.364) -- 0:07:29
18000 -- (-980.115) (-961.901) (-957.861) [-945.462] * (-968.444) (-979.434) [-959.120] (-983.468) -- 0:07:16
18500 -- (-982.214) (-983.947) (-967.604) [-944.221] * (-974.527) (-973.661) [-958.199] (-990.252) -- 0:07:04
19000 -- (-978.692) (-951.217) (-968.766) [-960.846] * [-946.383] (-970.617) (-963.316) (-982.426) -- 0:07:44
19500 -- (-976.344) [-947.778] (-989.673) (-966.985) * (-965.535) [-955.034] (-978.594) (-972.469) -- 0:07:32
20000 -- (-973.093) [-958.267] (-977.261) (-966.039) * (-988.575) (-972.316) [-964.214] (-984.533) -- 0:07:21
Average standard deviation of split frequencies: 0.057317
20500 -- (-974.241) [-949.723] (-970.681) (-960.983) * (-970.841) (-967.286) [-956.333] (-985.000) -- 0:07:10
21000 -- (-975.600) (-967.906) [-946.036] (-966.631) * [-955.055] (-961.688) (-963.118) (-991.418) -- 0:07:46
21500 -- (-968.038) [-952.567] (-963.671) (-981.061) * [-953.669] (-959.549) (-973.524) (-966.221) -- 0:07:35
22000 -- (-982.151) [-957.624] (-974.715) (-970.311) * [-943.402] (-954.638) (-979.955) (-964.271) -- 0:07:24
22500 -- (-958.944) (-971.765) (-961.001) [-953.493] * [-953.615] (-955.023) (-984.771) (-977.698) -- 0:07:14
23000 -- (-986.672) (-963.067) (-969.762) [-953.902] * [-949.489] (-973.581) (-970.709) (-963.590) -- 0:07:47
23500 -- (-994.854) [-969.912] (-971.375) (-973.466) * (-956.179) (-986.947) [-954.730] (-967.317) -- 0:07:37
24000 -- (-979.387) (-967.923) [-963.449] (-971.948) * [-943.594] (-973.212) (-975.610) (-968.038) -- 0:07:27
24500 -- (-968.230) (-966.697) (-958.228) [-966.015] * [-947.785] (-974.395) (-969.033) (-971.780) -- 0:07:17
25000 -- (-989.505) [-955.929] (-970.237) (-984.104) * [-963.364] (-955.503) (-974.774) (-968.368) -- 0:07:09
Average standard deviation of split frequencies: 0.054393
25500 -- (-1015.710) (-954.874) (-969.240) [-945.948] * [-953.724] (-965.394) (-975.174) (-972.833) -- 0:07:38
26000 -- (-991.006) [-958.354] (-973.018) (-964.591) * (-964.198) (-960.318) (-971.108) [-966.026] -- 0:07:29
26500 -- (-1009.383) (-968.372) (-959.385) [-953.518] * (-957.945) [-950.230] (-977.294) (-977.175) -- 0:07:20
27000 -- (-1004.375) [-966.356] (-975.451) (-973.746) * (-956.667) (-964.307) (-958.448) [-957.802] -- 0:07:12
27500 -- (-968.303) (-976.737) (-968.812) [-970.116] * (-954.762) (-979.628) (-991.254) [-956.206] -- 0:07:39
28000 -- (-988.557) (-957.288) (-972.630) [-974.249] * [-950.817] (-974.415) (-984.246) (-977.765) -- 0:07:31
28500 -- (-977.472) (-974.019) [-952.765] (-966.234) * (-955.833) (-967.297) (-989.127) [-968.637] -- 0:07:23
29000 -- (-963.879) (-972.036) [-943.856] (-958.050) * [-960.335] (-982.493) (-1012.493) (-951.122) -- 0:07:15
29500 -- [-962.317] (-985.647) (-960.711) (-968.263) * (-978.641) (-964.025) (-986.844) [-955.350] -- 0:07:07
30000 -- (-988.485) [-959.592] (-962.334) (-969.174) * (-967.505) (-964.405) (-977.947) [-957.137] -- 0:07:32
Average standard deviation of split frequencies: 0.052908
30500 -- (-954.872) (-973.781) [-963.537] (-982.057) * [-957.741] (-983.007) (-975.399) (-971.736) -- 0:07:25
31000 -- (-965.244) (-967.027) [-954.018] (-991.998) * (-962.445) (-979.744) (-958.522) [-956.968] -- 0:07:17
31500 -- (-967.137) (-969.826) [-942.063] (-981.296) * (-970.971) (-955.585) (-967.340) [-953.962] -- 0:07:10
32000 -- (-964.454) (-980.955) [-950.141] (-970.461) * (-970.879) (-965.695) (-961.237) [-939.072] -- 0:07:33
32500 -- (-955.644) (-1008.853) [-955.709] (-961.408) * (-985.884) (-972.878) (-961.926) [-944.779] -- 0:07:26
33000 -- (-967.968) (-978.873) [-961.198] (-970.521) * (-975.750) (-975.325) [-941.088] (-955.610) -- 0:07:19
33500 -- [-962.919] (-972.590) (-968.494) (-997.743) * (-971.923) (-969.986) [-958.482] (-966.277) -- 0:07:12
34000 -- [-951.162] (-973.915) (-947.725) (-1002.892) * (-955.085) (-948.128) [-964.764] (-963.126) -- 0:07:06
34500 -- [-947.214] (-994.524) (-971.037) (-977.721) * (-973.477) [-947.913] (-975.749) (-970.849) -- 0:07:27
35000 -- (-957.016) [-953.597] (-990.357) (-980.176) * (-963.351) [-940.904] (-964.589) (-956.121) -- 0:07:21
Average standard deviation of split frequencies: 0.046158
35500 -- (-978.804) [-962.423] (-971.326) (-990.525) * [-963.489] (-955.009) (-974.160) (-981.576) -- 0:07:14
36000 -- [-957.037] (-983.941) (-962.014) (-986.789) * (-957.157) [-956.951] (-988.254) (-969.496) -- 0:07:08
36500 -- [-944.015] (-981.343) (-970.676) (-984.242) * [-952.923] (-961.395) (-970.198) (-985.673) -- 0:07:28
37000 -- [-964.636] (-984.999) (-961.091) (-982.815) * (-968.493) (-980.883) (-981.381) [-969.522] -- 0:07:22
37500 -- (-982.184) (-976.106) [-950.970] (-974.299) * [-946.774] (-972.610) (-990.434) (-976.695) -- 0:07:16
38000 -- (-963.900) (-983.587) [-954.003] (-980.178) * (-961.440) [-963.368] (-987.800) (-982.818) -- 0:07:10
38500 -- (-954.449) (-979.321) [-951.246] (-979.746) * (-965.233) [-958.803] (-990.508) (-979.283) -- 0:07:04
39000 -- [-965.982] (-967.910) (-967.391) (-999.103) * (-966.399) (-966.094) (-982.644) [-956.100] -- 0:07:23
39500 -- [-963.452] (-969.142) (-962.218) (-977.173) * (-957.985) (-974.530) (-991.986) [-968.105] -- 0:07:17
40000 -- [-960.771] (-954.099) (-949.937) (-980.499) * (-971.114) [-959.155] (-984.889) (-969.723) -- 0:07:12
Average standard deviation of split frequencies: 0.042608
40500 -- [-957.312] (-972.872) (-948.661) (-970.399) * (-975.753) (-968.056) (-963.859) [-968.249] -- 0:07:06
41000 -- (-959.054) (-976.320) [-946.185] (-980.658) * (-966.652) (-973.870) (-982.309) [-957.987] -- 0:07:24
41500 -- (-953.908) [-949.154] (-965.502) (-969.099) * [-970.360] (-975.345) (-995.314) (-972.414) -- 0:07:18
42000 -- (-965.571) (-978.677) [-950.366] (-971.585) * (-982.842) [-960.015] (-966.387) (-962.745) -- 0:07:13
42500 -- (-965.376) (-997.521) [-963.142] (-953.431) * (-981.203) (-956.895) (-974.642) [-958.878] -- 0:07:08
43000 -- (-986.198) (-989.250) [-946.787] (-962.979) * (-977.552) [-943.829] (-971.994) (-951.765) -- 0:07:25
43500 -- (-961.098) (-996.753) [-942.540] (-972.225) * [-964.721] (-966.905) (-967.794) (-986.586) -- 0:07:19
44000 -- (-963.142) (-984.604) (-957.396) [-964.251] * [-960.544] (-965.968) (-969.656) (-983.381) -- 0:07:14
44500 -- (-970.311) (-1005.406) [-971.454] (-983.028) * [-955.412] (-980.334) (-961.727) (-970.850) -- 0:07:09
45000 -- [-950.341] (-982.945) (-970.736) (-983.388) * [-964.407] (-985.362) (-962.640) (-990.198) -- 0:07:04
Average standard deviation of split frequencies: 0.037838
45500 -- [-957.504] (-962.470) (-971.718) (-982.266) * (-963.326) [-949.117] (-972.434) (-970.609) -- 0:07:20
46000 -- [-954.680] (-985.656) (-947.328) (-981.871) * (-978.117) [-962.582] (-966.079) (-976.349) -- 0:07:15
46500 -- (-965.612) (-980.368) (-965.058) [-966.564] * (-978.089) (-985.379) [-958.225] (-990.322) -- 0:07:10
47000 -- (-966.812) (-982.826) (-956.276) [-954.053] * (-987.141) [-962.479] (-965.830) (-985.530) -- 0:07:05
47500 -- (-975.472) (-990.377) [-962.477] (-964.216) * (-975.068) (-962.830) [-961.095] (-979.638) -- 0:07:21
48000 -- [-974.657] (-981.570) (-949.304) (-977.262) * (-968.436) (-953.258) (-976.987) [-966.265] -- 0:07:16
48500 -- (-962.259) (-997.373) [-953.491] (-969.058) * (-980.773) [-955.055] (-972.156) (-969.180) -- 0:07:11
49000 -- (-987.474) (-979.731) [-954.974] (-958.141) * (-961.749) (-985.084) (-959.045) [-954.452] -- 0:07:06
49500 -- (-988.009) (-980.506) [-963.245] (-960.131) * [-961.321] (-970.368) (-970.943) (-985.115) -- 0:07:21
50000 -- (-977.029) (-977.876) [-964.451] (-960.130) * (-958.879) (-963.401) [-961.614] (-967.022) -- 0:07:17
Average standard deviation of split frequencies: 0.037932
50500 -- (-973.256) (-971.132) (-979.229) [-954.420] * [-958.607] (-986.135) (-985.290) (-964.331) -- 0:07:12
51000 -- (-961.703) (-977.881) (-994.308) [-968.992] * (-965.008) (-972.071) [-964.396] (-969.369) -- 0:07:07
51500 -- (-978.627) [-966.997] (-977.424) (-969.546) * (-965.750) (-983.651) [-968.754] (-971.948) -- 0:07:03
52000 -- (-984.092) (-962.598) [-953.963] (-948.876) * (-974.689) (-982.969) [-953.030] (-961.930) -- 0:07:17
52500 -- (-967.567) (-964.491) (-969.510) [-944.600] * (-964.070) (-993.146) [-955.596] (-985.720) -- 0:07:13
53000 -- [-955.324] (-989.784) (-976.975) (-958.247) * (-959.821) (-969.695) [-938.686] (-977.650) -- 0:07:08
53500 -- (-964.421) (-980.641) [-956.536] (-951.370) * [-964.491] (-960.123) (-972.051) (-973.321) -- 0:07:04
54000 -- (-964.035) (-962.763) [-962.398] (-955.576) * (-969.071) (-962.713) [-958.961] (-973.685) -- 0:07:17
54500 -- (-982.641) [-957.487] (-960.629) (-961.380) * (-977.617) [-956.509] (-951.225) (-991.291) -- 0:07:13
55000 -- (-960.054) (-980.692) (-962.566) [-952.045] * (-983.641) (-960.792) [-958.162] (-964.402) -- 0:07:09
Average standard deviation of split frequencies: 0.036010
55500 -- (-981.341) (-961.945) (-990.190) [-955.451] * [-975.882] (-991.564) (-959.978) (-975.030) -- 0:07:05
56000 -- (-979.173) (-960.042) (-954.186) [-945.957] * (-950.409) (-989.972) [-970.572] (-976.478) -- 0:07:18
56500 -- (-969.122) (-974.175) (-960.096) [-957.277] * (-954.998) (-985.592) (-964.510) [-958.481] -- 0:07:14
57000 -- (-974.623) (-971.551) (-959.130) [-953.890] * [-962.454] (-970.724) (-955.240) (-984.429) -- 0:07:10
57500 -- (-980.837) (-968.116) [-966.391] (-956.446) * (-981.557) (-952.723) [-954.943] (-982.362) -- 0:07:06
58000 -- (-977.761) (-967.346) [-957.387] (-966.841) * (-967.008) [-955.494] (-953.702) (-987.701) -- 0:07:02
58500 -- (-974.433) (-953.245) [-951.627] (-975.978) * (-1004.863) [-958.651] (-965.635) (-970.009) -- 0:07:14
59000 -- [-953.168] (-948.821) (-970.436) (-955.681) * (-988.780) (-961.058) [-958.998] (-971.086) -- 0:07:10
59500 -- (-987.082) [-940.574] (-968.348) (-998.987) * (-965.401) [-957.616] (-971.599) (-975.166) -- 0:07:06
60000 -- (-973.252) [-953.721] (-959.959) (-996.232) * (-984.442) (-960.667) (-962.035) [-950.268] -- 0:07:03
Average standard deviation of split frequencies: 0.038408
60500 -- (-974.042) [-959.029] (-970.697) (-980.600) * (-968.360) [-950.265] (-972.399) (-957.466) -- 0:07:14
61000 -- (-968.410) (-991.886) (-970.448) [-971.048] * (-961.890) (-981.423) (-966.468) [-958.376] -- 0:07:11
61500 -- (-976.367) [-962.705] (-971.862) (-965.588) * [-959.156] (-985.313) (-976.387) (-973.296) -- 0:07:07
62000 -- (-976.960) (-967.879) (-975.454) [-972.823] * (-971.693) (-992.811) [-952.535] (-973.450) -- 0:07:03
62500 -- (-976.500) (-988.679) [-965.051] (-973.456) * (-975.849) [-959.300] (-961.298) (-988.973) -- 0:07:15
63000 -- (-979.871) (-975.555) [-965.131] (-964.615) * (-967.471) (-970.574) [-950.500] (-974.906) -- 0:07:11
63500 -- (-972.748) (-964.692) [-943.194] (-969.877) * (-967.892) [-967.982] (-961.602) (-989.083) -- 0:07:07
64000 -- (-997.724) (-966.754) [-956.856] (-953.180) * (-970.665) [-964.817] (-978.440) (-982.980) -- 0:07:04
64500 -- (-988.898) (-991.050) (-974.346) [-950.956] * (-960.231) (-979.964) [-956.920] (-992.035) -- 0:07:00
65000 -- (-980.863) (-982.747) (-985.061) [-957.844] * [-966.098] (-974.346) (-964.876) (-964.321) -- 0:07:11
Average standard deviation of split frequencies: 0.032141
65500 -- (-981.930) (-961.739) (-981.721) [-951.650] * (-960.861) [-952.584] (-974.545) (-975.610) -- 0:07:08
66000 -- (-967.491) (-973.348) (-977.650) [-955.451] * (-964.953) (-993.189) (-953.548) [-962.729] -- 0:07:04
66500 -- (-976.065) (-983.014) (-967.226) [-956.857] * (-986.420) (-987.507) [-948.453] (-966.067) -- 0:07:01
67000 -- (-987.812) (-972.210) (-969.697) [-962.600] * (-988.481) (-979.138) [-954.687] (-966.086) -- 0:06:57
67500 -- (-978.647) (-956.072) (-984.811) [-955.145] * (-977.195) (-968.794) [-958.100] (-962.037) -- 0:07:08
68000 -- (-978.081) (-972.139) (-961.705) [-958.884] * (-998.783) [-949.576] (-956.428) (-963.753) -- 0:07:04
68500 -- (-971.744) (-992.752) [-979.817] (-964.880) * (-983.211) [-957.969] (-982.819) (-963.591) -- 0:07:01
69000 -- [-958.707] (-989.286) (-979.349) (-965.004) * (-975.400) (-966.733) (-976.572) [-950.495] -- 0:06:58
69500 -- (-955.021) (-980.335) (-984.711) [-952.134] * (-982.118) [-953.783] (-948.708) (-972.226) -- 0:07:08
70000 -- (-960.037) (-970.902) (-984.400) [-952.928] * (-973.834) [-954.544] (-984.849) (-960.263) -- 0:07:05
Average standard deviation of split frequencies: 0.034977
70500 -- (-969.801) (-967.452) (-985.867) [-963.159] * (-980.533) [-953.953] (-993.639) (-970.778) -- 0:07:01
71000 -- (-977.800) [-958.837] (-986.702) (-971.303) * (-1004.545) (-961.968) (-984.235) [-956.750] -- 0:06:58
71500 -- (-965.722) [-951.808] (-995.447) (-968.357) * (-996.044) (-970.555) (-981.581) [-949.382] -- 0:06:55
72000 -- [-953.680] (-956.245) (-988.437) (-962.424) * (-996.253) (-963.422) (-973.477) [-948.565] -- 0:07:05
72500 -- (-966.121) (-957.957) (-987.460) [-952.555] * (-987.508) (-963.467) (-964.059) [-970.393] -- 0:07:02
73000 -- (-978.261) (-953.043) (-971.804) [-970.713] * (-982.637) (-966.381) (-970.812) [-958.612] -- 0:06:59
73500 -- (-975.776) (-976.836) [-953.996] (-984.297) * (-972.903) [-953.251] (-970.210) (-963.734) -- 0:06:55
74000 -- [-957.972] (-966.635) (-974.201) (-969.920) * (-984.836) [-947.997] (-969.400) (-967.653) -- 0:06:52
74500 -- (-957.433) [-959.685] (-973.214) (-972.061) * (-993.397) [-965.373] (-969.929) (-971.172) -- 0:07:02
75000 -- (-978.293) (-952.731) (-977.937) [-965.610] * (-984.126) [-952.348] (-970.202) (-975.110) -- 0:06:59
Average standard deviation of split frequencies: 0.036881
75500 -- (-967.176) (-965.820) (-966.239) [-945.801] * (-1003.982) [-949.893] (-962.207) (-965.308) -- 0:06:56
76000 -- [-946.986] (-979.490) (-965.397) (-964.167) * (-994.526) (-968.500) (-974.883) [-955.968] -- 0:06:53
76500 -- (-975.031) (-983.412) [-963.533] (-957.326) * (-982.586) (-966.882) (-964.629) [-950.268] -- 0:07:02
77000 -- [-963.134] (-989.487) (-979.072) (-961.513) * (-968.688) [-961.270] (-977.893) (-964.952) -- 0:06:59
77500 -- (-972.786) (-985.976) (-961.711) [-958.292] * (-964.269) (-953.865) (-973.032) [-966.428] -- 0:06:56
78000 -- [-938.902] (-992.118) (-962.876) (-952.191) * [-961.962] (-976.105) (-986.423) (-952.229) -- 0:06:53
78500 -- (-953.826) (-971.755) (-971.015) [-961.170] * [-968.450] (-974.706) (-971.683) (-963.015) -- 0:07:02
79000 -- (-975.754) (-980.207) (-975.105) [-958.997] * (-975.218) (-980.440) (-1002.573) [-948.862] -- 0:06:59
79500 -- (-952.587) (-974.121) (-987.140) [-957.924] * (-967.062) (-980.570) (-989.753) [-959.663] -- 0:06:56
80000 -- (-960.429) (-964.318) (-971.030) [-954.367] * (-989.383) (-967.179) (-973.137) [-959.631] -- 0:06:54
Average standard deviation of split frequencies: 0.038472
80500 -- (-958.727) (-959.348) (-955.720) [-955.194] * [-969.733] (-974.376) (-965.670) (-983.967) -- 0:06:51
81000 -- [-954.177] (-951.081) (-966.634) (-966.869) * (-954.788) (-983.112) (-989.186) [-962.608] -- 0:06:59
81500 -- (-962.004) (-967.307) [-946.997] (-975.827) * (-986.503) (-984.882) (-983.864) [-942.492] -- 0:06:56
82000 -- (-991.961) (-972.280) [-954.892] (-969.114) * (-979.536) [-970.119] (-998.614) (-961.976) -- 0:06:54
82500 -- (-964.674) [-961.215] (-972.340) (-972.597) * (-967.040) (-985.445) (-1017.825) [-964.853] -- 0:06:51
83000 -- (-969.222) [-961.966] (-981.588) (-977.590) * [-961.344] (-994.300) (-997.611) (-957.785) -- 0:06:59
83500 -- (-959.756) (-990.119) (-980.361) [-963.034] * [-946.561] (-968.601) (-970.274) (-978.009) -- 0:06:57
84000 -- (-989.211) (-994.448) (-970.097) [-965.420] * (-966.037) (-963.427) (-975.873) [-958.133] -- 0:06:54
84500 -- (-979.528) (-969.315) [-958.648] (-980.342) * (-978.194) [-960.338] (-965.405) (-969.248) -- 0:06:51
85000 -- (-969.328) (-959.577) [-961.361] (-966.844) * (-1001.527) (-960.521) [-969.296] (-975.308) -- 0:06:49
Average standard deviation of split frequencies: 0.036639
85500 -- (-987.612) [-953.267] (-955.061) (-968.973) * (-979.300) [-949.807] (-966.133) (-971.333) -- 0:06:57
86000 -- (-976.977) (-966.894) (-989.447) [-959.760] * [-956.911] (-960.616) (-963.802) (-971.661) -- 0:06:54
86500 -- (-973.163) (-956.246) (-989.407) [-951.996] * (-970.630) (-962.754) [-965.357] (-988.284) -- 0:06:51
87000 -- (-966.878) (-978.124) (-968.698) [-960.074] * (-972.589) (-972.504) [-957.688] (-972.277) -- 0:06:49
87500 -- (-978.845) [-968.979] (-982.927) (-960.810) * (-983.409) [-957.871] (-974.394) (-970.843) -- 0:06:57
88000 -- (-971.590) (-965.793) [-974.433] (-970.806) * (-968.817) [-957.692] (-970.758) (-971.795) -- 0:06:54
88500 -- (-979.782) (-962.993) (-959.957) [-957.829] * (-970.803) (-970.555) [-950.905] (-971.896) -- 0:06:51
89000 -- (-983.139) (-974.154) [-950.679] (-955.148) * [-965.303] (-990.493) (-957.117) (-959.827) -- 0:06:49
89500 -- (-969.767) (-970.321) (-961.262) [-956.159] * [-962.933] (-984.402) (-966.394) (-953.767) -- 0:06:46
90000 -- (-969.873) (-969.010) [-966.658] (-958.437) * (-959.803) (-949.269) (-978.579) [-948.172] -- 0:06:54
Average standard deviation of split frequencies: 0.038037
90500 -- [-964.366] (-961.287) (-973.439) (-972.065) * (-972.728) (-954.231) (-980.738) [-956.686] -- 0:06:52
91000 -- (-968.113) (-957.820) (-977.167) [-962.126] * (-968.998) [-955.747] (-964.251) (-966.756) -- 0:06:49
91500 -- (-985.220) (-976.855) [-949.507] (-987.044) * (-971.174) [-947.715] (-953.129) (-982.224) -- 0:06:47
92000 -- (-987.283) [-965.230] (-950.936) (-1008.220) * (-979.207) [-961.494] (-940.880) (-968.581) -- 0:06:54
92500 -- (-976.741) [-968.747] (-965.845) (-994.817) * (-983.028) (-966.372) [-956.192] (-967.342) -- 0:06:52
93000 -- (-987.824) (-963.276) [-944.017] (-993.978) * (-975.501) [-953.806] (-978.418) (-967.154) -- 0:06:49
93500 -- (-969.804) (-971.611) [-953.281] (-992.586) * (-967.923) [-952.691] (-982.518) (-960.465) -- 0:06:47
94000 -- (-956.778) (-998.189) [-951.583] (-968.554) * (-969.891) [-964.297] (-964.349) (-971.224) -- 0:06:54
94500 -- (-958.247) (-992.320) [-955.829] (-974.369) * (-965.908) (-964.680) (-993.297) [-950.606] -- 0:06:52
95000 -- (-966.485) (-984.020) [-958.567] (-977.221) * (-984.564) (-962.013) [-962.986] (-966.333) -- 0:06:49
Average standard deviation of split frequencies: 0.035874
95500 -- (-978.193) (-981.238) [-953.323] (-990.963) * (-980.900) (-966.846) [-963.707] (-966.819) -- 0:06:47
96000 -- (-963.713) (-982.715) [-960.145] (-981.580) * [-964.039] (-970.139) (-972.491) (-966.004) -- 0:06:44
96500 -- (-967.303) (-977.633) (-972.652) [-970.564] * (-961.197) (-975.337) (-972.401) [-955.993] -- 0:06:51
97000 -- (-960.348) (-971.981) [-951.718] (-991.900) * (-968.255) (-999.025) (-995.620) [-946.926] -- 0:06:49
97500 -- (-980.207) (-967.395) [-945.093] (-982.449) * [-960.823] (-969.875) (-994.290) (-946.383) -- 0:06:47
98000 -- (-982.461) (-986.291) [-948.829] (-973.844) * (-965.766) (-992.310) (-980.377) [-944.911] -- 0:06:44
98500 -- (-972.826) (-974.644) [-952.183] (-973.948) * (-959.510) (-976.494) [-971.822] (-978.353) -- 0:06:51
99000 -- (-974.994) (-981.995) [-946.335] (-975.114) * [-952.083] (-973.069) (-966.553) (-987.397) -- 0:06:49
99500 -- (-974.503) (-984.272) [-956.348] (-973.341) * [-952.115] (-964.812) (-979.291) (-978.421) -- 0:06:47
100000 -- (-978.415) (-965.841) [-964.550] (-982.175) * (-966.284) (-977.000) (-963.054) [-951.033] -- 0:06:45
Average standard deviation of split frequencies: 0.037596
100500 -- (-974.838) (-973.337) [-957.600] (-981.120) * (-978.756) (-958.375) [-954.301] (-969.206) -- 0:06:51
101000 -- (-964.158) (-965.816) [-967.027] (-994.151) * (-984.513) (-968.786) (-963.727) [-951.704] -- 0:06:49
101500 -- (-974.053) (-971.920) [-953.048] (-980.763) * (-972.204) (-972.460) (-950.054) [-952.452] -- 0:06:47
102000 -- (-977.849) (-957.973) [-947.559] (-970.631) * [-951.096] (-973.591) (-983.134) (-968.283) -- 0:06:44
102500 -- [-950.075] (-965.517) (-951.174) (-973.731) * (-987.662) (-970.450) (-959.718) [-966.618] -- 0:06:42
103000 -- (-969.495) (-966.867) [-950.154] (-971.240) * (-981.961) (-965.109) (-974.039) [-956.387] -- 0:06:49
103500 -- (-964.450) (-969.225) [-949.344] (-953.408) * (-994.648) (-961.753) (-970.892) [-952.944] -- 0:06:47
104000 -- (-960.857) [-949.771] (-984.332) (-961.133) * (-974.348) (-962.272) (-964.680) [-955.258] -- 0:06:44
104500 -- [-961.389] (-965.279) (-975.306) (-973.764) * (-968.733) (-977.625) (-963.519) [-952.424] -- 0:06:42
105000 -- (-967.793) (-978.690) (-992.457) [-962.870] * (-982.376) (-944.871) (-972.578) [-953.909] -- 0:06:40
Average standard deviation of split frequencies: 0.034641
105500 -- (-964.685) [-964.398] (-983.635) (-967.942) * (-959.071) (-973.683) (-967.679) [-950.807] -- 0:06:46
106000 -- [-963.741] (-974.546) (-966.195) (-985.774) * (-963.526) (-960.642) (-981.577) [-958.950] -- 0:06:44
106500 -- (-962.205) (-971.782) (-958.343) [-968.891] * [-959.538] (-956.711) (-978.418) (-951.292) -- 0:06:42
107000 -- [-964.448] (-973.537) (-963.738) (-964.762) * (-973.725) (-957.387) (-964.531) [-950.927] -- 0:06:40
107500 -- (-978.112) [-947.226] (-971.930) (-965.824) * (-979.043) [-950.816] (-971.883) (-957.759) -- 0:06:38
108000 -- (-990.025) (-973.122) (-966.450) [-962.241] * (-967.386) (-961.933) (-969.986) [-957.937] -- 0:06:44
108500 -- (-963.079) (-966.056) (-960.816) [-964.432] * (-979.090) [-957.339] (-969.756) (-971.737) -- 0:06:42
109000 -- (-953.411) (-969.109) [-953.241] (-967.844) * [-956.722] (-961.253) (-977.974) (-964.483) -- 0:06:40
109500 -- (-973.409) (-960.180) [-962.379] (-976.673) * (-963.415) (-988.768) (-965.688) [-946.676] -- 0:06:38
110000 -- (-956.680) [-962.921] (-990.122) (-970.650) * (-956.151) (-973.042) [-949.100] (-956.843) -- 0:06:36
Average standard deviation of split frequencies: 0.035198
110500 -- [-950.762] (-983.964) (-983.144) (-963.995) * (-965.118) (-984.174) [-943.579] (-952.255) -- 0:06:42
111000 -- (-967.590) (-980.136) (-972.935) [-953.893] * (-986.329) (-977.317) (-958.767) [-967.512] -- 0:06:40
111500 -- (-950.550) (-969.192) (-975.802) [-961.033] * (-968.315) (-994.848) [-956.084] (-958.339) -- 0:06:38
112000 -- (-969.471) (-967.145) (-972.264) [-952.195] * (-960.125) (-1003.876) (-960.085) [-947.912] -- 0:06:36
112500 -- (-959.264) [-955.312] (-966.343) (-973.083) * (-968.469) (-975.707) (-974.969) [-941.722] -- 0:06:34
113000 -- [-961.891] (-966.619) (-971.866) (-966.819) * (-966.499) (-978.082) (-994.859) [-964.121] -- 0:06:32
113500 -- (-962.919) (-968.194) [-959.206] (-978.704) * (-955.806) (-971.928) (-999.330) [-951.770] -- 0:06:38
114000 -- (-957.137) (-973.397) [-954.024] (-985.922) * (-958.751) (-975.686) (-979.782) [-946.861] -- 0:06:36
114500 -- (-958.847) (-981.451) (-961.045) [-972.708] * (-960.615) (-966.101) [-956.916] (-958.290) -- 0:06:34
115000 -- [-968.632] (-975.912) (-969.590) (-973.493) * (-957.992) (-977.423) (-971.582) [-945.284] -- 0:06:32
Average standard deviation of split frequencies: 0.035184
115500 -- (-979.406) (-975.024) (-955.822) [-962.261] * (-962.289) (-987.934) (-969.840) [-953.734] -- 0:06:30
116000 -- (-978.304) (-973.267) (-962.343) [-959.916] * (-972.421) (-984.220) [-948.914] (-957.000) -- 0:06:36
116500 -- [-966.079] (-989.994) (-957.781) (-965.578) * (-955.449) (-974.122) (-976.297) [-954.732] -- 0:06:34
117000 -- (-953.235) (-972.843) (-965.534) [-955.184] * (-974.206) (-982.550) [-962.659] (-963.257) -- 0:06:32
117500 -- (-985.938) [-953.229] (-975.080) (-975.943) * (-969.156) (-972.820) [-953.679] (-962.962) -- 0:06:30
118000 -- (-972.412) [-953.070] (-947.721) (-978.722) * (-958.055) [-954.898] (-965.951) (-976.993) -- 0:06:28
118500 -- (-967.462) [-960.299] (-962.154) (-997.415) * (-980.101) (-968.673) (-975.537) [-970.575] -- 0:06:34
119000 -- (-985.011) [-966.318] (-970.649) (-982.100) * (-979.050) (-974.179) [-962.441] (-973.252) -- 0:06:32
119500 -- (-979.781) [-954.275] (-968.689) (-962.158) * (-971.506) [-971.660] (-956.713) (-975.454) -- 0:06:30
120000 -- (-970.006) (-954.347) (-989.112) [-959.334] * (-959.107) (-959.843) [-962.664] (-980.726) -- 0:06:28
Average standard deviation of split frequencies: 0.033207
120500 -- (-980.222) (-978.060) [-961.666] (-978.524) * (-968.111) (-968.502) [-969.326] (-974.528) -- 0:06:26
121000 -- (-989.944) [-975.501] (-970.033) (-969.855) * (-971.101) [-968.422] (-976.690) (-960.342) -- 0:06:32
121500 -- (-979.329) (-958.805) [-959.134] (-970.568) * [-959.823] (-977.872) (-985.756) (-959.136) -- 0:06:30
122000 -- (-968.896) (-962.352) (-959.012) [-959.869] * [-964.662] (-975.442) (-968.370) (-974.714) -- 0:06:28
122500 -- (-961.333) (-974.046) (-982.606) [-970.804] * (-976.951) [-970.046] (-952.742) (-975.862) -- 0:06:26
123000 -- (-969.661) [-955.085] (-960.832) (-985.746) * [-974.154] (-986.724) (-970.947) (-975.495) -- 0:06:25
123500 -- [-972.959] (-969.199) (-970.837) (-964.507) * (-972.651) (-988.680) [-963.675] (-982.309) -- 0:06:23
124000 -- (-977.440) (-966.006) (-976.009) [-964.652] * (-978.802) (-978.904) [-964.362] (-973.937) -- 0:06:28
124500 -- (-983.165) (-964.841) [-962.843] (-978.243) * (-983.204) (-964.861) [-961.397] (-965.167) -- 0:06:26
125000 -- [-963.126] (-955.714) (-970.505) (-982.174) * (-983.511) (-974.110) [-961.599] (-974.058) -- 0:06:25
Average standard deviation of split frequencies: 0.029832
125500 -- (-949.317) [-950.399] (-967.111) (-988.311) * (-980.688) (-978.768) (-983.249) [-966.457] -- 0:06:23
126000 -- [-947.372] (-959.305) (-965.150) (-974.980) * (-975.973) [-963.705] (-972.262) (-974.814) -- 0:06:21
126500 -- (-948.913) (-993.941) [-960.965] (-990.845) * (-965.109) (-964.301) (-979.091) [-954.278] -- 0:06:26
127000 -- [-957.489] (-973.073) (-942.371) (-970.277) * (-962.568) (-966.901) (-984.563) [-958.153] -- 0:06:24
127500 -- [-955.569] (-974.560) (-972.126) (-991.053) * (-985.598) (-978.529) [-967.990] (-967.935) -- 0:06:23
128000 -- [-966.885] (-956.960) (-952.773) (-976.855) * (-986.967) (-1002.550) [-967.209] (-966.356) -- 0:06:21
128500 -- [-963.730] (-973.148) (-957.151) (-971.123) * (-983.746) (-973.093) [-956.282] (-978.392) -- 0:06:26
129000 -- [-961.255] (-964.195) (-956.837) (-980.478) * (-977.869) [-967.042] (-967.290) (-969.976) -- 0:06:24
129500 -- (-967.032) (-969.435) [-949.780] (-977.152) * (-971.363) (-973.460) [-965.805] (-975.691) -- 0:06:23
130000 -- (-969.630) (-945.585) [-946.919] (-971.763) * (-960.004) (-979.091) (-970.156) [-956.216] -- 0:06:28
Average standard deviation of split frequencies: 0.027984
130500 -- (-963.041) (-967.359) [-947.852] (-983.814) * (-963.669) (-983.206) (-968.674) [-966.021] -- 0:06:26
131000 -- (-951.780) (-967.112) [-966.040] (-971.631) * (-973.051) (-1001.586) (-955.713) [-967.760] -- 0:06:24
131500 -- (-960.560) (-949.035) [-963.555] (-960.761) * (-977.495) [-961.769] (-972.317) (-981.146) -- 0:06:23
132000 -- (-962.144) [-948.581] (-964.322) (-968.348) * (-952.128) (-960.537) [-971.854] (-986.080) -- 0:06:27
132500 -- (-962.354) [-959.832] (-973.529) (-984.654) * (-971.726) [-963.658] (-961.216) (-985.199) -- 0:06:26
133000 -- (-970.063) [-949.318] (-968.679) (-973.287) * [-955.475] (-976.839) (-953.847) (-978.941) -- 0:06:24
133500 -- (-960.420) [-964.999] (-970.920) (-974.609) * (-981.696) (-966.994) [-962.052] (-991.890) -- 0:06:29
134000 -- (-956.940) (-988.166) [-958.078] (-982.174) * (-992.546) [-971.031] (-961.664) (-976.056) -- 0:06:27
134500 -- (-962.688) (-990.509) [-952.049] (-989.154) * (-989.082) [-964.628] (-958.991) (-971.143) -- 0:06:26
135000 -- [-959.184] (-980.947) (-967.901) (-973.031) * (-985.693) (-979.655) [-951.888] (-958.976) -- 0:06:24
Average standard deviation of split frequencies: 0.026512
135500 -- (-957.519) (-978.727) (-967.276) [-958.542] * (-997.338) (-966.764) [-949.689] (-970.244) -- 0:06:22
136000 -- (-950.536) (-989.688) [-954.273] (-995.967) * (-993.755) (-973.221) [-956.545] (-962.858) -- 0:06:27
136500 -- [-965.046] (-976.613) (-962.223) (-983.141) * (-984.270) [-966.485] (-958.829) (-950.989) -- 0:06:25
137000 -- (-975.309) (-975.167) [-965.265] (-999.855) * (-979.796) (-959.517) (-962.322) [-957.308] -- 0:06:24
137500 -- (-964.357) (-1000.530) [-949.966] (-969.290) * (-982.935) (-956.405) [-947.617] (-984.389) -- 0:06:22
138000 -- (-949.990) (-991.328) [-958.909] (-977.605) * (-992.747) (-974.995) [-960.093] (-971.020) -- 0:06:21
138500 -- (-964.459) (-994.579) [-961.177] (-973.748) * (-981.214) (-973.599) [-956.802] (-960.311) -- 0:06:25
139000 -- (-997.256) (-968.407) [-962.992] (-978.030) * (-989.208) (-973.145) (-961.605) [-954.092] -- 0:06:24
139500 -- (-994.331) (-982.283) (-969.492) [-967.848] * (-989.831) (-977.125) [-957.614] (-952.849) -- 0:06:22
140000 -- (-977.572) [-977.802] (-962.493) (-983.316) * (-981.997) (-967.583) (-973.704) [-955.870] -- 0:06:20
Average standard deviation of split frequencies: 0.024740
140500 -- [-964.303] (-973.742) (-960.961) (-986.783) * (-977.709) (-950.180) (-945.329) [-959.149] -- 0:06:19
141000 -- [-961.303] (-977.964) (-968.746) (-974.781) * (-973.566) (-970.868) (-959.867) [-967.233] -- 0:06:23
141500 -- (-973.333) (-993.304) [-950.923] (-974.502) * (-994.706) (-955.558) [-952.726] (-966.585) -- 0:06:22
142000 -- (-969.317) (-981.688) [-956.630] (-981.493) * (-983.743) (-974.908) [-956.531] (-952.765) -- 0:06:20
142500 -- (-971.833) (-992.920) [-966.104] (-984.161) * (-991.308) (-973.497) (-961.077) [-960.660] -- 0:06:19
143000 -- (-968.115) (-994.220) (-968.422) [-958.495] * (-986.066) (-984.392) [-965.785] (-980.585) -- 0:06:17
143500 -- (-958.389) (-973.994) [-962.796] (-1000.497) * (-969.840) (-975.849) [-961.364] (-963.061) -- 0:06:21
144000 -- (-957.936) (-967.680) [-956.595] (-999.667) * (-984.962) (-968.260) [-953.723] (-979.513) -- 0:06:20
144500 -- (-982.188) (-987.689) [-957.364] (-971.861) * (-984.902) (-966.246) [-966.352] (-986.797) -- 0:06:18
145000 -- (-980.801) (-978.925) [-958.883] (-971.647) * (-969.603) [-948.265] (-957.798) (-962.878) -- 0:06:17
Average standard deviation of split frequencies: 0.023823
145500 -- (-981.280) (-963.446) (-967.353) [-969.228] * (-980.246) [-948.376] (-984.392) (-977.962) -- 0:06:15
146000 -- [-963.359] (-959.726) (-982.240) (-965.226) * (-993.538) [-954.268] (-964.700) (-973.424) -- 0:06:14
146500 -- [-948.477] (-963.830) (-985.238) (-977.295) * (-991.017) [-946.815] (-946.213) (-966.776) -- 0:06:18
147000 -- [-943.677] (-953.457) (-1000.271) (-964.400) * (-1004.036) (-945.105) [-950.684] (-949.401) -- 0:06:17
147500 -- [-967.713] (-970.513) (-986.680) (-957.322) * (-1004.256) (-945.573) (-980.363) [-947.374] -- 0:06:15
148000 -- (-975.004) [-965.666] (-976.441) (-971.929) * (-991.124) (-966.954) (-973.381) [-950.226] -- 0:06:14
148500 -- (-969.206) (-969.337) (-980.269) [-954.386] * (-980.431) (-957.208) (-972.158) [-944.038] -- 0:06:12
149000 -- (-957.603) (-974.022) [-960.985] (-978.807) * (-982.614) [-962.781] (-966.836) (-954.187) -- 0:06:16
149500 -- (-962.879) (-975.195) (-961.691) [-955.273] * (-980.864) (-961.980) (-943.718) [-963.397] -- 0:06:15
150000 -- [-955.749] (-958.344) (-968.313) (-975.186) * (-965.094) (-981.796) [-951.331] (-975.382) -- 0:06:14
Average standard deviation of split frequencies: 0.024943
150500 -- [-958.325] (-948.605) (-964.545) (-987.977) * (-990.052) (-962.781) (-957.156) [-956.659] -- 0:06:12
151000 -- (-959.319) [-964.059] (-979.325) (-969.539) * (-963.914) (-962.834) [-954.186] (-977.887) -- 0:06:11
151500 -- (-959.956) [-952.692] (-973.119) (-967.629) * (-978.947) (-972.901) [-952.168] (-963.080) -- 0:06:15
152000 -- (-967.555) (-981.537) (-960.786) [-946.282] * (-999.801) (-962.784) [-950.282] (-974.066) -- 0:06:13
152500 -- [-938.998] (-991.443) (-970.702) (-963.099) * (-986.369) [-961.536] (-965.321) (-962.742) -- 0:06:12
153000 -- (-971.093) (-963.861) (-968.458) [-944.631] * (-991.654) (-966.475) [-955.128] (-968.389) -- 0:06:10
153500 -- (-958.573) (-974.515) (-971.565) [-947.972] * (-993.313) (-961.745) [-960.870] (-954.802) -- 0:06:09
154000 -- [-965.450] (-957.795) (-978.880) (-964.787) * (-992.997) (-955.764) (-971.750) [-957.605] -- 0:06:13
154500 -- (-958.500) [-958.281] (-980.798) (-977.101) * (-996.121) (-966.545) (-949.610) [-961.172] -- 0:06:12
155000 -- (-965.059) [-960.723] (-965.556) (-948.928) * (-989.209) [-961.845] (-955.827) (-975.440) -- 0:06:10
Average standard deviation of split frequencies: 0.024007
155500 -- (-978.986) [-941.939] (-985.431) (-949.030) * (-976.503) (-948.029) [-954.233] (-970.501) -- 0:06:09
156000 -- (-970.750) [-944.338] (-987.058) (-955.564) * (-979.347) (-959.572) [-954.770] (-976.078) -- 0:06:07
156500 -- (-979.497) (-970.618) [-956.632] (-958.804) * (-1002.431) (-961.027) [-962.693] (-988.326) -- 0:06:06
157000 -- (-973.826) (-987.657) [-942.414] (-950.050) * (-979.997) [-959.229] (-975.423) (-974.373) -- 0:06:10
157500 -- (-955.271) (-973.724) [-950.669] (-983.846) * (-987.938) [-952.908] (-968.712) (-970.462) -- 0:06:09
158000 -- [-952.187] (-982.111) (-948.430) (-988.823) * (-976.515) (-958.305) [-965.019] (-967.849) -- 0:06:07
158500 -- (-964.377) (-958.223) [-945.210] (-966.560) * (-971.262) [-961.524] (-984.315) (-975.731) -- 0:06:06
159000 -- [-964.722] (-959.913) (-963.290) (-991.060) * (-970.544) [-955.978] (-962.132) (-989.086) -- 0:06:04
159500 -- [-954.663] (-984.139) (-960.138) (-989.402) * (-992.468) (-976.042) [-957.675] (-955.378) -- 0:06:08
160000 -- (-981.112) [-954.715] (-970.393) (-967.874) * (-968.878) [-955.102] (-970.005) (-968.738) -- 0:06:07
Average standard deviation of split frequencies: 0.022466
160500 -- [-953.821] (-980.070) (-982.067) (-974.602) * (-970.841) (-947.402) (-989.362) [-963.791] -- 0:06:06
161000 -- [-954.325] (-967.765) (-971.419) (-958.499) * (-969.623) [-962.850] (-965.073) (-976.891) -- 0:06:04
161500 -- (-976.418) (-973.487) (-956.020) [-954.996] * (-986.326) (-971.533) (-953.410) [-957.729] -- 0:06:03
162000 -- (-961.701) (-962.708) [-956.205] (-970.722) * (-976.301) [-948.434] (-955.328) (-974.466) -- 0:06:07
162500 -- (-950.233) (-971.244) [-944.628] (-983.271) * (-981.012) [-952.605] (-962.242) (-965.348) -- 0:06:05
163000 -- (-959.423) (-977.428) [-936.894] (-972.893) * (-967.730) [-952.525] (-979.773) (-951.152) -- 0:06:04
163500 -- [-959.022] (-956.328) (-962.652) (-998.015) * (-970.819) (-953.949) (-970.611) [-965.517] -- 0:06:03
164000 -- (-961.644) [-971.631] (-958.729) (-977.862) * (-967.940) (-967.866) (-965.131) [-957.961] -- 0:06:01
164500 -- [-940.411] (-961.004) (-967.890) (-975.670) * (-997.092) (-955.483) (-981.392) [-966.563] -- 0:06:00
165000 -- (-943.703) [-945.544] (-979.076) (-965.488) * (-997.928) (-958.463) (-962.831) [-954.862] -- 0:06:04
Average standard deviation of split frequencies: 0.021339
165500 -- [-944.429] (-960.066) (-968.396) (-983.725) * [-959.926] (-959.679) (-957.730) (-972.647) -- 0:06:03
166000 -- (-980.448) [-956.539] (-973.467) (-952.548) * (-962.809) (-973.160) [-952.774] (-954.818) -- 0:06:01
166500 -- (-964.529) (-972.963) (-974.043) [-959.933] * (-965.729) (-972.815) [-953.560] (-980.938) -- 0:06:00
167000 -- (-965.868) (-990.645) [-961.217] (-965.472) * (-963.661) (-985.332) [-944.140] (-972.362) -- 0:05:59
167500 -- (-967.234) (-1009.452) [-964.453] (-956.039) * (-955.725) (-983.946) [-948.408] (-966.863) -- 0:06:02
168000 -- (-982.770) (-984.395) [-948.901] (-968.424) * (-954.647) (-974.161) [-952.615] (-996.706) -- 0:06:01
168500 -- (-972.448) (-993.677) [-963.489] (-974.913) * (-975.403) (-960.460) [-962.054] (-979.767) -- 0:06:00
169000 -- (-972.284) (-963.890) (-966.355) [-967.967] * (-967.598) [-958.710] (-958.263) (-983.532) -- 0:05:58
169500 -- (-975.543) [-975.279] (-967.552) (-983.268) * (-968.924) (-956.985) (-965.377) [-966.949] -- 0:05:57
170000 -- (-973.934) [-954.433] (-961.578) (-973.401) * (-971.131) (-989.124) [-961.408] (-988.721) -- 0:06:01
Average standard deviation of split frequencies: 0.018309
170500 -- (-971.587) [-947.900] (-970.693) (-975.703) * (-972.512) (-978.029) [-968.419] (-996.796) -- 0:06:00
171000 -- (-960.988) [-955.317] (-969.480) (-965.644) * [-947.819] (-966.347) (-968.999) (-991.477) -- 0:05:58
171500 -- (-965.152) (-960.931) (-991.089) [-948.734] * [-953.830] (-978.069) (-970.382) (-991.005) -- 0:05:57
172000 -- (-963.078) [-959.137] (-973.537) (-958.980) * (-956.454) (-973.980) [-956.476] (-995.513) -- 0:06:01
172500 -- (-961.569) (-960.773) (-966.704) [-958.921] * [-956.783] (-971.671) (-961.899) (-977.310) -- 0:05:59
173000 -- [-961.229] (-971.918) (-974.283) (-988.018) * (-965.204) (-960.896) [-941.393] (-968.346) -- 0:05:58
173500 -- (-974.043) (-969.480) [-945.717] (-963.962) * (-987.239) [-956.183] (-955.466) (-973.253) -- 0:05:57
174000 -- [-978.014] (-961.267) (-978.830) (-955.593) * (-962.575) (-974.149) [-957.965] (-965.728) -- 0:06:00
174500 -- (-956.240) [-964.834] (-964.767) (-979.146) * (-979.096) (-971.033) [-952.129] (-972.948) -- 0:05:59
175000 -- (-974.894) [-955.688] (-984.857) (-970.463) * (-984.425) (-996.467) [-957.211] (-974.391) -- 0:05:58
Average standard deviation of split frequencies: 0.018526
175500 -- (-975.165) [-950.500] (-981.474) (-981.553) * (-982.576) [-969.154] (-950.116) (-980.405) -- 0:05:57
176000 -- (-957.446) [-952.334] (-973.987) (-970.158) * (-991.266) (-991.997) [-942.322] (-960.510) -- 0:05:55
176500 -- [-965.075] (-956.942) (-979.754) (-967.037) * (-986.252) (-987.071) [-951.835] (-966.439) -- 0:05:59
177000 -- (-964.332) (-959.323) (-989.381) [-963.711] * (-993.996) (-987.030) [-966.418] (-974.222) -- 0:05:58
177500 -- (-957.137) [-959.040] (-966.311) (-961.707) * (-983.267) (-975.289) [-956.627] (-973.154) -- 0:05:56
178000 -- (-941.608) [-963.410] (-984.981) (-973.254) * (-981.667) (-981.671) (-965.908) [-953.325] -- 0:05:55
178500 -- [-955.629] (-967.589) (-962.318) (-961.505) * (-981.772) (-990.937) [-971.621] (-960.064) -- 0:05:54
179000 -- (-951.752) (-967.816) [-952.892] (-977.268) * (-988.387) (-967.789) [-964.591] (-957.647) -- 0:05:57
179500 -- (-966.250) (-984.325) (-974.622) [-952.462] * (-991.155) (-975.978) [-956.617] (-982.145) -- 0:05:56
180000 -- (-963.499) (-990.366) (-972.982) [-950.867] * (-987.247) [-971.013] (-952.560) (-965.497) -- 0:05:55
Average standard deviation of split frequencies: 0.017221
180500 -- [-964.137] (-985.466) (-982.083) (-956.341) * (-978.351) (-980.824) [-956.832] (-982.037) -- 0:05:54
181000 -- (-952.713) (-955.611) [-972.617] (-977.324) * [-980.560] (-986.653) (-977.731) (-999.555) -- 0:05:57
181500 -- (-961.604) (-965.180) [-963.052] (-971.733) * (-977.084) (-963.430) [-959.495] (-977.804) -- 0:05:56
182000 -- (-967.104) [-951.081] (-963.979) (-965.262) * (-964.050) (-974.088) [-960.642] (-989.853) -- 0:05:55
182500 -- (-957.245) (-977.359) [-956.164] (-969.503) * (-960.888) (-953.176) [-958.412] (-979.631) -- 0:05:53
183000 -- (-962.826) (-961.696) [-956.815] (-979.890) * [-953.375] (-957.403) (-956.558) (-995.831) -- 0:05:52
183500 -- [-951.297] (-972.794) (-968.981) (-979.401) * (-976.425) (-967.373) [-959.145] (-974.264) -- 0:05:55
184000 -- (-968.522) (-966.932) [-950.617] (-973.569) * (-972.645) (-972.092) [-952.618] (-975.430) -- 0:05:54
184500 -- (-963.946) (-959.215) [-952.987] (-975.643) * (-981.967) (-975.392) [-942.065] (-987.077) -- 0:05:53
185000 -- [-959.311] (-967.081) (-973.222) (-965.367) * (-983.391) (-960.288) [-953.497] (-977.749) -- 0:05:52
Average standard deviation of split frequencies: 0.016510
185500 -- (-970.140) [-964.103] (-979.138) (-973.024) * [-970.025] (-990.393) (-973.184) (-972.628) -- 0:05:55
186000 -- (-968.550) (-963.437) (-977.741) [-964.828] * (-960.896) (-1000.720) (-955.483) [-967.337] -- 0:05:54
186500 -- (-977.372) (-953.698) (-973.192) [-954.508] * (-963.826) (-989.453) [-962.806] (-978.896) -- 0:05:53
187000 -- (-973.066) [-955.546] (-967.696) (-962.953) * (-959.860) [-968.409] (-973.169) (-975.199) -- 0:05:52
187500 -- (-967.884) (-975.690) (-976.673) [-979.266] * (-959.744) [-952.731] (-970.743) (-968.283) -- 0:05:51
188000 -- (-978.520) [-972.707] (-971.138) (-967.739) * (-975.532) (-973.721) [-953.431] (-983.726) -- 0:05:54
188500 -- [-946.440] (-984.742) (-977.665) (-959.153) * (-974.436) (-979.983) [-949.587] (-976.620) -- 0:05:53
189000 -- [-954.316] (-980.888) (-973.964) (-963.704) * (-959.373) (-979.178) [-966.984] (-971.729) -- 0:05:51
189500 -- (-973.713) (-963.868) (-964.751) [-955.489] * (-951.345) (-983.651) [-957.348] (-965.634) -- 0:05:50
190000 -- (-974.264) (-960.951) (-972.055) [-955.320] * (-962.287) (-976.300) [-958.082] (-978.865) -- 0:05:53
Average standard deviation of split frequencies: 0.015258
190500 -- [-959.438] (-970.012) (-985.508) (-982.973) * (-962.509) (-975.861) [-949.416] (-971.198) -- 0:05:52
191000 -- [-960.546] (-971.481) (-986.332) (-969.632) * (-956.361) (-962.530) [-947.974] (-974.194) -- 0:05:51
191500 -- [-945.638] (-967.474) (-987.956) (-978.724) * [-959.367] (-955.780) (-952.440) (-982.551) -- 0:05:50
192000 -- (-966.498) [-956.588] (-982.012) (-967.229) * (-981.969) (-985.448) [-967.707] (-985.302) -- 0:05:49
192500 -- (-958.082) [-962.313] (-979.492) (-966.544) * [-963.214] (-968.826) (-957.176) (-971.155) -- 0:05:52
193000 -- (-975.244) [-948.720] (-981.812) (-957.809) * (-959.777) (-951.482) [-963.801] (-969.876) -- 0:05:51
193500 -- (-960.561) (-955.171) (-987.969) [-955.748] * (-977.611) (-981.100) [-948.160] (-965.358) -- 0:05:50
194000 -- [-966.064] (-961.984) (-981.920) (-976.509) * [-953.667] (-984.719) (-972.136) (-981.975) -- 0:05:48
194500 -- (-971.065) (-980.602) (-974.161) [-965.361] * [-963.909] (-981.897) (-959.327) (-969.667) -- 0:05:52
195000 -- (-966.486) (-1005.361) (-976.653) [-952.564] * (-973.257) (-989.345) [-962.206] (-969.159) -- 0:05:50
Average standard deviation of split frequencies: 0.014714
195500 -- (-963.571) (-984.365) (-989.451) [-962.360] * [-969.660] (-985.445) (-972.193) (-979.311) -- 0:05:49
196000 -- [-958.677] (-992.898) (-972.569) (-959.489) * [-962.560] (-954.372) (-968.255) (-992.141) -- 0:05:48
196500 -- (-965.968) (-981.796) (-981.841) [-952.001] * (-959.502) [-967.285] (-962.011) (-977.984) -- 0:05:51
197000 -- [-979.956] (-973.624) (-985.719) (-981.259) * (-956.309) [-955.693] (-978.572) (-974.533) -- 0:05:50
197500 -- (-974.926) [-973.206] (-986.438) (-969.755) * (-981.723) (-963.647) [-962.727] (-970.209) -- 0:05:49
198000 -- (-967.125) (-968.749) (-960.732) [-965.788] * (-978.345) [-957.134] (-973.273) (-956.743) -- 0:05:48
198500 -- (-987.194) [-967.884] (-973.872) (-977.573) * (-981.876) [-960.726] (-961.352) (-981.120) -- 0:05:47
199000 -- [-971.750] (-964.437) (-960.720) (-982.753) * (-975.190) (-978.762) [-962.768] (-978.662) -- 0:05:50
199500 -- (-967.268) [-972.007] (-976.511) (-973.957) * (-965.266) (-971.368) [-959.272] (-950.911) -- 0:05:49
200000 -- (-956.405) (-983.202) (-977.780) [-962.032] * (-968.802) (-968.139) (-962.218) [-953.213] -- 0:05:48
Average standard deviation of split frequencies: 0.014238
200500 -- (-969.109) [-967.718] (-986.860) (-968.163) * [-957.877] (-985.984) (-975.010) (-965.932) -- 0:05:46
201000 -- (-988.934) [-963.431] (-985.092) (-965.719) * (-964.575) [-970.860] (-986.207) (-966.724) -- 0:05:49
201500 -- (-969.784) [-954.968] (-976.400) (-971.573) * [-963.891] (-969.933) (-981.283) (-968.218) -- 0:05:48
202000 -- (-971.564) [-948.698] (-993.981) (-978.424) * [-956.261] (-975.864) (-991.074) (-972.986) -- 0:05:47
202500 -- (-978.315) [-977.646] (-997.886) (-983.489) * (-962.669) [-966.501] (-975.502) (-964.241) -- 0:05:46
203000 -- (-960.924) (-983.500) (-985.073) [-966.271] * [-959.534] (-996.306) (-981.661) (-982.298) -- 0:05:45
203500 -- [-954.255] (-975.573) (-1005.100) (-968.384) * [-955.099] (-990.681) (-976.615) (-969.400) -- 0:05:48
204000 -- [-959.097] (-955.696) (-993.312) (-965.069) * (-966.681) [-970.832] (-969.729) (-988.848) -- 0:05:47
204500 -- [-958.835] (-951.370) (-965.907) (-968.104) * [-969.539] (-965.453) (-970.676) (-997.596) -- 0:05:46
205000 -- (-976.575) (-973.324) (-975.730) [-962.994] * (-969.667) [-951.712] (-960.140) (-968.837) -- 0:05:45
Average standard deviation of split frequencies: 0.013865
205500 -- [-956.593] (-967.804) (-976.987) (-955.400) * (-977.334) (-970.665) [-952.783] (-995.918) -- 0:05:47
206000 -- (-968.385) (-976.892) [-970.853] (-1003.175) * [-957.610] (-983.844) (-958.811) (-984.052) -- 0:05:46
206500 -- (-966.011) [-961.214] (-970.136) (-970.061) * (-957.437) (-969.910) [-962.411] (-969.819) -- 0:05:45
207000 -- (-968.072) (-978.540) (-965.268) [-954.542] * (-977.999) (-964.357) [-950.395] (-962.121) -- 0:05:44
207500 -- (-967.351) [-967.804] (-966.786) (-979.452) * (-968.211) (-972.717) (-972.853) [-964.479] -- 0:05:47
208000 -- (-962.952) (-980.245) [-965.667] (-976.172) * [-952.591] (-969.152) (-967.856) (-957.201) -- 0:05:46
208500 -- (-967.921) (-991.968) [-964.944] (-985.163) * [-974.065] (-964.040) (-975.919) (-947.401) -- 0:05:45
209000 -- (-971.040) (-985.048) [-961.407] (-967.530) * [-953.388] (-979.135) (-975.824) (-955.865) -- 0:05:44
209500 -- (-970.687) (-980.896) [-963.231] (-975.386) * (-952.923) (-970.090) (-994.195) [-953.362] -- 0:05:43
210000 -- (-971.234) (-971.874) [-954.948] (-973.353) * [-956.986] (-967.900) (-974.771) (-967.712) -- 0:05:46
Average standard deviation of split frequencies: 0.015137
210500 -- (-966.642) (-973.571) (-976.706) [-958.330] * (-965.063) (-976.313) (-959.944) [-953.920] -- 0:05:45
211000 -- (-972.202) (-976.348) [-970.225] (-977.023) * (-970.214) (-962.588) (-976.366) [-957.741] -- 0:05:44
211500 -- [-957.537] (-991.945) (-966.920) (-978.182) * (-951.771) (-984.213) [-967.958] (-968.593) -- 0:05:42
212000 -- [-957.177] (-990.378) (-966.838) (-970.506) * (-968.217) (-976.743) (-962.163) [-942.081] -- 0:05:45
212500 -- [-955.453] (-979.921) (-975.866) (-950.851) * (-959.146) (-983.892) (-990.235) [-956.749] -- 0:05:44
213000 -- (-977.624) (-961.197) [-961.364] (-966.866) * (-953.576) [-973.575] (-972.061) (-969.275) -- 0:05:43
213500 -- (-993.707) [-963.026] (-979.352) (-979.336) * [-950.818] (-981.546) (-999.033) (-961.645) -- 0:05:42
214000 -- (-957.020) (-960.382) [-962.908] (-987.565) * (-957.404) (-973.081) (-982.266) [-947.458] -- 0:05:41
214500 -- [-959.813] (-956.224) (-979.002) (-972.749) * (-967.436) (-979.007) (-993.621) [-950.653] -- 0:05:44
215000 -- (-952.027) (-959.553) (-977.435) [-967.245] * (-974.631) (-966.797) (-971.878) [-945.449] -- 0:05:43
Average standard deviation of split frequencies: 0.016027
215500 -- (-955.992) [-958.496] (-967.202) (-977.405) * (-986.494) (-968.975) (-970.990) [-958.998] -- 0:05:42
216000 -- (-970.522) [-960.340] (-970.306) (-972.084) * [-962.241] (-976.449) (-972.899) (-962.452) -- 0:05:41
216500 -- (-972.803) [-970.730] (-975.294) (-982.069) * (-962.627) (-983.048) (-987.410) [-949.238] -- 0:05:40
217000 -- (-983.679) (-980.730) [-958.069] (-985.120) * (-957.383) (-976.831) [-962.982] (-959.397) -- 0:05:42
217500 -- (-975.848) [-952.806] (-961.090) (-975.206) * [-954.186] (-982.782) (-949.838) (-973.571) -- 0:05:41
218000 -- (-988.104) (-971.835) [-956.404] (-971.214) * [-945.988] (-979.743) (-958.964) (-977.020) -- 0:05:40
218500 -- (-969.955) (-990.222) [-956.642] (-983.047) * (-966.462) (-990.870) (-968.322) [-963.353] -- 0:05:39
219000 -- (-989.656) (-972.270) [-951.400] (-987.830) * (-980.853) (-999.999) (-966.228) [-948.999] -- 0:05:38
219500 -- (-967.120) (-978.949) [-953.915] (-987.852) * (-964.752) (-979.870) [-974.450] (-982.975) -- 0:05:37
220000 -- (-960.324) (-987.657) [-961.211] (-990.629) * [-963.068] (-984.692) (-965.792) (-972.224) -- 0:05:40
Average standard deviation of split frequencies: 0.015278
220500 -- (-980.457) (-977.016) [-958.341] (-970.661) * (-986.133) (-987.316) (-960.756) [-969.796] -- 0:05:39
221000 -- (-971.227) (-971.227) [-960.281] (-969.277) * (-963.673) (-985.881) [-960.503] (-965.940) -- 0:05:38
221500 -- [-966.967] (-990.836) (-956.731) (-976.985) * (-978.600) (-993.317) [-950.635] (-963.190) -- 0:05:37
222000 -- (-963.510) (-981.764) [-954.593] (-977.118) * (-976.436) (-989.673) [-969.778] (-974.895) -- 0:05:36
222500 -- (-973.829) (-968.291) [-955.082] (-967.003) * [-957.529] (-967.453) (-977.045) (-955.408) -- 0:05:38
223000 -- (-971.832) (-975.906) [-945.085] (-960.071) * [-956.496] (-969.400) (-966.985) (-973.981) -- 0:05:37
223500 -- (-976.390) (-970.656) [-961.339] (-972.797) * (-949.895) (-992.233) [-949.980] (-987.290) -- 0:05:37
224000 -- (-993.561) (-990.278) [-955.493] (-987.611) * (-952.504) (-990.017) [-952.913] (-980.196) -- 0:05:36
224500 -- [-960.113] (-973.758) (-971.533) (-992.989) * (-960.451) (-962.343) [-952.908] (-977.154) -- 0:05:35
225000 -- (-970.426) (-988.296) [-951.674] (-974.595) * (-958.270) (-970.803) [-952.959] (-956.514) -- 0:05:37
Average standard deviation of split frequencies: 0.015383
225500 -- (-967.775) (-994.945) [-956.983] (-974.066) * (-967.898) (-961.959) [-954.596] (-968.846) -- 0:05:36
226000 -- (-976.240) (-992.778) (-958.172) [-961.512] * [-962.039] (-970.096) (-958.734) (-973.962) -- 0:05:35
226500 -- (-971.958) (-988.338) (-968.157) [-961.680] * (-965.622) (-964.668) [-958.604] (-973.207) -- 0:05:34
227000 -- (-980.820) (-1001.503) (-968.374) [-957.844] * [-951.442] (-968.935) (-971.186) (-956.642) -- 0:05:33
227500 -- (-981.551) (-979.986) (-963.819) [-953.726] * (-952.774) (-967.515) (-973.550) [-954.912] -- 0:05:36
228000 -- (-966.390) (-972.349) (-975.624) [-950.790] * [-952.512] (-961.431) (-980.889) (-978.742) -- 0:05:35
228500 -- (-966.923) (-975.348) (-980.889) [-952.396] * (-964.178) [-951.952] (-985.946) (-976.079) -- 0:05:34
229000 -- (-965.501) (-986.905) (-974.456) [-959.754] * (-972.244) [-955.906] (-983.047) (-987.935) -- 0:05:33
229500 -- (-983.299) (-989.240) (-964.240) [-964.254] * [-965.120] (-947.015) (-981.516) (-977.927) -- 0:05:32
230000 -- (-990.829) (-982.326) (-980.566) [-951.373] * (-969.606) (-963.343) [-964.829] (-998.407) -- 0:05:34
Average standard deviation of split frequencies: 0.016481
230500 -- (-978.990) (-987.694) (-987.283) [-957.159] * (-970.094) [-960.019] (-982.419) (-969.408) -- 0:05:33
231000 -- (-975.872) (-994.108) (-973.356) [-954.572] * (-977.120) (-962.359) (-990.860) [-968.921] -- 0:05:32
231500 -- (-970.737) (-981.951) (-992.891) [-954.569] * (-970.458) (-969.758) (-973.895) [-945.520] -- 0:05:31
232000 -- (-991.866) (-982.241) (-967.524) [-958.334] * (-975.452) [-962.998] (-981.268) (-962.065) -- 0:05:31
232500 -- (-977.419) (-974.367) (-962.194) [-956.430] * (-969.836) (-971.163) (-954.600) [-957.605] -- 0:05:30
233000 -- (-988.725) (-970.429) [-952.973] (-958.890) * (-993.473) (-967.131) (-965.166) [-965.098] -- 0:05:32
233500 -- (-990.261) (-972.396) (-957.718) [-949.568] * [-967.384] (-980.591) (-966.090) (-970.227) -- 0:05:31
234000 -- (-991.216) (-970.888) (-971.319) [-956.546] * (-968.079) (-971.283) (-981.727) [-969.983] -- 0:05:30
234500 -- (-977.052) (-979.848) [-960.478] (-946.604) * (-996.101) (-974.547) (-978.930) [-964.111] -- 0:05:29
235000 -- [-962.307] (-976.496) (-973.356) (-955.589) * (-978.768) [-957.518] (-957.796) (-974.160) -- 0:05:28
Average standard deviation of split frequencies: 0.016753
235500 -- (-966.531) (-985.749) (-992.682) [-949.215] * (-973.796) (-978.381) [-960.016] (-986.451) -- 0:05:31
236000 -- (-977.967) (-975.882) (-1007.226) [-944.431] * (-978.573) [-974.360] (-984.912) (-971.715) -- 0:05:30
236500 -- (-973.867) (-983.132) (-972.340) [-947.298] * (-977.550) (-979.694) [-959.377] (-953.689) -- 0:05:29
237000 -- (-990.194) (-960.972) (-985.950) [-960.599] * (-975.056) (-981.631) [-961.822] (-974.244) -- 0:05:28
237500 -- (-988.816) (-964.008) (-984.869) [-943.271] * (-969.820) (-973.714) [-956.766] (-965.015) -- 0:05:27
238000 -- (-984.379) (-969.586) (-969.278) [-949.198] * (-971.501) (-977.703) (-956.539) [-947.210] -- 0:05:29
238500 -- (-987.482) [-950.192] (-977.851) (-966.119) * (-972.890) (-986.558) (-977.095) [-954.294] -- 0:05:28
239000 -- (-977.851) (-959.227) (-994.040) [-948.171] * (-970.760) (-977.774) (-996.277) [-957.820] -- 0:05:27
239500 -- (-977.923) (-977.238) (-987.541) [-960.670] * (-973.656) (-982.818) (-974.334) [-959.503] -- 0:05:27
240000 -- (-967.885) (-978.347) (-978.749) [-962.820] * (-975.173) (-971.850) (-994.887) [-951.891] -- 0:05:26
Average standard deviation of split frequencies: 0.018197
240500 -- [-953.808] (-974.903) (-976.008) (-967.355) * (-974.101) (-984.747) (-971.488) [-961.245] -- 0:05:28
241000 -- [-952.893] (-970.229) (-979.488) (-971.273) * (-970.152) (-993.108) (-988.271) [-949.783] -- 0:05:27
241500 -- (-949.398) [-958.873] (-978.422) (-979.287) * (-968.963) (-982.803) (-991.934) [-961.205] -- 0:05:26
242000 -- [-954.156] (-968.822) (-979.924) (-960.858) * (-976.464) (-977.474) (-979.898) [-953.023] -- 0:05:25
242500 -- [-957.983] (-957.123) (-971.063) (-953.685) * [-960.482] (-986.268) (-982.816) (-969.857) -- 0:05:24
243000 -- (-956.012) [-955.458] (-966.466) (-965.751) * (-957.128) (-977.455) (-963.674) [-965.048] -- 0:05:27
243500 -- [-959.839] (-960.159) (-974.220) (-976.858) * (-969.798) (-987.877) [-966.091] (-990.557) -- 0:05:26
244000 -- [-950.910] (-959.505) (-966.293) (-988.764) * [-955.518] (-974.832) (-971.165) (-973.633) -- 0:05:25
244500 -- (-955.639) [-960.626] (-972.862) (-972.951) * (-972.807) (-989.288) (-977.033) [-968.721] -- 0:05:24
245000 -- (-972.766) [-967.686] (-970.668) (-956.435) * (-977.421) (-978.206) (-975.213) [-963.718] -- 0:05:23
Average standard deviation of split frequencies: 0.019039
245500 -- (-972.091) [-956.067] (-991.592) (-954.169) * (-973.483) (-975.366) [-954.793] (-974.359) -- 0:05:22
246000 -- (-972.004) (-979.310) (-978.278) [-951.605] * (-977.133) [-962.842] (-952.153) (-960.594) -- 0:05:24
246500 -- (-960.467) (-953.440) (-983.323) [-966.872] * (-984.395) [-965.520] (-961.217) (-953.200) -- 0:05:24
247000 -- [-967.365] (-975.593) (-977.201) (-958.960) * (-983.844) (-994.154) (-960.326) [-960.563] -- 0:05:23
247500 -- [-976.454] (-959.443) (-991.147) (-962.169) * (-974.010) (-976.219) [-950.705] (-965.359) -- 0:05:22
248000 -- [-957.127] (-948.842) (-982.256) (-965.703) * (-1003.739) (-975.805) [-959.439] (-956.677) -- 0:05:21
248500 -- [-974.445] (-965.592) (-985.628) (-965.161) * (-990.665) [-955.470] (-948.292) (-964.135) -- 0:05:23
249000 -- (-955.199) (-963.600) (-985.431) [-962.014] * (-971.576) [-959.456] (-955.758) (-957.117) -- 0:05:22
249500 -- (-952.090) (-977.568) (-963.697) [-959.876] * (-969.065) (-956.555) [-948.097] (-976.144) -- 0:05:21
250000 -- (-955.321) (-973.403) [-950.868] (-956.863) * (-975.083) (-950.839) [-944.657] (-1004.838) -- 0:05:21
Average standard deviation of split frequencies: 0.019049
250500 -- [-944.842] (-969.098) (-953.938) (-968.841) * (-983.132) [-944.855] (-946.966) (-982.080) -- 0:05:20
251000 -- (-943.370) [-961.891] (-987.909) (-959.901) * (-968.252) [-966.554] (-977.436) (-979.448) -- 0:05:22
251500 -- (-941.903) [-961.029] (-977.428) (-964.761) * (-974.668) [-966.143] (-947.561) (-989.545) -- 0:05:21
252000 -- (-960.740) [-951.340] (-981.581) (-962.028) * [-953.797] (-960.371) (-968.070) (-989.268) -- 0:05:20
252500 -- [-944.516] (-969.063) (-982.611) (-968.477) * [-942.420] (-983.502) (-964.649) (-975.639) -- 0:05:19
253000 -- [-963.617] (-960.679) (-989.321) (-966.765) * [-949.902] (-971.161) (-973.354) (-992.712) -- 0:05:18
253500 -- (-956.442) (-956.092) (-991.564) [-956.723] * [-952.020] (-957.353) (-977.462) (-990.428) -- 0:05:20
254000 -- (-971.356) (-960.842) (-976.852) [-956.296] * (-960.363) [-958.406] (-961.374) (-968.485) -- 0:05:20
254500 -- [-961.828] (-962.939) (-975.712) (-974.344) * [-957.495] (-971.743) (-973.323) (-967.507) -- 0:05:19
255000 -- [-954.200] (-963.072) (-985.975) (-964.341) * [-943.752] (-973.635) (-968.772) (-966.978) -- 0:05:18
Average standard deviation of split frequencies: 0.017263
255500 -- (-952.577) [-955.348] (-980.259) (-976.055) * [-944.854] (-983.492) (-976.633) (-968.560) -- 0:05:17
256000 -- [-956.267] (-969.181) (-989.888) (-985.839) * [-962.336] (-962.594) (-970.810) (-981.915) -- 0:05:19
256500 -- [-949.395] (-965.162) (-992.046) (-967.708) * [-969.105] (-970.457) (-958.416) (-994.896) -- 0:05:18
257000 -- [-962.727] (-968.834) (-998.512) (-974.675) * [-956.961] (-981.894) (-974.129) (-970.427) -- 0:05:18
257500 -- [-941.095] (-963.170) (-986.706) (-984.080) * [-963.340] (-952.416) (-977.885) (-996.585) -- 0:05:17
258000 -- [-953.555] (-964.367) (-991.036) (-972.233) * (-952.936) [-955.950] (-963.284) (-985.572) -- 0:05:16
258500 -- [-955.384] (-958.056) (-987.298) (-986.847) * [-955.540] (-961.462) (-967.771) (-980.327) -- 0:05:15
259000 -- [-947.729] (-970.044) (-992.892) (-984.397) * (-969.556) (-987.944) [-962.639] (-995.740) -- 0:05:17
259500 -- (-951.664) [-950.828] (-976.982) (-966.678) * (-952.636) (-981.027) [-974.781] (-999.830) -- 0:05:16
260000 -- [-963.690] (-968.530) (-987.025) (-966.141) * [-942.516] (-979.594) (-971.573) (-982.166) -- 0:05:15
Average standard deviation of split frequencies: 0.016801
260500 -- (-951.896) (-987.655) (-964.222) [-963.252] * [-950.988] (-964.656) (-977.428) (-993.967) -- 0:05:15
261000 -- [-950.655] (-974.888) (-969.250) (-973.918) * [-960.267] (-964.890) (-986.294) (-984.346) -- 0:05:14
261500 -- (-947.374) (-956.453) [-959.581] (-986.497) * [-950.065] (-971.844) (-985.300) (-987.931) -- 0:05:16
262000 -- (-966.438) [-962.793] (-971.108) (-989.507) * [-964.790] (-979.741) (-965.770) (-982.391) -- 0:05:15
262500 -- [-958.904] (-973.165) (-979.678) (-976.276) * [-951.117] (-969.758) (-974.656) (-997.184) -- 0:05:14
263000 -- [-960.489] (-956.731) (-978.809) (-990.026) * [-967.628] (-977.543) (-963.006) (-986.165) -- 0:05:13
263500 -- (-970.428) [-948.392] (-992.270) (-980.123) * (-956.466) [-960.263] (-965.188) (-990.514) -- 0:05:13
264000 -- (-969.995) [-954.210] (-974.381) (-977.337) * [-944.759] (-978.900) (-968.422) (-986.980) -- 0:05:15
264500 -- (-959.352) [-957.396] (-1002.770) (-964.413) * [-956.520] (-959.897) (-964.944) (-992.318) -- 0:05:14
265000 -- (-1003.177) (-955.790) (-966.281) [-964.177] * [-968.103] (-951.053) (-978.989) (-984.287) -- 0:05:13
Average standard deviation of split frequencies: 0.016171
265500 -- (-1000.855) [-952.957] (-976.842) (-986.969) * [-952.653] (-957.422) (-973.024) (-987.794) -- 0:05:12
266000 -- (-985.519) [-952.803] (-990.309) (-974.603) * (-981.800) [-964.483] (-977.835) (-966.257) -- 0:05:11
266500 -- (-980.718) (-964.186) [-954.017] (-956.316) * (-958.237) [-963.240] (-987.963) (-982.187) -- 0:05:13
267000 -- (-980.052) (-974.955) [-956.073] (-958.930) * [-956.596] (-966.464) (-979.099) (-989.661) -- 0:05:12
267500 -- (-959.085) (-988.117) (-961.231) [-954.654] * [-971.193] (-963.718) (-962.115) (-990.147) -- 0:05:12
268000 -- (-960.777) (-983.978) (-976.186) [-958.759] * (-975.992) (-959.662) [-961.687] (-967.165) -- 0:05:11
268500 -- (-970.529) (-974.185) (-951.206) [-960.110] * (-964.782) [-955.655] (-957.320) (-979.798) -- 0:05:10
269000 -- (-975.658) (-968.511) [-952.906] (-953.120) * (-972.479) [-964.556] (-979.487) (-973.420) -- 0:05:12
269500 -- [-949.278] (-978.777) (-968.459) (-958.599) * (-969.457) [-951.811] (-978.086) (-971.044) -- 0:05:11
270000 -- [-960.049] (-967.950) (-962.257) (-979.426) * [-952.372] (-952.525) (-996.937) (-967.710) -- 0:05:10
Average standard deviation of split frequencies: 0.017035
270500 -- [-961.087] (-971.691) (-958.655) (-987.934) * (-998.585) [-955.406] (-980.583) (-958.993) -- 0:05:10
271000 -- (-956.139) (-955.791) [-945.279] (-970.028) * (-974.573) (-966.968) [-964.614] (-969.907) -- 0:05:09
271500 -- (-979.570) [-949.865] (-977.161) (-963.140) * (-987.554) [-964.451] (-964.165) (-959.390) -- 0:05:11
272000 -- (-985.758) (-967.011) [-958.871] (-963.754) * (-966.888) (-968.505) [-968.884] (-972.011) -- 0:05:10
272500 -- (-978.789) [-954.499] (-971.708) (-966.291) * (-969.836) (-980.122) [-963.856] (-970.178) -- 0:05:09
273000 -- (-986.665) (-965.784) (-992.833) [-951.950] * (-983.735) (-970.105) [-953.915] (-964.976) -- 0:05:08
273500 -- (-1004.297) [-955.540] (-991.227) (-955.606) * (-987.154) (-992.174) (-958.155) [-951.948] -- 0:05:08
274000 -- (-982.309) [-957.293] (-963.169) (-952.364) * (-964.004) (-990.163) [-954.062] (-970.461) -- 0:05:07
274500 -- (-989.736) [-962.313] (-958.560) (-969.041) * (-967.164) (-983.913) (-969.303) [-951.557] -- 0:05:09
275000 -- (-981.177) (-973.793) [-955.368] (-956.995) * (-991.228) (-988.529) (-965.319) [-947.068] -- 0:05:08
Average standard deviation of split frequencies: 0.016600
275500 -- (-990.948) (-967.720) (-972.023) [-963.289] * (-988.189) (-989.993) [-966.611] (-950.162) -- 0:05:07
276000 -- (-1001.495) (-983.477) (-964.444) [-953.030] * (-986.072) (-978.061) [-959.893] (-964.891) -- 0:05:06
276500 -- (-997.728) [-963.045] (-962.315) (-959.420) * (-970.516) (-974.959) [-944.443] (-966.682) -- 0:05:06
277000 -- (-982.321) (-956.533) (-949.579) [-949.619] * (-976.081) (-985.645) (-960.423) [-950.719] -- 0:05:07
277500 -- [-958.983] (-960.272) (-976.330) (-1002.994) * (-962.733) (-969.243) (-946.470) [-952.486] -- 0:05:07
278000 -- (-984.333) [-971.934] (-960.502) (-971.238) * (-952.900) [-960.260] (-990.897) (-963.663) -- 0:05:06
278500 -- (-983.953) (-968.860) [-947.639] (-977.605) * (-968.082) (-976.723) (-955.685) [-965.701] -- 0:05:05
279000 -- [-963.673] (-959.857) (-957.961) (-995.044) * (-966.745) (-975.968) (-966.986) [-964.550] -- 0:05:04
279500 -- [-954.137] (-982.511) (-963.969) (-985.352) * (-982.304) (-977.694) [-945.173] (-975.416) -- 0:05:06
280000 -- [-949.988] (-990.717) (-947.431) (-959.744) * (-983.578) (-966.364) [-953.639] (-988.843) -- 0:05:06
Average standard deviation of split frequencies: 0.017426
280500 -- [-959.491] (-1007.128) (-964.533) (-966.157) * (-977.462) [-947.334] (-978.822) (-980.610) -- 0:05:05
281000 -- (-946.223) (-998.222) [-951.839] (-978.737) * (-978.310) [-949.883] (-976.747) (-985.954) -- 0:05:04
281500 -- (-963.654) [-959.486] (-970.409) (-965.902) * (-982.215) (-952.624) [-962.223] (-991.403) -- 0:05:03
282000 -- (-972.672) (-944.282) [-948.432] (-988.921) * (-975.191) [-946.664] (-973.943) (-978.633) -- 0:05:02
282500 -- (-966.303) [-952.320] (-965.198) (-973.055) * (-981.060) (-964.882) [-965.801] (-972.123) -- 0:05:04
283000 -- (-989.097) (-966.514) [-956.207] (-985.427) * (-962.829) [-952.503] (-981.608) (-995.526) -- 0:05:04
283500 -- (-956.409) (-965.499) [-955.779] (-968.151) * (-972.991) (-973.422) [-956.519] (-973.451) -- 0:05:03
284000 -- (-951.116) (-971.085) [-951.597] (-950.884) * (-971.388) [-969.971] (-963.306) (-988.226) -- 0:05:02
284500 -- (-990.762) (-983.087) (-953.097) [-960.433] * (-962.107) (-983.026) [-977.215] (-997.869) -- 0:05:01
285000 -- (-982.016) (-979.544) (-950.248) [-947.791] * (-964.206) [-957.504] (-965.628) (-975.971) -- 0:05:03
Average standard deviation of split frequencies: 0.018543
285500 -- (-977.630) (-979.001) [-961.805] (-970.021) * (-985.519) (-964.424) [-964.922] (-976.204) -- 0:05:02
286000 -- [-971.860] (-969.423) (-962.712) (-984.783) * (-998.362) [-967.907] (-964.720) (-978.347) -- 0:05:02
286500 -- (-954.116) (-958.682) [-954.366] (-962.593) * [-964.828] (-971.106) (-952.770) (-965.686) -- 0:05:01
287000 -- [-957.286] (-970.141) (-986.790) (-974.906) * (-981.804) [-968.628] (-988.322) (-963.175) -- 0:05:00
287500 -- [-949.920] (-973.622) (-986.200) (-969.993) * (-975.899) [-954.508] (-968.819) (-979.424) -- 0:05:02
288000 -- (-979.172) (-970.278) (-974.372) [-958.406] * (-981.566) [-948.316] (-953.468) (-977.518) -- 0:05:01
288500 -- (-973.812) (-977.162) [-964.204] (-965.693) * (-965.635) (-975.629) (-955.977) [-972.514] -- 0:05:00
289000 -- (-982.495) (-974.753) (-971.879) [-956.032] * (-966.941) [-947.070] (-985.470) (-970.759) -- 0:05:00
289500 -- (-966.477) [-969.284] (-963.971) (-964.132) * (-976.712) [-960.825] (-977.375) (-955.355) -- 0:04:59
290000 -- (-983.377) (-962.185) (-957.933) [-955.939] * (-978.494) (-952.654) (-982.011) [-951.884] -- 0:05:01
Average standard deviation of split frequencies: 0.018093
290500 -- (-984.089) [-951.253] (-949.672) (-968.907) * (-963.048) (-982.285) (-967.998) [-967.670] -- 0:05:00
291000 -- (-974.199) (-972.314) [-961.722] (-982.875) * [-956.783] (-953.713) (-967.115) (-980.653) -- 0:04:59
291500 -- (-972.262) [-952.897] (-957.468) (-965.197) * (-973.551) (-977.090) [-945.503] (-968.141) -- 0:04:58
292000 -- (-973.475) (-960.903) [-965.358] (-968.413) * (-984.358) (-980.209) [-945.007] (-947.621) -- 0:04:58
292500 -- (-966.878) (-974.509) [-955.837] (-967.112) * [-952.533] (-967.404) (-968.266) (-950.459) -- 0:04:59
293000 -- (-959.774) (-969.908) [-949.206] (-1001.962) * (-952.777) (-965.943) (-981.153) [-957.407] -- 0:04:59
293500 -- (-978.330) (-967.272) (-991.310) [-958.357] * (-957.253) (-992.036) (-970.872) [-953.901] -- 0:04:58
294000 -- [-970.895] (-972.920) (-998.396) (-959.778) * (-985.170) [-971.293] (-970.706) (-979.224) -- 0:04:57
294500 -- (-961.573) (-966.965) (-983.313) [-958.392] * (-969.458) (-970.228) (-976.770) [-956.547] -- 0:04:57
295000 -- [-945.271] (-986.484) (-969.028) (-962.747) * (-952.388) (-966.098) (-988.303) [-953.260] -- 0:04:56
Average standard deviation of split frequencies: 0.018484
295500 -- [-944.331] (-988.291) (-978.242) (-965.738) * [-951.333] (-982.800) (-976.000) (-958.584) -- 0:04:58
296000 -- (-955.094) (-961.405) (-969.459) [-952.351] * [-963.502] (-961.544) (-972.499) (-971.124) -- 0:04:57
296500 -- (-974.150) [-950.279] (-967.914) (-963.922) * (-1000.421) (-976.551) [-964.493] (-967.693) -- 0:04:56
297000 -- (-975.531) (-948.584) [-961.754] (-981.881) * [-969.234] (-963.602) (-994.280) (-981.385) -- 0:04:55
297500 -- (-967.421) (-959.533) (-971.550) [-954.652] * (-977.192) [-951.505] (-970.330) (-982.582) -- 0:04:55
298000 -- (-979.516) (-974.517) (-982.323) [-953.425] * (-968.710) [-962.291] (-974.504) (-952.173) -- 0:04:56
298500 -- (-976.542) (-973.533) (-974.148) [-961.050] * (-969.310) (-975.236) [-951.548] (-962.225) -- 0:04:56
299000 -- (-981.122) (-958.854) (-976.547) [-950.290] * [-979.591] (-963.599) (-989.512) (-970.129) -- 0:04:55
299500 -- (-966.271) [-948.706] (-971.684) (-966.851) * (-962.756) (-962.394) [-947.688] (-989.016) -- 0:04:54
300000 -- (-968.559) [-947.670] (-968.591) (-972.784) * (-962.761) [-958.501] (-954.397) (-981.578) -- 0:04:54
Average standard deviation of split frequencies: 0.019059
300500 -- (-964.729) [-951.152] (-973.743) (-976.936) * [-955.695] (-951.313) (-974.851) (-996.634) -- 0:04:55
301000 -- (-964.859) (-956.438) (-971.962) [-963.959] * (-954.933) [-953.726] (-981.299) (-980.476) -- 0:04:54
301500 -- (-968.708) [-962.698] (-996.967) (-990.734) * [-956.020] (-963.177) (-978.827) (-967.381) -- 0:04:54
302000 -- (-984.150) [-948.939] (-997.118) (-973.166) * [-951.845] (-947.130) (-987.778) (-973.712) -- 0:04:53
302500 -- (-970.207) [-948.872] (-996.473) (-972.074) * (-980.550) [-949.694] (-967.336) (-999.147) -- 0:04:52
303000 -- (-967.673) [-952.632] (-985.902) (-965.952) * (-987.091) [-961.017] (-966.266) (-986.185) -- 0:04:54
303500 -- [-970.915] (-970.723) (-981.302) (-959.751) * (-972.596) (-957.938) [-954.761] (-967.115) -- 0:04:53
304000 -- (-985.766) (-975.802) (-986.755) [-948.065] * [-966.113] (-958.162) (-980.058) (-990.734) -- 0:04:53
304500 -- (-974.689) (-974.548) [-964.784] (-954.364) * [-952.247] (-967.459) (-974.587) (-975.610) -- 0:04:52
305000 -- (-971.671) (-979.786) [-957.045] (-965.380) * [-943.516] (-974.617) (-999.111) (-969.104) -- 0:04:51
Average standard deviation of split frequencies: 0.020027
305500 -- (-973.196) (-960.453) (-971.262) [-956.191] * (-972.422) (-959.804) (-991.070) [-947.394] -- 0:04:50
306000 -- (-986.689) (-974.423) (-957.914) [-953.575] * (-987.646) (-953.863) (-983.930) [-968.595] -- 0:04:52
306500 -- (-983.193) (-988.369) [-957.056] (-981.010) * (-981.960) [-963.645] (-986.022) (-961.163) -- 0:04:51
307000 -- (-973.892) (-984.798) [-949.069] (-967.686) * (-968.319) (-967.631) (-992.502) [-955.544] -- 0:04:51
307500 -- (-979.863) (-965.880) [-954.392] (-984.729) * [-949.579] (-967.187) (-972.862) (-951.736) -- 0:04:50
308000 -- (-991.031) (-963.631) (-984.409) [-956.107] * [-956.067] (-980.215) (-970.844) (-963.797) -- 0:04:49
308500 -- (-991.519) (-966.811) [-969.970] (-964.373) * (-960.790) (-979.763) (-964.210) [-970.767] -- 0:04:51
309000 -- (-977.707) (-964.178) (-974.370) [-952.197] * [-956.270] (-979.321) (-965.764) (-989.903) -- 0:04:50
309500 -- (-976.322) (-974.448) (-958.113) [-951.889] * [-964.722] (-977.261) (-961.291) (-981.374) -- 0:04:50
310000 -- (-975.479) (-963.177) [-960.565] (-950.291) * (-962.619) [-952.927] (-985.360) (-977.409) -- 0:04:49
Average standard deviation of split frequencies: 0.021054
310500 -- (-1004.912) (-981.345) (-956.148) [-951.816] * [-960.442] (-986.679) (-966.020) (-971.032) -- 0:04:48
311000 -- (-982.418) (-974.076) (-969.200) [-955.602] * [-961.757] (-959.658) (-961.009) (-993.333) -- 0:04:50
311500 -- (-990.198) (-964.197) [-956.007] (-964.806) * (-955.423) [-962.441] (-972.403) (-991.823) -- 0:04:49
312000 -- (-994.044) (-973.409) (-965.734) [-961.859] * [-957.510] (-974.357) (-964.853) (-987.451) -- 0:04:48
312500 -- (-995.228) (-984.966) [-948.212] (-951.333) * [-957.390] (-985.046) (-966.389) (-974.794) -- 0:04:48
313000 -- (-984.295) (-976.758) [-954.904] (-958.126) * [-953.293] (-991.634) (-969.539) (-977.933) -- 0:04:47
313500 -- (-999.803) (-974.474) [-954.428] (-963.352) * [-957.175] (-966.613) (-966.651) (-961.389) -- 0:04:49
314000 -- (-984.266) [-956.518] (-967.436) (-965.133) * [-953.816] (-958.138) (-967.400) (-987.302) -- 0:04:48
314500 -- (-997.557) (-949.267) [-955.939] (-968.963) * (-958.438) (-962.794) (-981.055) [-973.142] -- 0:04:47
315000 -- (-979.080) (-959.595) [-951.904] (-974.211) * (-948.973) (-961.978) [-945.980] (-964.827) -- 0:04:47
Average standard deviation of split frequencies: 0.020837
315500 -- (-971.336) [-959.039] (-980.640) (-984.962) * (-990.348) (-975.731) (-957.613) [-962.751] -- 0:04:46
316000 -- (-975.392) [-956.117] (-964.154) (-984.180) * (-970.707) [-967.462] (-954.104) (-974.580) -- 0:04:47
316500 -- (-968.351) (-970.342) [-959.671] (-988.094) * [-971.158] (-957.515) (-972.055) (-990.707) -- 0:04:47
317000 -- (-976.920) [-952.102] (-953.083) (-980.993) * (-976.418) [-955.232] (-962.129) (-972.143) -- 0:04:46
317500 -- (-969.014) [-956.896] (-979.361) (-995.005) * (-983.984) (-989.935) [-953.855] (-974.856) -- 0:04:45
318000 -- (-962.497) [-949.964] (-976.296) (-981.789) * [-973.250] (-987.610) (-972.485) (-966.254) -- 0:04:45
318500 -- [-953.227] (-948.703) (-978.274) (-968.271) * (-970.082) (-983.652) (-957.164) [-956.874] -- 0:04:44
319000 -- (-972.531) [-949.124] (-968.506) (-954.423) * (-970.683) (-976.115) [-947.003] (-959.412) -- 0:04:46
319500 -- (-973.686) (-982.143) [-963.799] (-979.005) * (-982.000) (-972.621) [-955.397] (-953.966) -- 0:04:45
320000 -- (-972.713) (-968.408) (-965.827) [-964.239] * (-991.572) (-966.219) [-950.325] (-958.828) -- 0:04:44
Average standard deviation of split frequencies: 0.020202
320500 -- [-971.496] (-975.284) (-974.898) (-964.629) * (-1002.898) [-968.188] (-947.465) (-977.935) -- 0:04:44
321000 -- (-964.406) [-967.742] (-981.241) (-966.622) * (-968.614) (-958.082) [-965.230] (-998.692) -- 0:04:45
321500 -- (-959.225) [-947.047] (-982.639) (-959.952) * [-958.074] (-963.334) (-953.290) (-961.723) -- 0:04:44
322000 -- [-948.044] (-957.091) (-977.270) (-979.179) * (-959.380) (-967.059) [-946.599] (-991.308) -- 0:04:44
322500 -- (-962.281) [-951.661] (-976.732) (-975.721) * (-972.638) (-972.481) [-938.868] (-1002.135) -- 0:04:43
323000 -- (-972.513) (-961.415) (-966.562) [-966.114] * (-968.970) (-971.055) [-954.633] (-987.352) -- 0:04:45
323500 -- [-957.789] (-964.516) (-958.581) (-983.169) * (-965.628) [-958.924] (-957.421) (-973.585) -- 0:04:44
324000 -- [-952.522] (-978.779) (-959.523) (-972.190) * (-967.349) [-958.926] (-965.333) (-975.707) -- 0:04:43
324500 -- (-965.667) (-972.703) [-952.996] (-976.319) * (-974.949) (-965.526) (-962.667) [-972.005] -- 0:04:43
325000 -- (-966.183) (-983.638) [-942.947] (-981.369) * (-973.469) (-973.683) (-989.094) [-956.244] -- 0:04:42
Average standard deviation of split frequencies: 0.018974
325500 -- (-947.530) (-993.084) [-950.113] (-980.468) * (-963.557) (-985.294) (-966.373) [-952.198] -- 0:04:43
326000 -- (-952.401) (-992.782) [-942.101] (-955.712) * (-975.882) (-992.017) (-957.776) [-942.525] -- 0:04:43
326500 -- [-957.860] (-994.750) (-953.416) (-967.362) * (-975.538) (-966.930) (-955.259) [-964.281] -- 0:04:42
327000 -- (-959.862) (-986.633) [-947.876] (-967.540) * (-973.242) (-970.897) (-967.385) [-963.364] -- 0:04:41
327500 -- (-966.015) (-998.124) [-964.537] (-970.592) * (-966.020) (-954.430) (-961.897) [-957.885] -- 0:04:43
328000 -- (-978.033) (-979.336) [-953.758] (-975.455) * [-965.176] (-958.457) (-952.480) (-954.983) -- 0:04:42
328500 -- (-954.993) (-985.068) [-952.700] (-981.185) * (-979.947) (-959.040) [-939.560] (-963.337) -- 0:04:42
329000 -- (-951.493) (-958.773) [-957.770] (-998.239) * (-975.331) (-974.056) [-965.516] (-955.908) -- 0:04:41
329500 -- [-952.326] (-957.849) (-977.425) (-993.238) * (-967.693) (-976.015) (-978.870) [-956.993] -- 0:04:42
330000 -- [-954.131] (-964.987) (-957.966) (-977.247) * (-968.787) (-972.236) [-957.822] (-948.672) -- 0:04:42
Average standard deviation of split frequencies: 0.019181
330500 -- [-954.082] (-976.334) (-969.276) (-972.304) * (-965.289) (-952.964) (-981.349) [-960.076] -- 0:04:41
331000 -- [-956.533] (-978.652) (-959.851) (-983.331) * (-955.893) [-945.573] (-982.804) (-985.345) -- 0:04:40
331500 -- (-959.500) (-983.089) [-967.946] (-978.920) * (-947.716) [-954.018] (-976.897) (-976.622) -- 0:04:40
332000 -- (-963.712) (-973.586) [-965.056] (-974.846) * [-945.091] (-965.774) (-983.725) (-961.456) -- 0:04:41
332500 -- (-972.665) (-973.109) (-956.642) [-967.240] * [-957.683] (-992.923) (-984.769) (-970.980) -- 0:04:41
333000 -- (-977.260) [-951.623] (-954.484) (-971.273) * [-954.726] (-968.547) (-964.431) (-966.708) -- 0:04:40
333500 -- (-969.794) [-947.708] (-960.498) (-981.666) * [-954.604] (-991.689) (-956.430) (-962.932) -- 0:04:39
334000 -- (-989.795) [-945.231] (-952.914) (-980.920) * (-971.432) (-974.326) (-958.162) [-958.498] -- 0:04:41
334500 -- (-973.657) (-955.664) [-961.943] (-977.625) * (-966.324) (-959.215) (-968.330) [-948.118] -- 0:04:40
335000 -- (-983.010) (-967.113) [-958.619] (-982.609) * (-976.480) (-968.044) (-963.829) [-958.935] -- 0:04:39
Average standard deviation of split frequencies: 0.019514
335500 -- (-985.241) [-947.617] (-963.640) (-993.779) * (-962.161) (-967.901) (-964.214) [-951.350] -- 0:04:39
336000 -- (-986.327) [-965.972] (-973.518) (-983.821) * (-968.019) (-967.060) [-966.963] (-975.220) -- 0:04:38
336500 -- (-964.535) [-961.665] (-990.650) (-986.640) * (-963.347) (-986.699) [-964.382] (-963.433) -- 0:04:39
337000 -- [-958.313] (-951.897) (-971.885) (-970.460) * (-973.944) (-975.868) [-961.401] (-972.639) -- 0:04:39
337500 -- [-954.507] (-949.584) (-978.707) (-968.717) * [-960.580] (-971.862) (-960.559) (-958.207) -- 0:04:38
338000 -- (-970.535) (-964.524) [-963.507] (-986.943) * (-954.848) (-992.515) (-950.560) [-966.503] -- 0:04:38
338500 -- [-951.727] (-975.120) (-959.501) (-971.045) * (-970.109) (-990.526) (-965.258) [-969.324] -- 0:04:39
339000 -- (-963.501) [-955.380] (-958.650) (-975.788) * [-959.635] (-979.496) (-979.753) (-968.929) -- 0:04:38
339500 -- (-984.822) [-956.557] (-961.567) (-988.624) * [-959.609] (-982.331) (-959.152) (-975.796) -- 0:04:38
340000 -- (-963.482) [-966.965] (-951.925) (-984.241) * (-981.381) (-986.542) (-968.471) [-951.275] -- 0:04:37
Average standard deviation of split frequencies: 0.018534
340500 -- (-982.680) (-971.898) [-949.743] (-963.723) * (-986.516) (-980.250) [-959.630] (-967.262) -- 0:04:38
341000 -- (-970.195) (-956.517) [-952.561] (-980.253) * [-956.580] (-986.782) (-962.701) (-973.354) -- 0:04:38
341500 -- [-968.710] (-960.695) (-965.727) (-978.864) * (-969.939) (-970.890) (-975.758) [-954.548] -- 0:04:37
342000 -- (-964.129) (-970.391) [-955.827] (-985.731) * (-965.171) (-998.248) (-998.580) [-952.067] -- 0:04:37
342500 -- (-968.244) (-962.524) [-943.910] (-982.816) * (-967.794) (-980.789) (-971.404) [-951.722] -- 0:04:36
343000 -- (-983.038) (-972.297) [-948.102] (-987.518) * (-967.698) (-982.420) (-967.631) [-942.320] -- 0:04:37
343500 -- (-968.596) (-956.015) [-956.555] (-1003.232) * (-965.960) (-983.591) (-976.940) [-954.491] -- 0:04:37
344000 -- (-949.303) (-974.509) [-942.311] (-1002.694) * (-979.338) (-984.075) (-970.139) [-951.219] -- 0:04:36
344500 -- (-957.137) [-948.834] (-985.058) (-982.030) * (-973.231) (-988.192) (-967.093) [-960.067] -- 0:04:35
345000 -- (-966.584) (-960.878) [-955.120] (-980.440) * (-964.890) (-997.296) (-958.597) [-953.510] -- 0:04:37
Average standard deviation of split frequencies: 0.017471
345500 -- (-965.226) [-948.023] (-978.517) (-977.418) * [-955.813] (-983.210) (-971.075) (-983.618) -- 0:04:36
346000 -- [-955.537] (-989.232) (-976.912) (-975.339) * (-963.693) (-980.112) [-957.339] (-974.754) -- 0:04:35
346500 -- [-957.885] (-964.896) (-984.091) (-973.857) * (-950.400) (-977.051) (-967.190) [-955.091] -- 0:04:35
347000 -- (-974.244) [-950.681] (-981.852) (-966.707) * [-958.263] (-994.045) (-972.109) (-961.831) -- 0:04:36
347500 -- [-948.074] (-973.695) (-997.504) (-980.435) * (-981.042) (-985.145) (-968.402) [-946.866] -- 0:04:36
348000 -- (-972.120) [-969.181] (-981.873) (-984.994) * [-965.677] (-991.520) (-978.913) (-952.656) -- 0:04:35
348500 -- [-969.108] (-967.331) (-956.766) (-973.134) * (-979.027) (-982.178) [-960.639] (-976.180) -- 0:04:34
349000 -- (-963.229) (-961.072) [-962.888] (-971.919) * (-964.790) (-988.304) (-963.932) [-967.848] -- 0:04:36
349500 -- (-996.232) (-945.457) [-968.007] (-965.092) * [-958.036] (-983.885) (-964.318) (-980.819) -- 0:04:35
350000 -- (-981.581) [-942.502] (-976.966) (-972.391) * [-968.807] (-983.510) (-975.695) (-967.979) -- 0:04:34
Average standard deviation of split frequencies: 0.016725
350500 -- (-978.328) [-946.944] (-990.134) (-979.024) * (-970.591) (-989.915) (-984.445) [-951.336] -- 0:04:34
351000 -- (-960.570) [-947.347] (-966.590) (-1002.063) * [-972.119] (-981.384) (-976.456) (-963.134) -- 0:04:33
351500 -- [-966.433] (-959.603) (-964.661) (-994.540) * (-974.625) (-991.613) (-982.349) [-954.433] -- 0:04:34
352000 -- (-969.972) [-959.512] (-972.120) (-988.033) * [-954.464] (-972.695) (-979.977) (-986.254) -- 0:04:34
352500 -- (-968.402) (-962.719) [-957.591] (-991.378) * [-951.957] (-971.381) (-986.485) (-999.816) -- 0:04:33
353000 -- (-981.753) (-974.176) [-964.098] (-995.497) * (-973.292) (-974.931) (-982.693) [-973.388] -- 0:04:33
353500 -- (-973.982) (-974.079) [-966.758] (-973.053) * (-962.293) (-979.204) (-976.113) [-967.292] -- 0:04:34
354000 -- (-963.547) (-957.157) [-960.359] (-967.019) * (-959.207) (-988.733) (-974.685) [-951.223] -- 0:04:33
354500 -- [-969.851] (-956.429) (-964.699) (-983.209) * [-961.242] (-983.596) (-974.516) (-945.786) -- 0:04:33
355000 -- (-973.112) (-961.707) [-959.006] (-989.871) * [-947.867] (-992.601) (-981.729) (-958.159) -- 0:04:32
Average standard deviation of split frequencies: 0.017253
355500 -- (-982.743) [-969.884] (-964.741) (-976.193) * (-963.331) (-979.364) (-977.920) [-943.758] -- 0:04:33
356000 -- (-978.831) [-957.527] (-972.272) (-985.949) * (-981.647) (-967.690) (-989.083) [-966.031] -- 0:04:33
356500 -- (-970.383) [-953.504] (-973.908) (-976.312) * (-970.820) (-974.714) (-967.717) [-955.826] -- 0:04:32
357000 -- (-962.987) [-954.576] (-966.619) (-961.656) * (-987.583) (-967.513) (-971.674) [-944.048] -- 0:04:31
357500 -- (-974.866) [-942.084] (-982.885) (-953.615) * (-975.723) (-967.698) [-970.635] (-955.109) -- 0:04:31
358000 -- (-977.773) [-961.670] (-972.434) (-962.261) * (-974.330) (-965.571) (-982.934) [-956.502] -- 0:04:32
358500 -- (-973.644) (-977.693) [-963.805] (-947.968) * [-951.061] (-969.258) (-967.910) (-974.528) -- 0:04:31
359000 -- (-953.451) (-973.101) (-968.158) [-953.582] * [-951.558] (-978.168) (-967.566) (-963.946) -- 0:04:31
359500 -- (-973.747) (-984.238) (-979.356) [-952.236] * (-971.225) [-958.321] (-968.156) (-961.276) -- 0:04:30
360000 -- [-960.052] (-990.240) (-963.989) (-974.618) * (-964.772) (-955.438) [-970.562] (-962.852) -- 0:04:32
Average standard deviation of split frequencies: 0.017863
360500 -- [-947.769] (-979.856) (-976.479) (-966.486) * (-966.563) [-962.356] (-966.691) (-956.559) -- 0:04:31
361000 -- (-966.037) (-995.313) [-964.061] (-969.196) * (-945.958) (-961.965) (-961.938) [-946.964] -- 0:04:30
361500 -- (-968.629) (-1008.289) (-972.664) [-957.539] * (-981.417) (-976.408) (-982.933) [-939.217] -- 0:04:30
362000 -- (-971.478) (-996.656) [-961.478] (-963.082) * [-964.725] (-978.377) (-959.695) (-973.416) -- 0:04:29
362500 -- (-953.349) [-954.104] (-973.644) (-968.625) * (-971.005) (-984.981) [-958.713] (-955.807) -- 0:04:30
363000 -- [-954.350] (-961.982) (-950.987) (-982.378) * (-963.763) (-984.571) (-955.627) [-954.156] -- 0:04:30
363500 -- [-953.147] (-946.767) (-988.293) (-976.001) * (-964.672) (-966.140) (-956.316) [-959.969] -- 0:04:29
364000 -- [-944.082] (-970.742) (-975.522) (-982.001) * (-968.574) (-966.787) [-956.064] (-957.122) -- 0:04:29
364500 -- [-955.748] (-957.771) (-971.154) (-970.140) * (-964.933) [-954.232] (-980.637) (-972.975) -- 0:04:30
365000 -- (-970.499) (-971.464) [-953.651] (-982.997) * (-972.504) [-951.125] (-972.857) (-973.046) -- 0:04:29
Average standard deviation of split frequencies: 0.016471
365500 -- (-954.881) (-987.008) [-960.387] (-980.374) * (-963.825) [-963.587] (-959.697) (-968.276) -- 0:04:29
366000 -- (-983.170) [-951.717] (-964.763) (-982.921) * (-963.160) (-980.135) (-967.455) [-952.178] -- 0:04:28
366500 -- (-978.279) (-961.212) [-967.821] (-992.116) * (-976.665) (-972.254) [-960.820] (-957.333) -- 0:04:29
367000 -- (-974.010) [-961.661] (-976.674) (-982.155) * (-976.521) (-974.910) (-988.165) [-953.452] -- 0:04:29
367500 -- [-960.230] (-969.444) (-958.201) (-999.082) * (-972.063) (-983.627) (-970.621) [-951.597] -- 0:04:28
368000 -- (-960.313) (-985.410) [-953.280] (-988.686) * [-962.626] (-970.689) (-982.427) (-975.675) -- 0:04:27
368500 -- (-964.824) (-968.007) [-963.583] (-975.496) * (-984.666) [-955.815] (-965.848) (-972.437) -- 0:04:27
369000 -- [-970.286] (-954.249) (-984.362) (-968.084) * (-965.635) (-962.577) [-960.992] (-978.999) -- 0:04:28
369500 -- (-964.422) [-956.735] (-970.067) (-973.166) * (-970.306) (-959.319) (-968.239) [-959.651] -- 0:04:27
370000 -- (-953.973) [-967.028] (-986.086) (-969.371) * (-977.241) (-960.181) (-958.012) [-953.281] -- 0:04:27
Average standard deviation of split frequencies: 0.015531
370500 -- [-955.388] (-959.357) (-976.966) (-982.389) * (-954.034) (-980.332) (-979.050) [-940.495] -- 0:04:26
371000 -- [-961.023] (-976.918) (-976.254) (-981.179) * (-960.979) (-978.986) (-976.449) [-952.642] -- 0:04:26
371500 -- (-960.167) (-967.385) (-968.312) [-965.742] * (-979.930) [-976.046] (-989.518) (-952.730) -- 0:04:27
372000 -- [-951.596] (-990.208) (-977.281) (-971.486) * (-982.235) (-985.669) (-970.306) [-949.674] -- 0:04:26
372500 -- [-960.312] (-971.982) (-967.023) (-970.031) * (-969.903) [-970.432] (-990.363) (-958.039) -- 0:04:26
373000 -- (-983.962) (-976.412) [-947.720] (-973.152) * (-963.816) (-982.177) (-971.779) [-948.758] -- 0:04:25
373500 -- (-974.946) (-957.320) [-955.694] (-974.158) * [-957.235] (-983.173) (-990.429) (-958.916) -- 0:04:26
374000 -- (-962.219) (-975.738) [-950.058] (-977.026) * [-952.823] (-972.855) (-977.406) (-956.559) -- 0:04:26
374500 -- (-962.946) (-957.781) [-949.813] (-978.426) * (-954.497) (-970.307) (-975.667) [-966.876] -- 0:04:25
375000 -- [-942.424] (-963.788) (-961.629) (-948.895) * [-970.415] (-972.754) (-979.275) (-967.156) -- 0:04:25
Average standard deviation of split frequencies: 0.014855
375500 -- (-950.865) [-947.275] (-962.118) (-953.643) * (-974.005) [-966.976] (-968.288) (-979.323) -- 0:04:24
376000 -- (-963.486) (-968.576) (-970.572) [-955.572] * [-959.042] (-965.021) (-991.137) (-970.002) -- 0:04:25
376500 -- (-972.982) [-959.888] (-965.213) (-956.430) * [-950.686] (-964.797) (-969.650) (-981.989) -- 0:04:24
377000 -- (-961.215) (-964.409) (-977.683) [-953.409] * (-973.295) (-972.329) [-969.912] (-949.774) -- 0:04:24
377500 -- (-963.514) (-955.022) (-972.287) [-963.410] * (-975.498) (-957.034) [-957.760] (-967.139) -- 0:04:23
378000 -- (-970.672) [-955.935] (-994.450) (-962.295) * (-980.516) (-963.190) [-941.383] (-967.820) -- 0:04:24
378500 -- (-977.115) [-964.029] (-976.823) (-981.360) * (-987.434) (-955.985) [-935.530] (-965.189) -- 0:04:24
379000 -- [-967.435] (-967.369) (-997.049) (-951.167) * (-980.058) (-978.504) [-941.675] (-959.417) -- 0:04:23
379500 -- (-981.629) [-967.252] (-976.793) (-962.493) * (-976.250) (-966.214) [-944.287] (-986.983) -- 0:04:23
380000 -- (-962.990) [-947.699] (-985.369) (-957.359) * (-962.934) [-957.387] (-959.546) (-1001.164) -- 0:04:22
Average standard deviation of split frequencies: 0.014898
380500 -- (-971.046) [-951.905] (-988.919) (-962.345) * (-974.278) [-962.580] (-959.999) (-962.596) -- 0:04:23
381000 -- (-969.729) [-954.282] (-991.987) (-965.642) * (-985.761) (-958.612) (-958.345) [-968.137] -- 0:04:23
381500 -- (-971.813) (-968.359) (-972.392) [-948.088] * (-999.941) [-966.389] (-958.635) (-977.961) -- 0:04:22
382000 -- (-959.453) (-960.240) (-962.542) [-947.156] * (-966.051) [-944.501] (-995.291) (-977.637) -- 0:04:22
382500 -- (-955.721) [-949.026] (-969.798) (-961.779) * (-971.364) (-965.689) [-970.406] (-985.503) -- 0:04:23
383000 -- (-971.870) (-963.708) (-971.383) [-954.676] * (-968.911) (-976.173) (-977.378) [-963.081] -- 0:04:22
383500 -- [-959.154] (-987.364) (-956.218) (-967.092) * (-966.848) [-968.216] (-998.509) (-962.818) -- 0:04:22
384000 -- (-962.646) (-978.053) [-959.899] (-993.758) * (-981.458) [-951.975] (-971.037) (-948.913) -- 0:04:21
384500 -- [-953.274] (-983.500) (-950.022) (-983.020) * (-967.586) (-982.146) [-960.863] (-978.019) -- 0:04:22
385000 -- [-954.470] (-968.168) (-957.518) (-971.918) * (-976.714) (-955.792) (-958.179) [-963.029] -- 0:04:21
Average standard deviation of split frequencies: 0.015062
385500 -- (-950.221) (-982.276) [-958.711] (-977.731) * (-973.734) (-967.113) [-961.643] (-969.717) -- 0:04:21
386000 -- (-979.322) (-1001.055) [-955.537] (-993.276) * (-958.101) [-971.002] (-968.160) (-960.095) -- 0:04:20
386500 -- [-962.773] (-978.922) (-948.684) (-976.104) * (-967.539) (-976.916) (-966.430) [-960.768] -- 0:04:20
387000 -- [-957.248] (-964.824) (-959.180) (-973.798) * (-987.366) (-973.757) (-985.028) [-958.657] -- 0:04:21
387500 -- [-966.950] (-961.344) (-967.136) (-970.266) * (-971.000) (-1007.473) [-965.572] (-956.244) -- 0:04:20
388000 -- (-977.601) [-963.768] (-974.578) (-951.999) * (-971.777) (-1000.440) [-973.885] (-964.461) -- 0:04:20
388500 -- [-954.464] (-962.694) (-978.428) (-968.126) * [-966.605] (-978.667) (-998.089) (-960.038) -- 0:04:19
389000 -- [-948.316] (-970.289) (-971.343) (-972.834) * (-981.370) [-954.945] (-974.545) (-960.515) -- 0:04:20
389500 -- [-950.899] (-974.790) (-981.562) (-972.258) * (-975.804) [-950.186] (-1004.024) (-968.253) -- 0:04:20
390000 -- [-949.658] (-994.977) (-963.348) (-948.789) * (-965.725) [-942.090] (-966.076) (-992.087) -- 0:04:19
Average standard deviation of split frequencies: 0.015284
390500 -- [-948.952] (-965.666) (-972.186) (-965.850) * (-961.245) [-953.826] (-991.661) (-977.677) -- 0:04:19
391000 -- (-956.292) (-970.177) [-966.926] (-972.634) * (-961.190) [-958.014] (-1001.763) (-988.520) -- 0:04:20
391500 -- [-956.984] (-962.459) (-979.380) (-960.181) * (-975.389) (-960.080) (-984.737) [-970.754] -- 0:04:19
392000 -- [-946.626] (-956.417) (-1006.646) (-961.507) * (-965.813) (-969.482) (-961.071) [-957.834] -- 0:04:19
392500 -- [-944.594] (-973.483) (-964.590) (-957.556) * (-954.480) (-970.726) (-958.408) [-957.635] -- 0:04:18
393000 -- [-947.705] (-973.292) (-994.053) (-973.907) * [-947.808] (-995.643) (-958.682) (-957.138) -- 0:04:19
393500 -- [-950.446] (-970.240) (-988.605) (-978.145) * (-968.306) (-1000.751) [-954.582] (-978.077) -- 0:04:18
394000 -- [-955.034] (-973.641) (-976.229) (-977.031) * [-962.089] (-968.761) (-968.952) (-977.313) -- 0:04:18
394500 -- (-959.357) (-975.462) [-959.428] (-980.302) * [-940.112] (-980.855) (-971.001) (-963.218) -- 0:04:17
395000 -- (-953.637) (-970.526) [-952.869] (-981.008) * (-965.355) (-984.083) [-963.901] (-970.418) -- 0:04:17
Average standard deviation of split frequencies: 0.016522
395500 -- (-958.806) (-974.324) [-953.096] (-973.091) * (-965.678) (-982.075) [-951.452] (-951.671) -- 0:04:18
396000 -- (-968.537) (-976.510) [-953.147] (-979.900) * (-972.874) (-977.222) (-963.769) [-958.025] -- 0:04:17
396500 -- (-979.936) (-966.569) (-956.296) [-961.700] * [-960.682] (-969.370) (-971.393) (-975.846) -- 0:04:17
397000 -- (-960.583) (-952.426) [-954.293] (-986.163) * (-964.412) [-951.006] (-972.471) (-975.152) -- 0:04:16
397500 -- (-963.744) (-968.330) [-942.688] (-991.699) * (-986.039) [-964.591] (-973.417) (-970.786) -- 0:04:17
398000 -- (-965.663) (-958.168) [-950.246] (-980.213) * [-969.044] (-987.639) (-987.008) (-979.157) -- 0:04:17
398500 -- (-987.295) (-986.359) [-949.018] (-970.112) * (-990.980) [-962.889] (-959.622) (-967.690) -- 0:04:16
399000 -- (-969.160) (-989.816) [-958.015] (-975.402) * (-1002.715) (-945.860) (-960.169) [-960.806] -- 0:04:16
399500 -- (-959.748) (-992.488) [-963.520] (-963.655) * (-1011.360) [-954.268] (-963.675) (-960.671) -- 0:04:15
400000 -- (-972.700) (-975.845) [-958.107] (-957.672) * (-1002.837) (-955.761) [-943.355] (-973.229) -- 0:04:16
Average standard deviation of split frequencies: 0.017256
400500 -- (-978.504) (-988.068) [-955.472] (-953.408) * (-1001.664) [-948.046] (-961.992) (-969.123) -- 0:04:15
401000 -- (-956.664) (-977.472) [-952.334] (-974.362) * (-988.210) (-968.221) [-946.098] (-958.712) -- 0:04:15
401500 -- (-970.162) (-986.066) (-953.434) [-956.381] * (-983.959) (-970.888) (-945.732) [-958.085] -- 0:04:14
402000 -- (-990.734) (-982.625) (-951.107) [-950.574] * (-959.626) (-980.230) [-950.725] (-995.077) -- 0:04:15
402500 -- (-991.321) (-974.004) [-950.489] (-968.097) * [-957.357] (-950.902) (-954.867) (-963.669) -- 0:04:15
403000 -- (-979.131) (-972.361) [-951.652] (-959.618) * (-983.273) (-960.733) [-952.642] (-986.490) -- 0:04:14
403500 -- (-996.959) (-980.735) [-950.623] (-975.133) * (-956.489) [-956.595] (-960.760) (-983.017) -- 0:04:14
404000 -- (-983.874) (-970.293) [-965.760] (-976.127) * [-954.080] (-962.433) (-977.562) (-966.246) -- 0:04:13
404500 -- (-981.097) (-966.806) [-967.577] (-968.756) * [-946.862] (-963.825) (-985.597) (-974.514) -- 0:04:14
405000 -- (-991.905) (-987.928) [-951.440] (-972.673) * (-950.081) (-1005.946) [-954.134] (-976.763) -- 0:04:14
Average standard deviation of split frequencies: 0.017452
405500 -- (-988.338) (-973.369) [-955.083] (-977.138) * [-952.709] (-970.009) (-974.965) (-974.078) -- 0:04:13
406000 -- (-1007.661) (-971.928) (-964.305) [-964.854] * (-965.981) (-971.671) (-969.467) [-973.830] -- 0:04:13
406500 -- (-986.794) (-986.952) (-975.448) [-951.236] * [-952.721] (-967.001) (-971.508) (-984.407) -- 0:04:14
407000 -- (-990.643) (-982.456) (-983.062) [-944.629] * [-957.481] (-967.284) (-962.117) (-965.852) -- 0:04:13
407500 -- (-985.807) (-969.817) (-972.129) [-959.716] * [-953.554] (-970.264) (-959.380) (-976.842) -- 0:04:12
408000 -- (-985.405) (-981.228) (-961.063) [-953.576] * [-954.290] (-972.399) (-960.641) (-962.665) -- 0:04:12
408500 -- (-982.097) (-966.227) (-956.565) [-960.623] * [-952.936] (-964.740) (-969.387) (-967.004) -- 0:04:11
409000 -- (-984.976) (-981.757) [-946.601] (-963.221) * (-969.498) [-958.840] (-977.425) (-994.398) -- 0:04:12
409500 -- (-982.797) (-968.675) (-963.773) [-953.228] * (-958.193) [-950.771] (-980.721) (-996.605) -- 0:04:12
410000 -- (-956.445) (-965.621) [-963.741] (-966.323) * [-964.180] (-970.423) (-974.836) (-979.152) -- 0:04:11
Average standard deviation of split frequencies: 0.017845
410500 -- (-952.027) (-988.604) (-958.238) [-951.441] * [-948.846] (-970.599) (-975.284) (-978.288) -- 0:04:11
411000 -- [-962.093] (-957.222) (-991.767) (-980.177) * (-961.060) (-972.970) (-978.377) [-963.884] -- 0:04:12
411500 -- (-962.459) (-970.010) (-1004.378) [-954.979] * (-981.521) (-973.286) [-970.036] (-975.830) -- 0:04:11
412000 -- (-973.871) (-971.421) (-989.375) [-952.764] * (-987.141) (-989.973) [-957.489] (-980.931) -- 0:04:11
412500 -- [-955.935] (-979.207) (-967.114) (-976.043) * (-962.119) (-1004.736) [-949.773] (-972.491) -- 0:04:10
413000 -- (-979.131) [-953.005] (-966.318) (-973.650) * (-968.143) (-985.448) (-963.685) [-972.265] -- 0:04:10
413500 -- (-971.743) (-967.265) (-976.687) [-954.971] * [-964.681] (-983.726) (-961.820) (-975.204) -- 0:04:11
414000 -- (-987.400) (-975.502) (-963.531) [-959.179] * [-953.583] (-987.499) (-956.646) (-993.015) -- 0:04:10
414500 -- (-970.639) (-973.158) [-958.753] (-970.177) * (-964.241) (-986.585) (-963.414) [-949.520] -- 0:04:10
415000 -- (-959.104) (-960.770) (-966.528) [-941.692] * (-971.482) (-976.963) [-957.925] (-979.525) -- 0:04:09
Average standard deviation of split frequencies: 0.018097
415500 -- (-986.958) (-968.954) [-963.583] (-952.407) * (-978.705) (-966.053) (-968.904) [-942.304] -- 0:04:08
416000 -- (-966.783) (-976.119) [-949.010] (-980.401) * (-971.669) [-952.914] (-982.806) (-960.220) -- 0:04:09
416500 -- (-977.151) (-966.591) [-953.762] (-958.758) * (-987.796) [-942.461] (-989.195) (-968.033) -- 0:04:09
417000 -- (-994.999) (-987.375) [-961.445] (-974.973) * (-971.607) (-965.419) (-967.983) [-969.134] -- 0:04:08
417500 -- (-976.711) (-968.842) (-953.044) [-958.887] * (-985.760) (-963.297) (-959.807) [-950.093] -- 0:04:08
418000 -- (-982.628) (-979.206) [-962.148] (-971.628) * (-977.223) (-960.644) [-950.055] (-969.658) -- 0:04:09
418500 -- (-984.013) (-997.546) [-949.731] (-958.105) * (-981.349) (-970.385) (-969.787) [-953.417] -- 0:04:08
419000 -- (-955.157) (-974.323) (-972.899) [-954.259] * (-973.212) (-980.653) (-981.614) [-954.711] -- 0:04:08
419500 -- (-966.239) (-979.837) (-965.482) [-954.955] * (-964.911) [-964.962] (-980.312) (-949.016) -- 0:04:07
420000 -- (-966.408) (-974.873) [-965.576] (-982.149) * [-958.685] (-967.839) (-991.794) (-955.259) -- 0:04:08
Average standard deviation of split frequencies: 0.018630
420500 -- (-959.052) (-977.250) (-967.688) [-963.213] * [-973.905] (-954.426) (-968.004) (-969.046) -- 0:04:08
421000 -- (-961.406) (-986.781) [-968.639] (-954.855) * (-972.092) [-961.335] (-974.739) (-950.052) -- 0:04:07
421500 -- (-965.714) (-992.505) [-953.589] (-958.987) * (-956.965) (-968.275) (-998.440) [-957.115] -- 0:04:07
422000 -- (-987.825) (-973.653) (-965.311) [-971.296] * (-985.243) (-969.737) (-969.728) [-959.631] -- 0:04:06
422500 -- (-976.509) (-972.739) [-960.456] (-975.379) * (-981.701) (-990.822) [-960.775] (-970.863) -- 0:04:07
423000 -- (-989.884) [-966.010] (-965.397) (-956.839) * (-975.683) (-984.457) [-969.973] (-965.586) -- 0:04:06
423500 -- (-987.223) (-962.913) (-951.881) [-952.586] * [-963.520] (-1008.953) (-957.660) (-965.038) -- 0:04:06
424000 -- (-987.447) (-975.849) (-971.366) [-951.220] * [-955.097] (-988.895) (-985.274) (-971.735) -- 0:04:05
424500 -- (-972.747) (-972.848) (-957.715) [-956.923] * [-955.251] (-989.169) (-977.576) (-966.189) -- 0:04:06
425000 -- (-965.688) (-999.790) (-961.987) [-953.387] * (-964.596) (-977.533) [-962.302] (-955.818) -- 0:04:06
Average standard deviation of split frequencies: 0.019227
425500 -- (-970.047) (-969.036) [-950.145] (-962.357) * [-958.466] (-967.361) (-961.811) (-960.432) -- 0:04:05
426000 -- (-985.385) (-961.809) (-959.643) [-964.023] * (-971.818) (-983.568) (-961.022) [-952.593] -- 0:04:05
426500 -- (-988.804) (-974.538) [-956.930] (-948.317) * (-959.275) (-969.779) (-970.853) [-969.478] -- 0:04:04
427000 -- (-976.928) (-957.265) (-980.476) [-960.807] * [-954.225] (-986.489) (-960.670) (-958.757) -- 0:04:05
427500 -- (-972.695) [-957.208] (-1012.091) (-963.998) * (-960.529) (-1006.156) [-955.167] (-958.858) -- 0:04:05
428000 -- (-965.116) (-983.258) [-973.021] (-970.200) * (-964.560) (-973.582) (-980.129) [-945.925] -- 0:04:04
428500 -- [-953.775] (-971.697) (-967.953) (-961.091) * (-984.846) (-965.941) (-983.918) [-943.472] -- 0:04:04
429000 -- [-961.569] (-987.162) (-979.512) (-962.188) * [-968.221] (-956.085) (-973.597) (-957.882) -- 0:04:04
429500 -- [-957.677] (-970.945) (-977.317) (-964.759) * [-942.761] (-980.048) (-975.519) (-967.292) -- 0:04:04
430000 -- (-983.791) (-976.708) (-953.787) [-960.571] * [-958.115] (-967.199) (-984.476) (-969.741) -- 0:04:03
Average standard deviation of split frequencies: 0.019205
430500 -- (-975.531) (-975.829) [-945.717] (-987.932) * (-979.012) (-957.048) (-1000.135) [-960.398] -- 0:04:03
431000 -- (-970.226) (-991.358) [-956.626] (-994.370) * (-986.728) (-966.024) (-973.450) [-945.856] -- 0:04:02
431500 -- (-980.558) (-979.988) [-966.456] (-979.975) * (-983.260) [-971.264] (-970.415) (-965.127) -- 0:04:03
432000 -- [-974.893] (-980.454) (-973.197) (-981.356) * (-975.488) (-976.454) (-972.244) [-961.027] -- 0:04:03
432500 -- (-953.076) [-975.972] (-970.473) (-981.081) * (-976.249) (-976.561) (-969.686) [-952.877] -- 0:04:02
433000 -- [-958.446] (-999.708) (-967.344) (-974.145) * [-957.237] (-981.611) (-964.419) (-964.686) -- 0:04:02
433500 -- (-954.773) (-993.704) (-967.674) [-974.131] * [-969.906] (-978.464) (-990.011) (-976.906) -- 0:04:03
434000 -- [-961.070] (-985.375) (-975.183) (-959.739) * [-967.735] (-976.694) (-993.548) (-968.378) -- 0:04:02
434500 -- [-966.693] (-1006.698) (-964.164) (-972.686) * (-971.177) (-992.763) (-966.413) [-960.392] -- 0:04:02
435000 -- (-972.452) (-984.751) [-958.505] (-965.833) * [-968.558] (-977.845) (-984.082) (-980.332) -- 0:04:01
Average standard deviation of split frequencies: 0.018380
435500 -- (-984.933) (-987.549) [-953.428] (-964.062) * (-976.949) [-961.580] (-985.580) (-979.725) -- 0:04:01
436000 -- (-962.794) (-994.620) [-957.094] (-974.065) * (-972.358) (-975.326) (-972.983) [-973.542] -- 0:04:01
436500 -- (-954.203) (-989.919) [-959.882] (-973.618) * [-963.616] (-967.540) (-976.390) (-963.851) -- 0:04:01
437000 -- [-947.476] (-985.846) (-961.942) (-962.190) * (-971.819) [-953.913] (-974.014) (-969.596) -- 0:04:00
437500 -- [-953.532] (-998.246) (-987.762) (-955.493) * (-960.707) [-937.623] (-965.664) (-965.622) -- 0:04:00
438000 -- [-969.812] (-989.846) (-972.228) (-957.737) * (-958.324) [-952.027] (-964.336) (-976.364) -- 0:04:01
438500 -- [-961.836] (-970.203) (-980.332) (-961.997) * (-977.191) [-953.774] (-977.946) (-982.263) -- 0:04:00
439000 -- (-978.198) (-981.194) (-980.028) [-958.561] * (-974.668) [-964.568] (-981.353) (-980.775) -- 0:04:00
439500 -- (-974.840) (-989.916) (-970.005) [-961.404] * (-964.792) [-955.429] (-998.776) (-969.386) -- 0:03:59
440000 -- (-971.459) (-981.072) [-972.454] (-966.949) * [-966.749] (-968.261) (-965.011) (-974.453) -- 0:03:59
Average standard deviation of split frequencies: 0.018086
440500 -- [-949.809] (-970.586) (-965.418) (-962.234) * (-959.450) [-965.801] (-965.697) (-976.061) -- 0:04:00
441000 -- (-974.375) (-974.935) (-967.578) [-957.043] * (-967.515) (-969.016) [-956.340] (-983.749) -- 0:03:59
441500 -- (-973.516) (-979.301) (-967.245) [-949.476] * (-957.144) (-977.210) [-953.306] (-991.029) -- 0:03:59
442000 -- [-960.856] (-996.496) (-953.834) (-961.883) * (-958.625) (-962.387) [-958.231] (-988.668) -- 0:03:58
442500 -- (-985.590) (-980.297) (-957.257) [-952.908] * (-959.595) [-963.608] (-971.678) (-990.486) -- 0:03:59
443000 -- (-975.564) (-979.678) (-969.094) [-946.352] * [-962.517] (-965.846) (-992.970) (-982.023) -- 0:03:58
443500 -- (-969.078) (-991.983) (-955.323) [-952.922] * (-952.159) [-964.084] (-970.372) (-984.875) -- 0:03:58
444000 -- (-952.886) (-982.815) (-970.653) [-947.361] * [-948.152] (-985.382) (-965.411) (-985.910) -- 0:03:57
444500 -- (-990.397) (-1009.625) [-966.509] (-953.105) * (-970.206) (-965.383) [-962.332] (-981.082) -- 0:03:57
445000 -- (-1005.974) [-960.155] (-977.776) (-944.595) * [-950.371] (-959.804) (-966.277) (-971.974) -- 0:03:58
Average standard deviation of split frequencies: 0.016713
445500 -- (-958.203) [-955.627] (-976.122) (-964.801) * (-963.589) [-958.842] (-964.530) (-980.750) -- 0:03:57
446000 -- [-958.003] (-980.064) (-989.378) (-974.266) * (-973.067) (-963.353) [-950.778] (-977.522) -- 0:03:57
446500 -- [-957.801] (-986.175) (-977.907) (-979.317) * [-977.536] (-1000.850) (-957.034) (-972.993) -- 0:03:56
447000 -- (-966.262) (-991.260) (-993.846) [-952.681] * (-970.631) (-996.294) [-951.874] (-961.174) -- 0:03:56
447500 -- [-961.220] (-984.135) (-992.955) (-955.642) * (-985.954) [-952.685] (-967.362) (-973.276) -- 0:03:57
448000 -- (-972.492) (-983.206) (-977.439) [-972.539] * (-976.663) (-982.045) [-952.801] (-968.029) -- 0:03:56
448500 -- [-947.544] (-965.338) (-987.209) (-962.629) * (-960.271) (-978.054) [-957.123] (-989.555) -- 0:03:56
449000 -- [-954.004] (-971.697) (-983.256) (-961.788) * (-976.262) (-958.496) [-938.157] (-976.207) -- 0:03:55
449500 -- (-976.297) (-984.697) (-970.558) [-957.486] * (-955.208) (-969.650) [-943.042] (-980.355) -- 0:03:56
450000 -- [-941.744] (-974.324) (-978.880) (-985.625) * [-957.543] (-968.127) (-960.961) (-979.561) -- 0:03:55
Average standard deviation of split frequencies: 0.016050
450500 -- [-942.381] (-975.475) (-977.001) (-980.055) * (-973.040) (-957.554) [-951.782] (-969.951) -- 0:03:55
451000 -- [-960.223] (-969.807) (-980.765) (-966.200) * (-984.935) [-950.131] (-952.975) (-967.117) -- 0:03:54
451500 -- [-950.556] (-978.348) (-976.783) (-975.903) * (-970.755) [-943.109] (-950.710) (-979.921) -- 0:03:54
452000 -- (-965.488) (-981.644) [-957.811] (-992.078) * (-969.208) [-949.046] (-965.237) (-978.617) -- 0:03:55
452500 -- (-964.764) [-952.115] (-957.972) (-998.038) * (-955.891) (-959.818) [-967.189] (-949.467) -- 0:03:54
453000 -- (-951.734) (-981.745) [-965.629] (-978.991) * (-982.946) (-980.470) [-958.645] (-970.395) -- 0:03:54
453500 -- (-971.740) [-944.679] (-956.912) (-973.165) * (-976.783) (-954.061) (-969.675) [-965.184] -- 0:03:53
454000 -- (-961.524) [-940.341] (-973.372) (-974.519) * (-980.527) [-959.302] (-988.774) (-963.689) -- 0:03:54
454500 -- (-963.353) [-956.255] (-969.234) (-997.437) * (-970.616) [-955.871] (-939.506) (-980.248) -- 0:03:54
455000 -- (-958.159) (-993.300) (-980.749) [-960.428] * (-961.519) [-951.885] (-953.955) (-981.929) -- 0:03:53
Average standard deviation of split frequencies: 0.016056
455500 -- (-979.491) [-954.969] (-971.221) (-976.544) * [-971.275] (-959.186) (-950.992) (-966.210) -- 0:03:53
456000 -- (-969.889) (-969.602) [-959.225] (-969.385) * (-984.881) (-979.625) [-958.212] (-965.795) -- 0:03:52
456500 -- [-965.167] (-958.836) (-978.402) (-971.196) * (-964.608) (-987.256) [-951.460] (-993.748) -- 0:03:53
457000 -- (-965.316) (-962.453) [-979.569] (-995.271) * (-968.094) (-959.512) [-947.914] (-985.378) -- 0:03:52
457500 -- (-952.978) [-953.574] (-976.600) (-972.824) * (-978.195) [-954.410] (-943.466) (-963.571) -- 0:03:52
458000 -- (-969.679) [-960.093] (-970.156) (-991.367) * (-964.835) [-945.817] (-964.845) (-969.986) -- 0:03:51
458500 -- (-957.119) (-969.528) [-944.273] (-977.863) * (-967.872) [-953.815] (-963.029) (-982.533) -- 0:03:51
459000 -- [-960.497] (-997.408) (-954.513) (-976.200) * (-950.997) [-961.710] (-987.341) (-992.175) -- 0:03:52
459500 -- (-954.560) (-994.803) [-964.927] (-983.440) * [-956.168] (-958.446) (-974.371) (-987.596) -- 0:03:51
460000 -- (-964.476) (-975.158) [-942.298] (-977.065) * (-963.374) [-950.191] (-968.339) (-994.462) -- 0:03:51
Average standard deviation of split frequencies: 0.016725
460500 -- (-973.137) (-976.805) [-948.935] (-983.790) * [-968.223] (-956.959) (-973.434) (-986.607) -- 0:03:50
461000 -- (-965.056) (-989.689) (-958.482) [-961.057] * [-958.231] (-968.762) (-962.315) (-988.160) -- 0:03:51
461500 -- (-960.496) (-976.651) [-957.143] (-979.829) * (-945.762) [-960.380] (-970.649) (-988.326) -- 0:03:51
462000 -- [-952.492] (-990.418) (-965.671) (-971.399) * [-957.845] (-973.753) (-977.404) (-981.932) -- 0:03:50
462500 -- (-968.999) (-959.903) [-962.856] (-970.948) * [-965.191] (-989.000) (-976.480) (-976.620) -- 0:03:50
463000 -- [-968.973] (-967.280) (-972.737) (-964.855) * (-967.120) [-966.802] (-964.510) (-968.519) -- 0:03:50
463500 -- [-946.895] (-974.355) (-956.359) (-994.827) * (-963.776) (-975.349) [-951.092] (-973.867) -- 0:03:50
464000 -- [-944.588] (-980.360) (-980.446) (-1017.304) * (-968.897) (-975.774) [-957.794] (-991.288) -- 0:03:49
464500 -- (-953.766) [-974.165] (-993.929) (-984.763) * (-970.503) (-972.714) [-949.653] (-989.524) -- 0:03:49
465000 -- [-952.452] (-958.338) (-981.201) (-973.351) * (-953.679) (-974.582) [-956.792] (-990.170) -- 0:03:50
Average standard deviation of split frequencies: 0.016565
465500 -- [-954.354] (-986.909) (-974.061) (-976.638) * [-950.440] (-964.692) (-962.963) (-994.621) -- 0:03:49
466000 -- (-966.116) (-972.977) [-965.193] (-986.572) * (-979.357) [-971.223] (-964.513) (-1000.209) -- 0:03:49
466500 -- (-959.388) [-945.773] (-955.109) (-981.018) * [-955.668] (-969.702) (-947.908) (-986.628) -- 0:03:48
467000 -- (-971.204) [-947.076] (-951.282) (-965.629) * (-975.191) [-956.084] (-971.409) (-971.628) -- 0:03:48
467500 -- (-973.616) [-951.802] (-981.308) (-977.719) * [-958.373] (-971.327) (-964.525) (-969.834) -- 0:03:48
468000 -- (-963.256) (-987.945) [-951.762] (-962.406) * (-971.527) (-955.622) [-952.553] (-988.985) -- 0:03:48
468500 -- [-955.965] (-987.979) (-959.899) (-958.533) * (-983.545) [-960.811] (-964.539) (-979.321) -- 0:03:48
469000 -- (-970.769) (-983.602) [-959.496] (-962.719) * (-986.245) (-961.751) [-954.434] (-992.092) -- 0:03:47
469500 -- (-987.411) (-987.050) [-952.349] (-968.141) * (-990.211) [-956.476] (-963.500) (-980.288) -- 0:03:47
470000 -- (-964.080) (-981.859) [-952.526] (-980.519) * (-1000.060) (-980.780) [-968.642] (-960.576) -- 0:03:47
Average standard deviation of split frequencies: 0.016213
470500 -- (-957.957) (-993.313) (-953.269) [-957.406] * (-982.789) (-954.690) [-962.518] (-968.686) -- 0:03:47
471000 -- [-952.204] (-992.357) (-969.450) (-956.621) * (-987.358) [-969.858] (-965.683) (-972.931) -- 0:03:46
471500 -- (-962.602) (-980.444) (-970.871) [-954.361] * (-973.612) (-956.292) [-959.406] (-975.754) -- 0:03:46
472000 -- (-987.664) (-974.732) [-949.476] (-969.904) * (-961.340) (-972.163) [-957.833] (-967.488) -- 0:03:45
472500 -- (-979.507) (-977.491) [-966.296] (-975.935) * (-981.770) (-968.816) [-952.574] (-978.190) -- 0:03:46
473000 -- (-960.060) (-975.358) [-952.407] (-967.931) * (-969.674) [-951.060] (-971.505) (-988.759) -- 0:03:46
473500 -- (-981.113) (-974.460) (-955.893) [-957.275] * (-983.874) [-942.626] (-958.294) (-997.456) -- 0:03:45
474000 -- (-970.760) (-975.778) (-962.352) [-969.779] * (-973.215) (-965.914) [-955.898] (-981.476) -- 0:03:45
474500 -- [-952.832] (-973.851) (-969.776) (-971.359) * (-971.840) (-951.803) [-954.915] (-994.206) -- 0:03:44
475000 -- [-952.913] (-962.591) (-974.127) (-970.178) * (-965.143) [-956.339] (-973.651) (-982.462) -- 0:03:45
Average standard deviation of split frequencies: 0.016093
475500 -- [-953.635] (-971.566) (-984.566) (-969.632) * (-970.094) (-959.232) [-948.802] (-978.110) -- 0:03:45
476000 -- [-946.343] (-982.315) (-978.218) (-967.695) * (-963.740) (-963.019) [-957.005] (-988.796) -- 0:03:44
476500 -- (-956.733) (-976.276) (-969.707) [-961.300] * (-966.586) [-968.750] (-955.542) (-983.463) -- 0:03:44
477000 -- (-970.804) (-977.575) [-965.132] (-979.459) * (-974.084) (-972.583) [-952.728] (-969.353) -- 0:03:44
477500 -- (-959.717) [-959.074] (-989.111) (-962.356) * (-970.302) (-960.420) [-960.019] (-984.390) -- 0:03:44
478000 -- [-959.525] (-961.223) (-977.235) (-978.382) * (-971.691) (-981.338) [-954.540] (-978.599) -- 0:03:43
478500 -- (-959.109) [-950.941] (-974.713) (-964.232) * (-962.156) (-996.463) [-953.332] (-980.583) -- 0:03:43
479000 -- (-979.888) [-951.877] (-975.239) (-970.417) * (-969.523) (-984.459) (-979.565) [-962.517] -- 0:03:44
479500 -- (-971.094) [-957.281] (-960.281) (-973.563) * (-964.247) [-964.701] (-962.105) (-990.483) -- 0:03:43
480000 -- (-978.030) (-988.561) (-959.108) [-958.336] * [-952.049] (-966.493) (-946.539) (-969.405) -- 0:03:43
Average standard deviation of split frequencies: 0.016182
480500 -- (-968.857) (-978.462) (-974.034) [-970.260] * (-962.350) (-961.116) [-957.727] (-975.305) -- 0:03:42
481000 -- [-958.303] (-965.151) (-965.219) (-975.111) * [-953.578] (-967.278) (-963.613) (-964.129) -- 0:03:42
481500 -- (-972.082) (-964.122) [-957.778] (-986.491) * [-953.462] (-975.570) (-961.145) (-987.296) -- 0:03:42
482000 -- [-955.358] (-967.043) (-984.774) (-959.653) * [-954.511] (-975.692) (-963.673) (-972.735) -- 0:03:42
482500 -- (-972.246) (-989.985) (-956.795) [-951.551] * [-945.816] (-973.788) (-962.989) (-979.518) -- 0:03:42
483000 -- (-981.108) [-966.919] (-978.239) (-975.933) * (-966.584) (-966.233) [-943.014] (-984.582) -- 0:03:41
483500 -- (-964.790) [-954.563] (-988.795) (-987.454) * (-969.596) (-978.562) [-942.444] (-977.644) -- 0:03:42
484000 -- (-961.500) [-951.780] (-996.199) (-971.851) * (-957.039) (-987.589) [-939.916] (-975.642) -- 0:03:41
484500 -- (-990.554) [-954.835] (-969.710) (-964.884) * [-956.742] (-979.174) (-974.926) (-984.254) -- 0:03:41
485000 -- (-993.847) [-950.335] (-972.693) (-984.619) * (-973.221) [-961.908] (-971.348) (-981.780) -- 0:03:40
Average standard deviation of split frequencies: 0.015974
485500 -- (-983.020) [-950.091] (-952.712) (-980.352) * [-966.994] (-963.155) (-975.432) (-970.952) -- 0:03:40
486000 -- (-956.238) [-951.103] (-977.330) (-993.476) * (-978.690) [-968.963] (-954.786) (-976.342) -- 0:03:41
486500 -- (-965.011) [-948.168] (-963.173) (-1000.246) * (-969.519) (-984.588) [-961.544] (-979.834) -- 0:03:40
487000 -- (-953.019) (-963.853) [-963.506] (-993.715) * [-950.779] (-965.722) (-963.031) (-963.607) -- 0:03:40
487500 -- [-954.283] (-966.480) (-954.181) (-982.470) * (-958.478) (-974.695) [-952.553] (-961.924) -- 0:03:39
488000 -- (-971.818) (-973.843) [-946.259] (-966.336) * (-971.174) (-962.120) (-976.776) [-965.642] -- 0:03:39
488500 -- [-940.607] (-987.288) (-954.436) (-987.116) * (-972.946) (-966.005) (-966.607) [-963.741] -- 0:03:39
489000 -- [-960.283] (-961.081) (-969.846) (-985.462) * (-964.426) (-968.688) (-970.541) [-959.931] -- 0:03:39
489500 -- [-959.252] (-966.011) (-983.756) (-975.853) * [-951.614] (-962.640) (-952.279) (-986.360) -- 0:03:39
490000 -- (-973.317) [-959.238] (-961.317) (-971.736) * (-947.579) (-1005.908) [-959.030] (-967.949) -- 0:03:38
Average standard deviation of split frequencies: 0.015522
490500 -- (-997.015) (-970.071) [-964.334] (-968.525) * (-961.974) (-970.979) [-963.027] (-976.283) -- 0:03:38
491000 -- (-977.146) (-969.459) [-966.446] (-978.196) * (-955.383) (-973.205) (-958.426) [-958.463] -- 0:03:38
491500 -- (-968.824) [-956.274] (-960.478) (-970.696) * (-961.154) (-980.268) [-961.556] (-982.459) -- 0:03:38
492000 -- (-969.070) [-959.135] (-982.855) (-983.759) * [-950.854] (-965.591) (-957.903) (-968.400) -- 0:03:37
492500 -- [-961.027] (-950.386) (-999.730) (-981.364) * (-976.662) (-982.072) [-959.026] (-960.669) -- 0:03:37
493000 -- (-980.263) [-945.949] (-975.086) (-982.285) * (-966.501) (-958.952) (-980.217) [-957.895] -- 0:03:36
493500 -- (-976.683) [-945.729] (-979.681) (-974.144) * (-958.336) (-996.702) [-950.915] (-961.603) -- 0:03:36
494000 -- (-977.848) [-947.615] (-975.558) (-963.932) * (-962.849) (-951.012) (-984.059) [-948.230] -- 0:03:37
494500 -- (-989.090) [-949.682] (-967.479) (-961.907) * (-985.277) (-983.835) (-969.001) [-960.530] -- 0:03:36
495000 -- (-999.262) (-974.189) [-955.669] (-967.629) * (-986.769) (-979.299) [-961.190] (-959.774) -- 0:03:36
Average standard deviation of split frequencies: 0.014761
495500 -- (-992.317) [-948.024] (-961.303) (-970.761) * (-985.869) (-970.630) (-960.427) [-948.306] -- 0:03:35
496000 -- (-988.920) [-961.534] (-980.063) (-977.445) * (-981.918) (-968.333) (-972.024) [-949.798] -- 0:03:35
496500 -- [-968.342] (-962.894) (-953.386) (-967.223) * (-956.723) (-978.004) (-955.880) [-952.745] -- 0:03:36
497000 -- [-951.819] (-977.096) (-969.980) (-956.572) * (-994.082) (-974.380) [-947.526] (-958.948) -- 0:03:35
497500 -- (-954.098) [-952.413] (-991.578) (-964.317) * (-978.242) (-980.296) (-963.462) [-954.792] -- 0:03:35
498000 -- (-954.809) (-965.904) [-958.262] (-974.052) * (-968.937) (-975.858) [-954.742] (-965.262) -- 0:03:34
498500 -- (-972.012) (-973.822) [-954.696] (-982.812) * [-952.858] (-963.774) (-950.297) (-970.633) -- 0:03:34
499000 -- (-986.138) (-965.514) [-949.097] (-955.822) * (-957.434) [-959.964] (-971.965) (-966.110) -- 0:03:34
499500 -- (-971.829) (-989.099) [-955.026] (-957.957) * (-954.280) (-971.621) (-969.049) [-966.240] -- 0:03:34
500000 -- [-953.347] (-975.585) (-965.651) (-966.671) * [-954.387] (-953.611) (-977.176) (-960.197) -- 0:03:34
Average standard deviation of split frequencies: 0.013858
500500 -- [-963.010] (-973.178) (-981.120) (-957.540) * (-959.627) (-979.173) (-968.639) [-957.235] -- 0:03:33
501000 -- [-945.093] (-984.169) (-969.855) (-967.335) * (-966.129) (-981.602) (-981.682) [-949.114] -- 0:03:34
501500 -- (-963.097) (-992.969) (-960.984) [-962.370] * [-952.978] (-958.267) (-976.462) (-963.218) -- 0:03:33
502000 -- (-958.445) (-998.494) [-951.666] (-957.264) * [-952.751] (-952.259) (-973.546) (-966.445) -- 0:03:33
502500 -- [-944.490] (-993.844) (-961.118) (-956.303) * [-949.576] (-974.728) (-986.511) (-972.898) -- 0:03:32
503000 -- (-961.138) (-977.916) (-967.844) [-965.928] * (-951.817) (-962.701) (-985.362) [-951.261] -- 0:03:33
503500 -- (-956.355) (-980.854) (-984.370) [-953.368] * (-956.234) (-970.066) (-973.977) [-947.782] -- 0:03:32
504000 -- (-953.646) (-982.671) [-958.186] (-952.791) * (-960.387) (-968.686) (-975.729) [-957.861] -- 0:03:32
504500 -- [-953.025] (-956.489) (-983.904) (-971.389) * (-975.410) (-953.564) (-973.640) [-962.518] -- 0:03:32
505000 -- [-972.801] (-956.228) (-962.381) (-971.610) * (-964.717) (-971.486) (-985.818) [-952.019] -- 0:03:31
Average standard deviation of split frequencies: 0.014178
505500 -- (-963.291) (-965.648) [-965.534] (-962.789) * [-956.829] (-961.883) (-988.019) (-963.234) -- 0:03:32
506000 -- [-953.480] (-966.682) (-993.849) (-972.243) * (-975.375) (-973.506) (-977.036) [-962.755] -- 0:03:31
506500 -- [-939.679] (-974.972) (-977.277) (-960.134) * (-960.808) [-944.206] (-963.030) (-973.556) -- 0:03:31
507000 -- [-941.007] (-984.421) (-978.562) (-951.510) * (-968.867) [-945.668] (-970.827) (-981.470) -- 0:03:31
507500 -- (-976.642) (-972.893) (-983.890) [-965.522] * (-963.756) (-973.558) [-958.879] (-958.411) -- 0:03:31
508000 -- (-971.989) (-958.798) (-995.693) [-946.317] * (-974.309) [-956.293] (-980.175) (-970.695) -- 0:03:31
508500 -- [-956.568] (-979.037) (-991.940) (-949.787) * (-972.412) [-962.586] (-979.576) (-981.906) -- 0:03:30
509000 -- (-957.350) (-965.246) (-993.086) [-953.089] * (-972.850) [-953.823] (-976.034) (-996.471) -- 0:03:30
509500 -- [-945.918] (-974.561) (-974.899) (-970.690) * [-954.842] (-945.313) (-973.889) (-985.674) -- 0:03:29
510000 -- (-987.188) (-967.778) (-990.655) [-966.420] * (-972.719) [-963.696] (-963.723) (-995.013) -- 0:03:30
Average standard deviation of split frequencies: 0.014049
510500 -- (-964.909) (-971.513) (-994.237) [-952.946] * (-967.343) [-951.052] (-948.417) (-979.977) -- 0:03:29
511000 -- (-960.647) (-980.999) (-990.954) [-951.014] * (-979.715) [-948.876] (-958.352) (-978.006) -- 0:03:29
511500 -- [-955.812] (-974.062) (-976.359) (-964.864) * (-960.540) (-989.625) [-956.605] (-977.897) -- 0:03:29
512000 -- [-967.986] (-970.019) (-977.474) (-985.540) * [-961.866] (-976.648) (-950.179) (-974.366) -- 0:03:29
512500 -- (-970.379) (-969.990) (-975.737) [-951.343] * (-949.462) (-993.551) [-966.606] (-985.553) -- 0:03:29
513000 -- (-973.177) (-979.656) (-974.150) [-952.830] * [-971.905] (-1009.874) (-956.608) (-982.715) -- 0:03:28
513500 -- (-976.074) (-987.066) (-965.260) [-946.867] * [-963.881] (-951.373) (-960.284) (-968.231) -- 0:03:28
514000 -- [-975.520] (-993.858) (-978.495) (-968.377) * (-984.013) [-973.151] (-972.046) (-972.738) -- 0:03:28
514500 -- [-970.191] (-993.522) (-981.368) (-967.762) * (-972.691) (-954.808) [-965.287] (-982.067) -- 0:03:28
515000 -- [-966.713] (-984.841) (-1003.681) (-957.032) * [-967.858] (-977.228) (-970.190) (-970.138) -- 0:03:28
Average standard deviation of split frequencies: 0.013875
515500 -- (-966.075) (-985.814) (-1002.002) [-952.150] * (-966.741) [-963.521] (-970.456) (-973.461) -- 0:03:27
516000 -- [-950.210] (-984.077) (-991.187) (-956.001) * [-962.273] (-984.513) (-971.572) (-990.282) -- 0:03:27
516500 -- [-955.824] (-977.931) (-982.121) (-957.259) * (-967.648) [-958.060] (-957.905) (-965.765) -- 0:03:27
517000 -- [-948.420] (-981.354) (-982.954) (-960.421) * [-959.423] (-964.335) (-957.868) (-946.798) -- 0:03:27
517500 -- [-957.112] (-984.235) (-976.930) (-991.897) * (-962.696) (-971.772) (-991.980) [-953.530] -- 0:03:26
518000 -- (-964.277) (-986.187) (-986.716) [-946.009] * (-956.426) (-969.325) (-997.460) [-958.331] -- 0:03:26
518500 -- (-967.536) (-996.160) [-972.905] (-973.944) * (-962.908) (-971.372) (-980.938) [-958.727] -- 0:03:26
519000 -- (-958.218) (-978.070) (-992.843) [-956.115] * (-956.287) (-1001.205) [-959.173] (-968.132) -- 0:03:26
519500 -- (-945.301) (-991.578) (-961.197) [-961.035] * (-979.030) (-967.432) [-959.667] (-992.043) -- 0:03:26
520000 -- [-946.773] (-979.645) (-958.128) (-975.946) * (-967.233) (-967.264) [-964.223] (-988.509) -- 0:03:25
Average standard deviation of split frequencies: 0.013156
520500 -- (-972.692) (-974.121) [-969.906] (-969.168) * (-993.202) [-955.795] (-967.431) (-988.941) -- 0:03:25
521000 -- (-965.668) (-962.034) (-961.660) [-960.880] * (-986.314) (-956.175) (-966.178) [-963.083] -- 0:03:25
521500 -- (-956.095) [-958.071] (-963.199) (-974.707) * (-962.459) [-959.546] (-973.460) (-992.544) -- 0:03:25
522000 -- [-953.201] (-952.856) (-979.170) (-976.367) * [-956.419] (-964.912) (-969.696) (-963.478) -- 0:03:25
522500 -- (-966.507) [-958.867] (-977.402) (-971.466) * [-968.209] (-963.488) (-961.530) (-980.446) -- 0:03:24
523000 -- (-959.637) [-958.112] (-962.477) (-983.930) * [-958.627] (-957.414) (-968.376) (-971.935) -- 0:03:24
523500 -- [-969.259] (-948.790) (-978.015) (-965.412) * [-945.314] (-961.769) (-957.080) (-981.932) -- 0:03:24
524000 -- (-965.750) [-952.033] (-973.080) (-975.249) * (-962.689) (-986.057) [-957.699] (-975.268) -- 0:03:24
524500 -- (-964.267) [-974.785] (-989.762) (-965.955) * (-970.034) (-987.150) [-949.021] (-995.718) -- 0:03:23
525000 -- [-961.285] (-971.949) (-963.990) (-979.493) * (-971.608) [-960.696] (-952.157) (-989.993) -- 0:03:23
Average standard deviation of split frequencies: 0.013303
525500 -- [-964.637] (-959.947) (-969.248) (-969.073) * (-952.686) (-972.454) [-957.500] (-982.173) -- 0:03:23
526000 -- (-961.357) [-962.814] (-976.029) (-971.222) * [-955.750] (-967.209) (-969.261) (-981.002) -- 0:03:23
526500 -- (-966.318) [-957.765] (-982.745) (-980.035) * (-960.377) (-956.900) [-953.966] (-969.760) -- 0:03:23
527000 -- (-978.055) (-966.051) [-949.250] (-982.543) * (-965.271) [-951.449] (-967.408) (-969.193) -- 0:03:22
527500 -- [-953.465] (-947.818) (-988.876) (-966.406) * (-981.126) (-966.828) (-963.040) [-948.146] -- 0:03:22
528000 -- (-971.594) [-965.075] (-993.448) (-957.934) * (-973.717) (-982.008) (-959.454) [-957.315] -- 0:03:22
528500 -- (-963.956) [-951.863] (-985.032) (-982.078) * [-953.675] (-1000.787) (-956.901) (-963.051) -- 0:03:22
529000 -- (-962.889) [-961.105] (-961.540) (-972.023) * [-952.211] (-980.455) (-970.810) (-967.830) -- 0:03:22
529500 -- (-980.620) (-981.978) (-966.286) [-961.049] * (-949.389) (-960.496) (-978.460) [-953.978] -- 0:03:21
530000 -- (-968.765) [-946.410] (-959.276) (-968.399) * [-957.641] (-986.055) (-981.366) (-964.591) -- 0:03:21
Average standard deviation of split frequencies: 0.013269
530500 -- (-952.166) [-953.121] (-966.399) (-976.658) * [-952.291] (-976.399) (-959.023) (-990.403) -- 0:03:21
531000 -- (-970.789) (-973.958) (-978.976) [-966.959] * [-954.786] (-997.495) (-964.607) (-971.335) -- 0:03:21
531500 -- [-966.466] (-980.772) (-1006.876) (-955.878) * [-945.825] (-991.823) (-960.273) (-987.349) -- 0:03:20
532000 -- (-971.162) (-986.968) (-971.570) [-961.936] * (-962.295) (-968.118) [-954.488] (-964.639) -- 0:03:20
532500 -- (-969.388) (-972.065) [-966.913] (-967.967) * (-965.264) [-960.075] (-953.268) (-980.318) -- 0:03:20
533000 -- [-960.352] (-972.573) (-985.398) (-973.851) * (-960.565) (-962.793) [-947.073] (-984.140) -- 0:03:20
533500 -- [-965.940] (-976.376) (-975.635) (-984.826) * (-968.648) (-960.421) [-956.924] (-979.214) -- 0:03:20
534000 -- [-950.391] (-971.573) (-967.781) (-981.453) * (-971.429) [-961.305] (-949.883) (-986.526) -- 0:03:19
534500 -- [-952.749] (-976.731) (-987.880) (-971.619) * (-959.157) (-984.236) [-942.056] (-995.850) -- 0:03:19
535000 -- (-951.609) (-974.625) (-967.998) [-965.995] * (-984.097) (-963.279) (-964.791) [-965.490] -- 0:03:19
Average standard deviation of split frequencies: 0.013086
535500 -- (-966.786) (-968.197) [-965.940] (-977.692) * (-971.757) [-965.838] (-974.582) (-978.245) -- 0:03:19
536000 -- [-951.229] (-990.224) (-984.405) (-978.848) * [-966.713] (-967.039) (-967.104) (-985.306) -- 0:03:19
536500 -- [-955.718] (-984.348) (-973.290) (-953.047) * (-964.335) [-945.135] (-983.154) (-985.597) -- 0:03:18
537000 -- [-959.091] (-998.813) (-971.793) (-981.899) * (-973.695) (-952.630) [-946.638] (-981.591) -- 0:03:18
537500 -- (-968.718) (-984.743) (-953.966) [-967.559] * (-972.059) (-968.795) [-944.714] (-981.808) -- 0:03:18
538000 -- (-970.267) (-981.049) [-954.413] (-963.019) * (-988.979) (-961.026) [-957.758] (-970.734) -- 0:03:18
538500 -- (-980.444) [-962.557] (-960.873) (-973.911) * (-965.997) (-967.782) (-958.711) [-962.696] -- 0:03:17
539000 -- (-969.773) (-962.715) [-965.178] (-980.327) * (-990.493) (-970.540) [-948.135] (-972.208) -- 0:03:17
539500 -- (-979.552) (-963.736) [-967.470] (-958.444) * (-973.399) (-961.251) [-967.800] (-971.964) -- 0:03:18
540000 -- (-991.657) [-962.449] (-980.158) (-976.016) * (-975.056) [-953.682] (-964.149) (-962.752) -- 0:03:17
Average standard deviation of split frequencies: 0.012735
540500 -- (-978.627) [-949.504] (-973.591) (-978.399) * (-970.598) (-968.558) [-950.136] (-959.244) -- 0:03:17
541000 -- (-985.728) [-955.621] (-966.506) (-968.122) * (-986.003) (-970.515) (-953.328) [-953.714] -- 0:03:16
541500 -- (-983.298) (-987.358) [-954.647] (-979.184) * (-976.669) (-966.554) [-963.179] (-953.528) -- 0:03:16
542000 -- (-964.480) (-988.193) [-970.425] (-973.369) * (-989.474) (-980.262) (-971.683) [-972.597] -- 0:03:16
542500 -- [-975.142] (-980.525) (-971.622) (-985.519) * [-971.504] (-965.938) (-983.908) (-957.301) -- 0:03:16
543000 -- [-963.531] (-969.524) (-986.440) (-1007.845) * (-983.646) (-970.915) (-980.275) [-950.937] -- 0:03:16
543500 -- [-949.981] (-963.949) (-971.002) (-986.290) * (-982.727) [-979.680] (-974.365) (-964.860) -- 0:03:15
544000 -- (-959.890) [-962.727] (-992.226) (-984.068) * (-983.699) (-983.820) (-966.082) [-944.815] -- 0:03:16
544500 -- (-965.209) [-968.674] (-979.694) (-975.719) * (-982.123) (-964.365) [-953.185] (-955.614) -- 0:03:15
545000 -- (-988.152) (-964.137) [-963.732] (-979.417) * (-988.312) (-979.057) (-969.686) [-950.843] -- 0:03:15
Average standard deviation of split frequencies: 0.013343
545500 -- (-974.646) (-976.212) [-953.513] (-979.883) * [-963.215] (-993.330) (-959.632) (-963.327) -- 0:03:14
546000 -- [-953.657] (-971.066) (-959.980) (-952.071) * (-987.354) (-978.047) [-951.605] (-965.138) -- 0:03:14
546500 -- (-971.266) (-967.377) (-994.266) [-960.807] * [-962.776] (-978.721) (-959.320) (-967.511) -- 0:03:15
547000 -- (-980.940) (-970.518) (-959.053) [-957.126] * [-944.034] (-989.853) (-978.164) (-977.424) -- 0:03:14
547500 -- (-979.186) (-966.410) (-963.138) [-963.617] * [-961.797] (-975.981) (-976.484) (-979.119) -- 0:03:14
548000 -- (-961.939) (-984.925) [-961.439] (-966.771) * (-951.944) (-981.132) (-979.912) [-962.117] -- 0:03:13
548500 -- [-955.914] (-976.002) (-960.929) (-951.975) * (-954.860) (-973.526) [-959.704] (-972.487) -- 0:03:14
549000 -- (-993.549) (-989.607) [-948.072] (-967.432) * (-979.288) (-978.094) [-951.865] (-965.655) -- 0:03:13
549500 -- (-986.159) (-959.197) (-974.851) [-956.678] * (-976.551) (-958.806) [-936.529] (-969.265) -- 0:03:13
550000 -- [-945.935] (-958.420) (-1004.586) (-961.940) * (-957.468) [-952.711] (-958.284) (-962.891) -- 0:03:13
Average standard deviation of split frequencies: 0.013386
550500 -- (-957.956) [-957.324] (-970.519) (-970.788) * (-970.081) (-960.385) [-945.644] (-968.702) -- 0:03:12
551000 -- (-953.872) [-962.125] (-982.274) (-972.882) * (-989.167) (-954.650) [-951.826] (-981.855) -- 0:03:13
551500 -- (-965.255) [-951.412] (-970.332) (-973.392) * (-977.382) (-964.983) (-983.394) [-962.457] -- 0:03:12
552000 -- (-954.344) [-962.758] (-992.077) (-977.739) * (-964.704) (-975.502) (-949.679) [-941.580] -- 0:03:12
552500 -- [-943.622] (-974.915) (-980.049) (-975.417) * [-962.417] (-956.445) (-951.798) (-982.357) -- 0:03:11
553000 -- [-957.487] (-980.576) (-991.124) (-962.037) * [-960.073] (-994.640) (-961.343) (-975.487) -- 0:03:12
553500 -- (-960.029) [-953.249] (-993.120) (-976.433) * (-993.095) (-965.639) (-980.684) [-961.201] -- 0:03:11
554000 -- (-971.486) (-992.837) (-974.193) [-967.475] * (-971.857) [-953.100] (-973.252) (-960.849) -- 0:03:11
554500 -- (-971.095) (-981.550) [-968.086] (-973.712) * (-965.097) (-965.840) (-950.248) [-955.549] -- 0:03:11
555000 -- (-974.081) (-981.058) (-968.393) [-949.473] * (-973.882) [-952.361] (-958.824) (-961.280) -- 0:03:10
Average standard deviation of split frequencies: 0.012718
555500 -- (-964.502) (-984.178) [-947.618] (-980.977) * (-973.108) [-953.893] (-949.893) (-970.970) -- 0:03:11
556000 -- (-993.053) (-982.237) [-948.349] (-966.872) * (-977.187) [-961.991] (-960.980) (-978.919) -- 0:03:10
556500 -- (-985.473) (-959.497) (-961.411) [-956.236] * [-960.343] (-968.150) (-980.739) (-965.624) -- 0:03:10
557000 -- (-975.466) (-987.980) [-957.302] (-971.251) * [-955.536] (-991.621) (-968.914) (-981.145) -- 0:03:10
557500 -- [-967.386] (-988.471) (-955.260) (-974.834) * [-959.591] (-986.733) (-962.053) (-976.794) -- 0:03:10
558000 -- (-970.734) (-967.621) [-960.979] (-987.186) * [-954.922] (-1005.623) (-977.348) (-969.557) -- 0:03:10
558500 -- (-992.363) (-963.906) [-970.103] (-969.075) * [-961.015] (-987.105) (-990.011) (-968.912) -- 0:03:09
559000 -- [-962.355] (-967.941) (-993.118) (-973.338) * [-946.929] (-970.468) (-962.436) (-959.852) -- 0:03:09
559500 -- (-962.894) [-969.444] (-992.242) (-991.142) * [-947.817] (-968.302) (-957.389) (-964.449) -- 0:03:08
560000 -- [-970.293] (-964.067) (-983.243) (-968.034) * (-948.311) (-973.431) (-966.056) [-956.473] -- 0:03:09
Average standard deviation of split frequencies: 0.012357
560500 -- (-977.842) (-982.552) [-961.968] (-964.097) * (-964.279) (-974.947) (-978.564) [-957.418] -- 0:03:08
561000 -- (-979.022) (-980.947) [-947.342] (-978.990) * (-978.804) (-979.714) (-971.511) [-965.328] -- 0:03:08
561500 -- (-983.826) (-979.689) [-967.932] (-966.611) * (-974.078) (-977.309) (-971.914) [-952.843] -- 0:03:08
562000 -- (-969.086) (-982.862) [-983.029] (-986.010) * (-975.460) (-982.579) (-982.473) [-942.890] -- 0:03:08
562500 -- [-957.759] (-979.592) (-971.808) (-971.052) * (-972.910) (-983.296) (-973.554) [-955.198] -- 0:03:08
563000 -- (-951.495) (-968.812) [-951.767] (-980.658) * (-973.611) (-985.647) (-989.971) [-969.589] -- 0:03:07
563500 -- (-970.581) (-981.818) [-954.492] (-980.454) * (-975.600) [-953.323] (-965.590) (-964.796) -- 0:03:07
564000 -- (-992.843) (-978.898) [-953.636] (-964.133) * [-967.798] (-963.950) (-984.790) (-971.484) -- 0:03:07
564500 -- (-972.712) (-981.199) [-965.557] (-957.409) * (-961.961) [-944.022] (-980.438) (-951.435) -- 0:03:07
565000 -- (-970.470) (-968.131) [-949.811] (-982.591) * (-976.514) [-945.103] (-959.731) (-966.706) -- 0:03:07
Average standard deviation of split frequencies: 0.012266
565500 -- (-965.503) (-957.896) [-955.107] (-973.328) * (-972.006) [-948.024] (-963.463) (-970.073) -- 0:03:06
566000 -- (-965.106) [-956.652] (-973.012) (-969.227) * (-982.407) [-965.802] (-974.989) (-963.210) -- 0:03:06
566500 -- (-966.390) (-979.394) [-965.663] (-977.609) * (-962.704) (-984.156) [-952.521] (-973.025) -- 0:03:06
567000 -- [-961.343] (-978.801) (-963.732) (-953.833) * (-972.629) (-978.919) (-948.235) [-947.057] -- 0:03:06
567500 -- (-973.287) (-986.669) [-965.149] (-958.869) * (-983.291) (-991.345) (-963.905) [-957.522] -- 0:03:05
568000 -- (-995.886) (-965.756) (-954.440) [-948.873] * (-982.916) (-1001.618) [-966.820] (-964.770) -- 0:03:05
568500 -- (-987.553) (-955.538) [-961.939] (-955.630) * (-972.871) (-981.099) (-972.869) [-951.549] -- 0:03:05
569000 -- [-967.265] (-957.156) (-961.012) (-973.073) * (-964.835) (-961.894) [-962.852] (-957.273) -- 0:03:05
569500 -- [-956.772] (-960.716) (-963.165) (-966.704) * [-972.886] (-976.269) (-970.435) (-966.706) -- 0:03:05
570000 -- [-948.877] (-977.332) (-969.178) (-965.115) * (-980.078) (-972.408) [-960.689] (-976.437) -- 0:03:04
Average standard deviation of split frequencies: 0.012441
570500 -- [-949.493] (-963.740) (-977.914) (-971.464) * (-963.151) [-959.602] (-966.771) (-969.106) -- 0:03:04
571000 -- [-949.646] (-976.745) (-977.046) (-966.942) * (-968.130) (-979.008) (-976.147) [-948.001] -- 0:03:04
571500 -- (-985.751) (-959.929) (-954.515) [-958.819] * (-997.439) (-952.596) (-976.717) [-961.449] -- 0:03:04
572000 -- (-971.687) (-963.182) (-968.997) [-958.896] * (-980.292) (-955.688) (-967.908) [-972.431] -- 0:03:04
572500 -- (-957.132) [-963.136] (-954.090) (-966.177) * (-977.713) [-953.198] (-976.406) (-967.326) -- 0:03:03
573000 -- (-980.478) [-971.761] (-963.052) (-973.247) * (-980.800) [-951.547] (-971.037) (-956.487) -- 0:03:04
573500 -- [-963.900] (-978.976) (-972.061) (-980.205) * (-968.072) [-943.724] (-977.251) (-972.839) -- 0:03:03
574000 -- (-959.667) (-983.832) (-969.710) [-976.066] * (-980.395) [-951.175] (-992.581) (-957.316) -- 0:03:03
574500 -- [-943.888] (-983.790) (-960.125) (-974.035) * [-962.078] (-965.301) (-957.213) (-981.503) -- 0:03:02
575000 -- (-969.306) (-972.492) [-956.933] (-955.718) * (-969.537) [-959.758] (-956.329) (-980.905) -- 0:03:02
Average standard deviation of split frequencies: 0.012301
575500 -- [-956.615] (-969.001) (-971.138) (-957.621) * (-972.978) (-992.801) [-950.301] (-981.072) -- 0:03:02
576000 -- (-984.357) (-965.722) [-956.483] (-966.381) * (-982.052) (-975.129) [-948.144] (-971.013) -- 0:03:02
576500 -- (-975.915) [-951.574] (-959.528) (-970.979) * (-967.696) (-959.836) [-976.444] (-968.126) -- 0:03:02
577000 -- (-989.592) [-961.066] (-960.603) (-965.030) * (-972.169) [-963.427] (-968.719) (-989.827) -- 0:03:01
577500 -- [-956.523] (-961.646) (-964.459) (-962.913) * (-968.713) [-960.132] (-954.327) (-996.958) -- 0:03:02
578000 -- (-974.868) (-982.655) [-950.988] (-949.292) * (-967.706) [-942.187] (-977.475) (-979.020) -- 0:03:01
578500 -- (-979.116) (-969.208) [-961.711] (-947.529) * (-966.851) (-967.454) (-973.804) [-969.094] -- 0:03:01
579000 -- (-979.591) (-976.984) (-963.957) [-962.355] * (-973.089) (-953.656) [-968.117] (-986.071) -- 0:03:01
579500 -- (-984.235) (-956.707) [-957.503] (-969.447) * [-962.951] (-953.203) (-966.782) (-991.135) -- 0:03:00
580000 -- (-972.697) (-964.893) [-959.340] (-969.061) * [-959.162] (-950.039) (-983.587) (-985.652) -- 0:03:01
Average standard deviation of split frequencies: 0.012547
580500 -- (-982.814) [-955.306] (-967.071) (-1002.885) * (-980.289) [-948.047] (-967.539) (-973.610) -- 0:03:00
581000 -- (-985.540) [-961.525] (-963.479) (-961.805) * (-977.918) (-975.079) [-959.245] (-970.402) -- 0:03:00
581500 -- (-977.542) [-968.433] (-978.606) (-966.468) * (-968.705) (-971.578) [-951.898] (-987.840) -- 0:02:59
582000 -- (-966.668) (-954.696) [-958.668] (-982.300) * [-954.008] (-978.605) (-954.964) (-965.701) -- 0:03:00
582500 -- [-951.560] (-981.244) (-958.561) (-978.065) * (-969.960) (-973.434) (-965.691) [-954.862] -- 0:02:59
583000 -- (-963.562) (-982.643) [-946.254] (-975.059) * (-951.271) [-944.165] (-975.205) (-949.721) -- 0:02:59
583500 -- (-964.209) (-978.233) [-953.085] (-981.986) * (-972.593) [-972.697] (-969.649) (-960.184) -- 0:02:59
584000 -- (-978.326) (-965.107) [-957.736] (-969.065) * (-960.839) (-991.955) [-953.672] (-980.875) -- 0:02:58
584500 -- (-972.407) (-961.786) (-971.057) [-963.006] * (-964.179) (-981.674) [-957.900] (-965.970) -- 0:02:59
585000 -- (-977.505) (-960.326) [-964.879] (-974.529) * (-965.827) (-983.803) [-938.089] (-995.569) -- 0:02:58
Average standard deviation of split frequencies: 0.012213
585500 -- [-960.772] (-959.795) (-980.302) (-978.905) * [-959.393] (-983.508) (-959.865) (-969.926) -- 0:02:58
586000 -- [-957.246] (-974.595) (-968.069) (-973.606) * (-957.683) (-973.097) [-944.134] (-967.544) -- 0:02:58
586500 -- (-965.048) (-966.216) [-952.879] (-982.066) * [-943.790] (-976.949) (-984.388) (-954.607) -- 0:02:57
587000 -- (-970.741) (-980.749) [-961.026] (-961.468) * (-969.861) [-953.155] (-957.135) (-978.820) -- 0:02:58
587500 -- (-976.998) (-976.879) [-953.051] (-953.600) * (-993.779) [-957.850] (-955.750) (-978.229) -- 0:02:57
588000 -- (-965.841) (-982.694) [-953.039] (-965.599) * (-981.921) [-943.297] (-955.152) (-965.479) -- 0:02:57
588500 -- (-969.662) [-951.893] (-966.888) (-963.089) * (-972.098) (-954.559) (-960.535) [-949.410] -- 0:02:56
589000 -- (-961.464) (-960.168) [-959.221] (-981.405) * (-975.615) (-973.739) (-958.538) [-957.972] -- 0:02:57
589500 -- (-962.270) (-970.819) [-953.542] (-976.038) * (-997.049) (-953.813) [-963.850] (-962.471) -- 0:02:56
590000 -- (-968.162) (-967.332) [-958.682] (-969.972) * (-1009.918) (-956.011) (-965.082) [-948.812] -- 0:02:56
Average standard deviation of split frequencies: 0.012165
590500 -- (-988.482) (-985.056) [-963.632] (-973.251) * (-987.222) [-953.038] (-959.742) (-986.374) -- 0:02:56
591000 -- (-980.190) (-973.654) [-965.189] (-997.789) * (-989.657) (-944.502) [-965.013] (-979.656) -- 0:02:55
591500 -- [-962.271] (-977.377) (-963.684) (-982.431) * (-1001.885) (-950.506) (-985.503) [-965.589] -- 0:02:56
592000 -- (-978.905) (-971.776) [-952.312] (-966.425) * (-981.351) (-976.551) [-956.994] (-965.458) -- 0:02:55
592500 -- (-976.859) (-975.233) (-977.817) [-955.308] * (-972.365) (-954.239) [-944.719] (-967.464) -- 0:02:55
593000 -- (-969.510) [-968.734] (-974.584) (-976.580) * (-975.281) (-965.657) (-959.447) [-959.406] -- 0:02:55
593500 -- (-975.725) (-971.580) [-963.401] (-968.564) * (-994.247) [-949.306] (-977.863) (-969.946) -- 0:02:55
594000 -- [-964.216] (-981.497) (-974.790) (-976.961) * [-975.449] (-972.474) (-958.886) (-985.574) -- 0:02:54
594500 -- (-962.615) (-976.861) (-987.626) [-969.737] * [-956.939] (-953.425) (-967.886) (-963.526) -- 0:02:54
595000 -- (-985.803) [-965.376] (-958.944) (-973.603) * (-964.231) (-961.297) (-966.190) [-953.271] -- 0:02:54
Average standard deviation of split frequencies: 0.012056
595500 -- (-985.267) [-964.680] (-963.655) (-980.036) * (-963.624) [-946.918] (-982.426) (-960.155) -- 0:02:54
596000 -- (-980.012) (-959.589) [-964.003] (-973.767) * [-953.961] (-967.827) (-966.906) (-962.018) -- 0:02:54
596500 -- [-963.105] (-972.445) (-970.631) (-969.483) * (-985.877) [-959.780] (-991.331) (-966.378) -- 0:02:53
597000 -- (-986.666) (-984.936) [-957.896] (-960.406) * [-959.436] (-953.007) (-958.963) (-968.794) -- 0:02:53
597500 -- (-966.914) [-986.650] (-971.495) (-971.640) * (-956.247) (-965.281) (-977.605) [-969.908] -- 0:02:53
598000 -- (-979.540) (-987.252) [-957.083] (-990.005) * (-988.559) (-971.530) [-958.816] (-979.050) -- 0:02:53
598500 -- (-976.939) (-980.982) (-977.594) [-956.647] * (-988.471) [-958.432] (-961.698) (-973.129) -- 0:02:53
599000 -- (-985.381) (-964.027) (-968.995) [-954.280] * (-970.227) (-974.796) [-950.441] (-973.743) -- 0:02:52
599500 -- (-971.757) (-995.083) [-959.293] (-957.800) * (-974.026) [-953.907] (-971.650) (-975.729) -- 0:02:52
600000 -- [-965.936] (-985.573) (-957.832) (-971.830) * (-976.729) (-980.460) [-955.292] (-980.870) -- 0:02:52
Average standard deviation of split frequencies: 0.012176
600500 -- [-955.377] (-977.393) (-975.707) (-982.557) * (-976.389) [-962.566] (-952.331) (-960.208) -- 0:02:52
601000 -- [-964.839] (-974.347) (-971.167) (-970.136) * (-972.736) [-958.772] (-955.817) (-971.350) -- 0:02:51
601500 -- (-972.103) (-966.953) (-982.100) [-968.698] * [-946.642] (-970.167) (-959.210) (-962.001) -- 0:02:51
602000 -- (-972.153) [-963.164] (-976.688) (-975.393) * (-975.511) (-965.440) [-950.097] (-966.386) -- 0:02:51
602500 -- [-955.908] (-957.753) (-971.143) (-973.546) * (-993.850) (-960.130) (-979.562) [-953.083] -- 0:02:51
603000 -- (-958.127) (-977.634) [-959.719] (-971.351) * (-1004.055) (-959.883) (-974.426) [-944.774] -- 0:02:51
603500 -- (-966.436) (-973.044) (-960.673) [-956.219] * (-999.526) [-960.807] (-978.351) (-962.125) -- 0:02:50
604000 -- (-964.074) (-962.080) [-948.672] (-984.054) * (-973.496) (-982.832) [-957.043] (-973.554) -- 0:02:50
604500 -- [-959.098] (-979.495) (-952.482) (-979.100) * (-989.171) (-974.040) (-953.647) [-967.747] -- 0:02:50
605000 -- (-965.410) [-950.141] (-959.051) (-982.427) * (-956.394) (-972.796) [-954.544] (-975.986) -- 0:02:50
Average standard deviation of split frequencies: 0.012305
605500 -- [-958.146] (-974.499) (-988.503) (-985.929) * (-983.625) (-947.123) [-938.467] (-971.762) -- 0:02:50
606000 -- [-950.391] (-966.833) (-970.149) (-996.548) * (-993.635) [-951.062] (-977.340) (-959.734) -- 0:02:49
606500 -- [-957.615] (-968.936) (-974.045) (-985.519) * (-995.565) (-958.850) [-961.184] (-955.576) -- 0:02:49
607000 -- [-949.168] (-974.562) (-978.236) (-985.934) * (-988.333) (-961.728) [-954.974] (-957.988) -- 0:02:49
607500 -- (-961.869) [-957.841] (-976.303) (-980.879) * (-968.579) (-971.310) [-947.609] (-948.065) -- 0:02:49
608000 -- (-973.267) (-957.016) (-985.049) [-957.940] * (-967.018) (-966.168) (-981.416) [-949.606] -- 0:02:48
608500 -- (-974.296) [-955.185] (-990.006) (-955.372) * (-956.449) (-952.473) (-970.053) [-961.081] -- 0:02:48
609000 -- (-969.588) [-962.399] (-979.768) (-971.471) * (-960.352) [-953.469] (-956.844) (-982.655) -- 0:02:48
609500 -- (-977.139) (-985.219) [-971.961] (-984.567) * (-968.825) [-952.435] (-967.141) (-979.213) -- 0:02:48
610000 -- (-978.577) (-960.522) (-974.495) [-966.189] * (-976.911) [-952.646] (-985.751) (-975.359) -- 0:02:48
Average standard deviation of split frequencies: 0.012445
610500 -- (-998.797) (-967.865) (-981.551) [-961.941] * [-972.812] (-981.204) (-973.378) (-965.492) -- 0:02:47
611000 -- (-976.646) [-960.325] (-967.924) (-969.970) * (-957.717) (-966.492) (-974.053) [-954.874] -- 0:02:47
611500 -- (-983.043) (-975.933) [-961.111] (-965.646) * [-943.535] (-977.182) (-988.474) (-965.387) -- 0:02:47
612000 -- (-994.005) (-966.464) [-955.334] (-959.203) * [-965.927] (-983.811) (-984.168) (-957.605) -- 0:02:47
612500 -- (-1000.465) (-959.702) [-957.171] (-972.938) * (-954.131) (-1004.537) [-952.708] (-964.820) -- 0:02:47
613000 -- (-987.210) (-964.972) (-964.176) [-960.120] * (-965.933) (-966.673) (-958.493) [-960.660] -- 0:02:46
613500 -- (-979.028) [-959.322] (-972.607) (-956.509) * (-977.377) (-983.993) (-961.941) [-977.531] -- 0:02:46
614000 -- (-992.346) (-957.491) [-962.859] (-959.877) * (-966.976) (-977.575) [-955.758] (-957.473) -- 0:02:46
614500 -- (-991.482) (-965.740) (-950.966) [-969.519] * (-961.926) (-976.013) (-979.624) [-949.854] -- 0:02:46
615000 -- (-981.138) (-971.035) [-953.158] (-964.734) * (-982.435) (-976.144) (-975.919) [-947.440] -- 0:02:45
Average standard deviation of split frequencies: 0.012546
615500 -- (-977.051) (-964.242) (-971.711) [-962.944] * (-975.137) (-958.453) (-980.530) [-960.501] -- 0:02:45
616000 -- (-982.508) (-957.370) (-960.877) [-954.311] * [-954.177] (-977.305) (-970.053) (-965.149) -- 0:02:45
616500 -- (-992.100) (-981.725) (-974.487) [-960.637] * (-957.428) (-969.045) [-964.490] (-974.043) -- 0:02:45
617000 -- (-996.994) (-987.838) (-970.575) [-965.352] * [-954.076] (-980.091) (-962.819) (-972.943) -- 0:02:45
617500 -- (-992.104) (-980.804) (-970.871) [-959.941] * [-961.472] (-964.672) (-957.260) (-977.353) -- 0:02:44
618000 -- (-982.528) (-972.665) [-962.509] (-977.231) * [-950.884] (-975.425) (-957.113) (-964.398) -- 0:02:45
618500 -- (-990.255) (-972.581) [-960.923] (-973.011) * [-944.434] (-975.754) (-962.964) (-949.018) -- 0:02:44
619000 -- (-984.076) (-982.650) [-964.777] (-971.983) * [-957.305] (-984.392) (-967.483) (-975.093) -- 0:02:44
619500 -- (-994.195) (-967.170) [-950.889] (-985.332) * (-973.257) (-977.819) [-957.053] (-976.666) -- 0:02:43
620000 -- (-975.849) [-962.579] (-954.788) (-982.665) * (-981.561) (-967.436) [-955.120] (-986.591) -- 0:02:43
Average standard deviation of split frequencies: 0.012590
620500 -- (-982.637) (-982.959) (-965.782) [-965.278] * (-975.600) (-961.526) [-957.192] (-977.838) -- 0:02:43
621000 -- (-964.202) (-980.622) [-953.836] (-963.947) * (-968.588) [-965.760] (-969.687) (-990.504) -- 0:02:43
621500 -- (-981.213) (-968.987) (-969.704) [-960.187] * (-974.874) [-947.101] (-959.554) (-986.406) -- 0:02:43
622000 -- (-977.338) (-981.672) [-958.925] (-990.799) * (-955.016) (-996.682) (-981.133) [-953.514] -- 0:02:42
622500 -- (-977.116) (-975.862) [-964.933] (-995.166) * (-965.321) [-954.303] (-974.540) (-965.785) -- 0:02:43
623000 -- (-974.588) (-971.622) [-957.440] (-996.317) * (-964.855) [-960.941] (-976.628) (-986.166) -- 0:02:42
623500 -- [-956.577] (-987.992) (-967.591) (-988.661) * (-965.427) (-937.006) [-958.356] (-981.311) -- 0:02:42
624000 -- [-956.014] (-961.905) (-971.259) (-979.412) * (-973.747) (-957.714) [-968.715] (-969.473) -- 0:02:42
624500 -- [-948.252] (-980.360) (-949.921) (-968.107) * (-966.801) (-955.549) (-973.595) [-961.420] -- 0:02:41
625000 -- (-948.153) (-982.912) [-957.715] (-968.331) * [-972.193] (-975.946) (-963.671) (-975.532) -- 0:02:42
Average standard deviation of split frequencies: 0.012710
625500 -- (-945.851) (-999.996) [-958.332] (-972.776) * (-977.982) [-976.251] (-981.715) (-971.926) -- 0:02:41
626000 -- (-973.810) (-978.655) (-977.838) [-952.722] * [-958.212] (-960.806) (-1004.647) (-968.126) -- 0:02:41
626500 -- (-987.570) [-949.489] (-977.952) (-969.368) * (-962.622) [-959.695] (-986.787) (-964.662) -- 0:02:40
627000 -- (-978.029) [-957.990] (-986.479) (-954.217) * [-956.310] (-961.933) (-985.907) (-966.779) -- 0:02:41
627500 -- (-956.901) [-964.008] (-980.758) (-972.246) * (-967.674) [-966.501] (-985.028) (-974.258) -- 0:02:40
628000 -- (-973.039) (-985.976) [-952.781] (-962.986) * (-981.670) (-961.941) [-974.402] (-963.245) -- 0:02:40
628500 -- (-957.176) (-974.435) [-959.859] (-972.691) * [-956.095] (-957.200) (-1002.510) (-966.445) -- 0:02:40
629000 -- (-967.008) [-964.841] (-976.080) (-979.973) * [-958.406] (-979.081) (-994.299) (-957.771) -- 0:02:39
629500 -- (-953.207) (-957.508) (-975.152) [-967.368] * (-957.357) (-962.065) (-986.486) [-956.977] -- 0:02:40
630000 -- (-957.666) (-973.048) (-974.921) [-981.679] * (-971.140) (-972.080) (-990.138) [-955.866] -- 0:02:39
Average standard deviation of split frequencies: 0.012956
630500 -- (-946.621) (-968.671) [-953.224] (-975.012) * (-967.159) (-991.148) (-984.046) [-947.959] -- 0:02:39
631000 -- (-950.289) (-975.845) [-968.820] (-978.181) * (-972.418) (-989.162) (-983.786) [-949.292] -- 0:02:39
631500 -- [-957.367] (-966.805) (-985.898) (-972.406) * [-958.502] (-976.355) (-990.187) (-977.266) -- 0:02:38
632000 -- [-940.932] (-963.776) (-970.146) (-973.569) * (-974.139) [-957.547] (-985.835) (-983.649) -- 0:02:38
632500 -- [-957.451] (-965.912) (-967.914) (-987.812) * [-973.300] (-968.238) (-1005.896) (-972.433) -- 0:02:38
633000 -- [-960.397] (-978.254) (-983.485) (-981.238) * [-949.986] (-984.473) (-992.564) (-959.625) -- 0:02:38
633500 -- [-942.970] (-983.482) (-998.255) (-964.289) * [-961.756] (-973.108) (-996.595) (-955.419) -- 0:02:37
634000 -- [-954.708] (-973.985) (-962.286) (-979.242) * (-983.291) (-974.957) (-985.928) [-957.932] -- 0:02:38
634500 -- [-962.631] (-979.623) (-963.582) (-953.571) * (-972.067) (-955.803) (-990.782) [-953.288] -- 0:02:37
635000 -- [-967.258] (-971.583) (-959.214) (-964.605) * (-985.244) (-967.515) (-990.608) [-948.529] -- 0:02:37
Average standard deviation of split frequencies: 0.012556
635500 -- (-982.522) (-971.001) [-949.407] (-976.649) * (-977.752) (-955.270) (-975.593) [-960.635] -- 0:02:37
636000 -- (-966.646) [-952.483] (-968.331) (-975.733) * (-979.918) (-959.035) (-974.463) [-954.917] -- 0:02:37
636500 -- [-954.344] (-984.874) (-944.830) (-972.586) * (-986.957) (-976.595) (-1002.929) [-955.244] -- 0:02:37
637000 -- [-972.391] (-972.655) (-955.340) (-962.775) * (-986.518) (-982.697) (-985.032) [-947.580] -- 0:02:36
637500 -- (-969.190) [-946.775] (-968.620) (-979.107) * (-994.661) (-959.475) (-980.293) [-949.447] -- 0:02:36
638000 -- (-973.839) (-949.889) (-980.231) [-960.894] * (-985.045) (-975.324) (-968.014) [-965.398] -- 0:02:36
638500 -- [-975.383] (-961.265) (-966.110) (-975.418) * (-977.857) [-955.428] (-983.398) (-967.609) -- 0:02:36
639000 -- [-950.456] (-954.239) (-965.469) (-975.068) * (-983.668) (-955.491) (-989.217) [-958.698] -- 0:02:35
639500 -- (-961.291) [-949.224] (-974.525) (-984.439) * (-991.169) [-945.945] (-984.841) (-962.779) -- 0:02:35
640000 -- (-983.783) (-953.127) [-947.448] (-978.457) * (-970.942) [-947.429] (-976.531) (-970.305) -- 0:02:35
Average standard deviation of split frequencies: 0.011862
640500 -- (-979.884) [-970.715] (-965.103) (-970.771) * (-969.727) [-950.553] (-977.493) (-966.446) -- 0:02:35
641000 -- (-971.244) (-967.442) [-947.266] (-983.816) * (-968.442) [-947.362] (-986.107) (-958.008) -- 0:02:35
641500 -- (-999.050) (-960.993) (-969.212) [-960.974] * (-963.406) (-970.320) (-980.510) [-955.146] -- 0:02:34
642000 -- (-971.761) (-974.118) (-981.903) [-954.257] * (-964.800) (-988.454) (-978.208) [-961.873] -- 0:02:34
642500 -- (-966.623) (-970.702) [-969.450] (-963.861) * (-977.218) [-969.337] (-980.150) (-956.300) -- 0:02:34
643000 -- (-970.964) (-968.595) (-967.821) [-950.994] * (-982.817) (-962.566) (-985.725) [-955.375] -- 0:02:34
643500 -- (-990.723) (-972.631) (-968.582) [-954.097] * [-960.881] (-975.340) (-974.740) (-964.319) -- 0:02:34
644000 -- (-964.138) (-964.247) (-971.956) [-951.684] * [-957.736] (-981.476) (-980.127) (-975.967) -- 0:02:33
644500 -- (-970.458) (-966.728) (-961.184) [-956.649] * (-975.532) (-978.421) (-975.118) [-959.586] -- 0:02:33
645000 -- [-968.839] (-979.033) (-944.916) (-969.618) * (-965.410) (-978.787) (-980.760) [-951.376] -- 0:02:33
Average standard deviation of split frequencies: 0.011278
645500 -- (-968.674) (-987.129) [-979.120] (-990.687) * (-987.122) (-983.334) (-956.139) [-954.712] -- 0:02:33
646000 -- (-983.438) (-974.851) (-955.727) [-963.905] * (-989.233) (-963.286) (-974.252) [-958.209] -- 0:02:32
646500 -- (-972.353) (-957.148) (-964.836) [-965.463] * (-977.472) (-970.692) (-989.638) [-955.407] -- 0:02:32
647000 -- (-962.720) [-956.663] (-974.343) (-988.201) * (-965.482) (-980.535) (-990.396) [-962.702] -- 0:02:32
647500 -- (-985.204) [-960.602] (-989.275) (-982.365) * [-956.771] (-980.158) (-971.130) (-962.641) -- 0:02:32
648000 -- (-973.458) [-958.307] (-974.740) (-982.645) * (-970.317) (-997.096) [-976.338] (-966.504) -- 0:02:32
648500 -- (-986.639) [-950.039] (-968.899) (-977.325) * (-973.263) (-988.634) [-965.040] (-963.580) -- 0:02:31
649000 -- (-981.311) (-973.993) (-959.824) [-951.398] * (-969.574) (-983.936) (-981.854) [-948.961] -- 0:02:31
649500 -- (-980.488) (-974.774) (-959.254) [-967.226] * (-971.871) [-981.874] (-997.492) (-968.284) -- 0:02:31
650000 -- (-967.240) (-954.489) [-963.013] (-975.653) * [-951.038] (-965.410) (-979.118) (-978.635) -- 0:02:31
Average standard deviation of split frequencies: 0.011197
650500 -- (-969.411) (-979.666) [-960.313] (-970.828) * (-953.706) (-991.305) (-969.456) [-960.060] -- 0:02:30
651000 -- (-969.070) (-979.450) (-968.544) [-957.984] * (-952.266) (-964.346) (-970.684) [-953.759] -- 0:02:30
651500 -- (-960.125) (-969.644) [-961.730] (-959.521) * (-955.025) (-962.496) (-986.079) [-952.506] -- 0:02:30
652000 -- (-982.686) (-979.019) [-960.673] (-958.236) * [-945.714] (-977.977) (-985.746) (-949.959) -- 0:02:30
652500 -- (-960.842) (-982.979) (-963.170) [-956.158] * (-963.858) (-982.259) (-985.517) [-943.219] -- 0:02:30
653000 -- [-939.260] (-955.546) (-978.607) (-960.522) * (-975.111) (-992.541) (-968.005) [-941.652] -- 0:02:29
653500 -- (-958.459) (-984.076) (-986.957) [-960.803] * (-980.862) (-971.453) (-972.476) [-977.004] -- 0:02:29
654000 -- (-950.051) (-965.055) (-1007.231) [-969.088] * (-995.215) (-979.774) (-972.516) [-961.785] -- 0:02:29
654500 -- (-967.603) (-961.620) (-978.961) [-953.860] * (-981.189) (-986.316) (-955.238) [-962.335] -- 0:02:29
655000 -- (-965.903) (-972.903) (-967.397) [-945.770] * (-972.755) (-988.492) (-959.823) [-957.039] -- 0:02:29
Average standard deviation of split frequencies: 0.011563
655500 -- (-945.187) (-971.663) (-983.297) [-942.442] * (-978.138) (-986.850) [-945.466] (-964.298) -- 0:02:28
656000 -- [-956.393] (-972.163) (-979.501) (-966.702) * (-988.780) (-970.039) [-949.558] (-964.893) -- 0:02:28
656500 -- [-962.846] (-982.949) (-972.647) (-946.938) * (-980.236) [-958.941] (-953.990) (-980.351) -- 0:02:28
657000 -- (-968.347) [-960.941] (-952.826) (-957.352) * (-985.205) [-953.697] (-971.307) (-956.448) -- 0:02:28
657500 -- (-972.805) (-985.897) (-992.200) [-946.821] * (-993.925) (-966.319) (-958.374) [-955.113] -- 0:02:27
658000 -- [-954.665] (-961.224) (-992.553) (-964.716) * (-978.971) (-986.715) [-962.226] (-961.840) -- 0:02:27
658500 -- (-959.157) (-989.933) (-973.121) [-950.237] * [-974.283] (-979.848) (-970.110) (-979.895) -- 0:02:27
659000 -- [-951.018] (-967.535) (-976.774) (-952.943) * (-974.545) (-969.290) (-961.536) [-951.578] -- 0:02:27
659500 -- (-956.193) (-983.646) [-955.484] (-963.105) * (-991.899) (-960.954) [-950.941] (-966.742) -- 0:02:27
660000 -- (-959.692) (-982.571) (-980.783) [-957.258] * (-1003.447) [-969.346] (-966.091) (-944.088) -- 0:02:26
Average standard deviation of split frequencies: 0.011460
660500 -- (-956.193) (-969.619) (-989.185) [-955.058] * (-992.922) (-991.996) (-970.218) [-952.243] -- 0:02:27
661000 -- [-960.741] (-968.404) (-988.019) (-958.462) * (-969.094) [-980.870] (-956.411) (-965.697) -- 0:02:26
661500 -- (-951.293) (-985.545) [-963.993] (-978.147) * (-982.262) (-980.657) [-957.032] (-975.942) -- 0:02:26
662000 -- [-951.502] (-996.031) (-981.359) (-987.529) * (-971.797) (-986.021) [-957.495] (-980.391) -- 0:02:26
662500 -- [-944.157] (-985.349) (-988.214) (-955.806) * (-982.395) (-977.370) [-964.939] (-977.249) -- 0:02:26
663000 -- [-953.046] (-974.223) (-987.785) (-967.234) * (-985.764) [-962.552] (-960.203) (-986.629) -- 0:02:25
663500 -- (-955.696) (-994.845) (-971.636) [-956.935] * (-988.603) (-965.857) [-959.957] (-960.877) -- 0:02:25
664000 -- [-949.770] (-955.048) (-974.411) (-969.658) * (-977.126) (-976.050) [-953.914] (-962.330) -- 0:02:25
664500 -- [-952.413] (-967.382) (-979.166) (-968.717) * (-981.522) (-963.205) (-989.843) [-960.573] -- 0:02:24
665000 -- (-966.090) (-962.096) (-996.120) [-961.750] * [-959.055] (-977.695) (-973.308) (-969.470) -- 0:02:25
Average standard deviation of split frequencies: 0.011861
665500 -- [-953.984] (-973.387) (-988.112) (-961.552) * [-951.233] (-965.824) (-964.378) (-977.128) -- 0:02:24
666000 -- (-987.334) [-966.813] (-998.746) (-962.708) * (-949.705) (-972.274) [-936.613] (-971.035) -- 0:02:24
666500 -- (-979.470) [-958.420] (-997.998) (-970.975) * [-947.822] (-979.918) (-950.875) (-987.149) -- 0:02:24
667000 -- (-984.231) (-992.892) (-969.320) [-969.555] * [-957.930] (-1005.412) (-953.938) (-962.387) -- 0:02:23
667500 -- [-963.432] (-989.149) (-977.574) (-971.374) * (-974.933) (-984.966) [-964.647] (-946.892) -- 0:02:23
668000 -- (-981.201) (-974.159) (-982.613) [-960.045] * [-957.915] (-970.350) (-977.089) (-952.362) -- 0:02:23
668500 -- (-975.625) (-987.268) (-984.426) [-956.971] * [-957.573] (-954.547) (-996.323) (-960.706) -- 0:02:23
669000 -- [-949.509] (-1001.402) (-976.540) (-965.847) * [-950.646] (-970.324) (-980.008) (-973.917) -- 0:02:22
669500 -- (-958.575) (-977.866) (-991.120) [-969.398] * (-947.550) (-972.478) [-957.598] (-963.557) -- 0:02:23
670000 -- (-973.796) (-994.651) (-973.634) [-944.628] * (-961.095) (-975.912) [-944.964] (-988.493) -- 0:02:22
Average standard deviation of split frequencies: 0.012077
670500 -- (-984.283) (-990.216) (-966.322) [-969.796] * (-955.187) (-974.131) (-973.481) [-959.730] -- 0:02:22
671000 -- (-984.469) [-967.148] (-971.198) (-986.951) * (-957.467) [-966.181] (-968.022) (-980.157) -- 0:02:22
671500 -- [-948.692] (-982.144) (-975.730) (-984.395) * [-959.193] (-955.358) (-965.489) (-989.689) -- 0:02:21
672000 -- (-958.767) (-958.860) [-963.203] (-980.271) * [-958.087] (-959.634) (-953.404) (-988.469) -- 0:02:22
672500 -- [-958.796] (-967.116) (-966.660) (-968.907) * (-968.390) (-960.343) [-949.684] (-982.586) -- 0:02:21
673000 -- (-957.408) (-999.775) [-972.304] (-972.007) * [-972.978] (-987.755) (-970.201) (-971.458) -- 0:02:21
673500 -- [-967.458] (-998.036) (-965.345) (-972.953) * (-969.712) (-982.291) [-983.308] (-970.892) -- 0:02:21
674000 -- (-966.954) [-960.916] (-963.222) (-976.816) * [-969.114] (-982.666) (-961.366) (-991.105) -- 0:02:20
674500 -- (-968.204) (-980.100) (-965.999) [-978.994] * (-981.210) [-961.981] (-963.127) (-963.792) -- 0:02:20
675000 -- (-950.312) (-981.456) (-982.316) [-960.729] * [-958.686] (-953.554) (-966.320) (-966.696) -- 0:02:20
Average standard deviation of split frequencies: 0.011665
675500 -- [-966.387] (-987.433) (-966.454) (-955.013) * (-947.730) (-976.534) [-966.171] (-991.235) -- 0:02:20
676000 -- (-983.288) [-961.518] (-983.506) (-955.059) * (-958.754) [-949.441] (-968.965) (-976.087) -- 0:02:19
676500 -- (-976.519) [-949.834] (-981.086) (-966.991) * (-966.537) [-961.507] (-946.121) (-978.282) -- 0:02:19
677000 -- (-972.211) [-952.527] (-964.070) (-970.638) * (-958.870) [-947.496] (-965.274) (-966.528) -- 0:02:19
677500 -- (-967.764) [-959.273] (-977.324) (-975.865) * [-955.944] (-955.646) (-961.160) (-970.459) -- 0:02:19
678000 -- (-968.702) [-960.829] (-990.340) (-962.724) * [-969.406] (-973.700) (-971.285) (-984.505) -- 0:02:19
678500 -- [-956.147] (-983.414) (-989.998) (-960.814) * [-961.565] (-983.929) (-983.914) (-971.404) -- 0:02:18
679000 -- (-964.657) [-958.558] (-993.933) (-950.783) * (-978.230) (-990.462) [-953.589] (-967.809) -- 0:02:18
679500 -- (-964.884) [-952.839] (-983.145) (-966.307) * [-981.747] (-978.721) (-948.654) (-968.560) -- 0:02:18
680000 -- (-971.671) [-960.452] (-984.287) (-964.002) * (-968.994) (-989.731) [-956.605] (-958.723) -- 0:02:18
Average standard deviation of split frequencies: 0.011816
680500 -- (-986.265) (-955.066) (-993.501) [-960.073] * (-976.182) [-970.829] (-966.864) (-951.522) -- 0:02:18
681000 -- (-977.133) [-952.199] (-984.922) (-951.009) * (-965.810) [-966.051] (-976.347) (-970.370) -- 0:02:17
681500 -- (-967.513) (-975.391) (-967.822) [-947.748] * [-946.267] (-972.482) (-973.001) (-960.106) -- 0:02:17
682000 -- (-977.416) (-968.363) (-986.216) [-954.439] * (-962.989) [-952.604] (-964.490) (-975.851) -- 0:02:17
682500 -- (-968.363) (-978.370) (-974.858) [-954.157] * [-946.010] (-971.903) (-966.250) (-961.008) -- 0:02:17
683000 -- (-969.343) (-971.927) (-984.150) [-956.097] * (-953.985) (-961.307) [-967.443] (-964.946) -- 0:02:16
683500 -- (-961.005) [-967.579] (-989.801) (-969.444) * (-964.538) (-969.401) [-956.166] (-966.874) -- 0:02:16
684000 -- [-955.115] (-954.297) (-973.452) (-989.203) * (-956.451) (-969.814) (-984.176) [-950.750] -- 0:02:16
684500 -- (-977.392) (-954.392) [-957.195] (-978.377) * (-970.702) [-951.728] (-966.454) (-959.637) -- 0:02:16
685000 -- [-962.096] (-971.564) (-959.916) (-984.390) * (-979.627) [-958.883] (-989.165) (-963.159) -- 0:02:16
Average standard deviation of split frequencies: 0.011983
685500 -- (-965.914) [-966.267] (-974.396) (-971.056) * (-969.703) [-945.878] (-970.464) (-966.312) -- 0:02:15
686000 -- [-959.522] (-960.969) (-985.473) (-961.669) * (-973.630) [-952.447] (-980.063) (-957.061) -- 0:02:15
686500 -- [-953.086] (-967.073) (-971.276) (-986.788) * [-957.822] (-966.305) (-984.592) (-963.324) -- 0:02:15
687000 -- [-953.503] (-957.362) (-963.903) (-972.803) * (-961.402) [-948.252] (-982.982) (-975.991) -- 0:02:15
687500 -- (-969.236) (-966.646) [-951.952] (-973.856) * (-950.571) [-956.060] (-966.185) (-964.159) -- 0:02:15
688000 -- [-976.234] (-953.067) (-962.593) (-973.820) * [-964.037] (-957.011) (-969.545) (-975.781) -- 0:02:14
688500 -- (-951.156) [-962.696] (-954.406) (-973.899) * [-960.247] (-960.739) (-962.916) (-989.464) -- 0:02:14
689000 -- [-954.616] (-970.077) (-960.102) (-968.363) * (-979.230) [-956.818] (-976.280) (-987.593) -- 0:02:14
689500 -- (-962.822) [-958.672] (-984.419) (-971.945) * (-981.362) [-946.151] (-990.514) (-980.069) -- 0:02:14
690000 -- [-954.639] (-963.824) (-969.864) (-977.894) * (-976.091) [-951.308] (-971.233) (-967.137) -- 0:02:13
Average standard deviation of split frequencies: 0.012414
690500 -- [-970.519] (-961.295) (-985.949) (-966.392) * (-976.812) (-952.672) [-957.732] (-964.623) -- 0:02:13
691000 -- (-980.700) (-968.131) (-981.240) [-958.211] * [-944.885] (-962.311) (-959.160) (-973.725) -- 0:02:13
691500 -- (-958.956) (-963.477) (-972.628) [-954.222] * (-964.970) (-964.786) [-953.525] (-979.599) -- 0:02:12
692000 -- [-953.887] (-990.536) (-979.564) (-978.163) * (-963.176) (-957.900) [-948.661] (-969.055) -- 0:02:13
692500 -- (-954.742) (-954.636) (-995.821) [-973.056] * [-959.075] (-959.466) (-966.622) (-976.942) -- 0:02:12
693000 -- [-968.421] (-958.756) (-988.173) (-985.061) * [-959.108] (-956.209) (-961.330) (-986.567) -- 0:02:12
693500 -- (-998.137) [-951.338] (-980.150) (-978.403) * [-960.864] (-960.417) (-975.284) (-990.240) -- 0:02:12
694000 -- (-972.771) [-952.538] (-987.039) (-967.595) * (-989.195) [-959.668] (-967.795) (-998.608) -- 0:02:11
694500 -- (-981.604) (-999.025) (-969.315) [-977.982] * [-969.711] (-968.934) (-979.752) (-965.100) -- 0:02:11
695000 -- (-980.752) [-945.047] (-974.214) (-990.595) * (-971.497) [-951.792] (-986.958) (-969.476) -- 0:02:11
Average standard deviation of split frequencies: 0.011959
695500 -- [-961.274] (-960.401) (-970.632) (-976.301) * [-968.582] (-956.403) (-996.178) (-969.775) -- 0:02:11
696000 -- (-972.196) (-962.531) [-963.810] (-979.052) * [-961.150] (-979.816) (-973.846) (-979.649) -- 0:02:11
696500 -- (-989.892) [-955.538] (-972.208) (-972.528) * (-963.268) [-961.637] (-984.065) (-965.333) -- 0:02:10
697000 -- (-982.996) (-972.306) (-951.323) [-971.322] * [-961.051] (-963.421) (-979.062) (-970.217) -- 0:02:10
697500 -- (-979.266) (-969.906) [-963.239] (-972.422) * [-965.248] (-960.386) (-971.600) (-966.081) -- 0:02:10
698000 -- (-949.325) [-959.433] (-972.914) (-972.953) * (-982.786) [-958.919] (-977.760) (-964.867) -- 0:02:10
698500 -- (-957.013) [-959.490] (-987.397) (-977.067) * (-952.554) (-984.338) [-949.566] (-977.304) -- 0:02:09
699000 -- (-966.919) [-963.483] (-965.027) (-988.709) * (-971.455) (-972.499) [-952.308] (-974.768) -- 0:02:09
699500 -- [-974.263] (-969.283) (-981.953) (-975.438) * (-967.879) [-955.795] (-968.227) (-1000.261) -- 0:02:09
700000 -- (-977.771) (-969.399) (-969.557) [-959.205] * [-966.158] (-956.765) (-990.751) (-981.219) -- 0:02:09
Average standard deviation of split frequencies: 0.012026
700500 -- (-982.278) (-965.882) (-967.715) [-985.466] * (-963.977) [-959.104] (-982.279) (-994.089) -- 0:02:09
701000 -- (-979.684) (-966.450) [-955.779] (-983.999) * (-980.077) (-966.310) (-974.652) [-959.536] -- 0:02:08
701500 -- (-978.297) [-961.929] (-970.931) (-951.242) * [-952.648] (-965.846) (-986.708) (-984.385) -- 0:02:08
702000 -- (-980.668) (-979.776) [-973.379] (-962.640) * [-969.848] (-960.637) (-981.575) (-971.449) -- 0:02:08
702500 -- (-991.322) (-974.249) [-946.323] (-959.638) * (-973.670) [-962.448] (-988.871) (-997.056) -- 0:02:08
703000 -- [-967.493] (-967.969) (-992.856) (-956.910) * (-971.585) [-953.493] (-982.393) (-973.625) -- 0:02:08
703500 -- [-975.869] (-970.513) (-996.334) (-970.912) * (-962.563) (-958.766) (-977.093) [-957.941] -- 0:02:07
704000 -- (-964.397) [-969.234] (-978.819) (-963.410) * (-968.457) (-968.084) (-977.892) [-952.729] -- 0:02:07
704500 -- (-986.621) (-966.033) [-950.114] (-969.158) * (-977.300) [-978.702] (-980.171) (-972.597) -- 0:02:07
705000 -- [-968.085] (-969.437) (-966.282) (-982.861) * (-956.884) (-981.342) (-977.189) [-950.751] -- 0:02:07
Average standard deviation of split frequencies: 0.011706
705500 -- (-969.764) (-953.393) [-951.999] (-974.207) * (-955.745) (-978.446) (-986.387) [-948.360] -- 0:02:06
706000 -- (-966.805) (-965.548) [-956.108] (-974.639) * [-959.387] (-975.447) (-984.177) (-955.646) -- 0:02:06
706500 -- [-956.268] (-971.340) (-970.383) (-985.628) * (-989.184) [-957.789] (-979.304) (-966.560) -- 0:02:06
707000 -- (-976.364) [-958.265] (-963.253) (-968.621) * (-983.899) [-952.375] (-986.105) (-975.676) -- 0:02:05
707500 -- (-974.627) (-964.936) [-959.720] (-973.650) * (-979.138) [-948.927] (-978.794) (-961.954) -- 0:02:05
708000 -- (-975.425) (-958.954) (-963.764) [-961.560] * (-977.337) [-966.207] (-974.266) (-969.391) -- 0:02:05
708500 -- (-988.375) (-957.930) (-969.178) [-969.396] * (-983.858) [-960.342] (-971.278) (-977.893) -- 0:02:05
709000 -- (-963.395) [-950.880] (-986.993) (-981.259) * (-981.056) (-961.184) (-967.012) [-975.602] -- 0:02:05
709500 -- [-957.210] (-988.795) (-970.774) (-984.946) * (-976.421) (-956.557) [-960.753] (-964.115) -- 0:02:04
710000 -- (-980.725) [-961.897] (-976.575) (-976.212) * (-979.244) [-950.946] (-969.411) (-961.917) -- 0:02:04
Average standard deviation of split frequencies: 0.011256
710500 -- (-973.644) [-962.330] (-985.487) (-987.923) * (-976.701) (-964.336) (-966.287) [-972.159] -- 0:02:04
711000 -- (-967.587) (-956.461) (-971.077) [-964.524] * (-977.340) (-966.291) [-943.352] (-986.982) -- 0:02:04
711500 -- (-965.812) [-953.248] (-971.247) (-978.356) * (-988.783) (-951.096) [-944.065] (-984.105) -- 0:02:04
712000 -- [-962.118] (-963.737) (-988.645) (-969.232) * (-971.350) [-940.348] (-952.529) (-990.492) -- 0:02:03
712500 -- [-957.201] (-976.346) (-976.859) (-963.321) * (-968.255) (-956.985) [-946.061] (-974.142) -- 0:02:03
713000 -- [-963.877] (-968.267) (-963.209) (-972.799) * (-968.721) (-969.822) [-967.394] (-969.382) -- 0:02:03
713500 -- [-958.657] (-969.261) (-971.527) (-982.695) * (-971.607) (-964.391) [-949.122] (-986.358) -- 0:02:03
714000 -- [-956.622] (-970.555) (-996.671) (-985.353) * (-965.740) (-957.681) (-960.994) [-965.480] -- 0:02:02
714500 -- [-966.423] (-968.753) (-975.546) (-973.899) * (-960.070) [-969.728] (-977.866) (-978.471) -- 0:02:02
715000 -- (-958.218) [-954.982] (-970.611) (-978.273) * (-982.414) (-963.046) (-959.164) [-964.656] -- 0:02:02
Average standard deviation of split frequencies: 0.010884
715500 -- [-947.672] (-949.322) (-979.119) (-969.777) * (-959.389) (-975.632) [-945.778] (-960.708) -- 0:02:02
716000 -- [-951.402] (-960.480) (-975.504) (-980.726) * (-969.970) (-994.880) [-949.481] (-982.758) -- 0:02:02
716500 -- (-965.905) (-967.745) (-986.233) [-962.475] * (-966.471) (-959.618) [-957.283] (-965.547) -- 0:02:01
717000 -- (-970.113) (-961.035) [-956.516] (-994.332) * (-962.203) [-963.610] (-960.224) (-981.580) -- 0:02:01
717500 -- [-950.304] (-963.836) (-951.320) (-979.852) * (-968.646) [-965.720] (-968.298) (-975.869) -- 0:02:01
718000 -- [-950.403] (-969.030) (-961.198) (-988.927) * (-971.228) [-963.925] (-997.901) (-948.138) -- 0:02:01
718500 -- [-958.638] (-968.194) (-972.389) (-988.524) * (-974.699) (-968.551) [-991.554] (-966.688) -- 0:02:01
719000 -- [-953.974] (-962.511) (-975.978) (-971.193) * [-956.721] (-972.850) (-983.166) (-978.085) -- 0:02:00
719500 -- (-966.968) (-972.500) [-961.462] (-977.600) * [-963.939] (-958.588) (-981.126) (-976.280) -- 0:02:00
720000 -- (-984.708) (-972.793) (-974.755) [-965.723] * (-973.422) [-963.164] (-990.245) (-961.279) -- 0:02:00
Average standard deviation of split frequencies: 0.011038
720500 -- (-970.715) (-976.812) [-950.909] (-979.703) * (-973.758) [-964.096] (-982.307) (-970.094) -- 0:01:59
721000 -- [-969.248] (-979.241) (-969.933) (-986.088) * [-968.408] (-981.555) (-976.428) (-986.534) -- 0:01:59
721500 -- (-985.372) [-977.234] (-989.748) (-966.691) * [-952.291] (-988.934) (-962.576) (-989.233) -- 0:01:59
722000 -- (-987.467) (-975.232) (-978.893) [-958.854] * [-952.459] (-966.196) (-977.009) (-983.616) -- 0:01:59
722500 -- (-964.670) (-1006.792) (-967.744) [-955.298] * [-954.286] (-967.865) (-1009.999) (-974.344) -- 0:01:59
723000 -- [-962.137] (-978.742) (-966.530) (-969.643) * (-977.497) [-956.880] (-983.801) (-969.058) -- 0:01:58
723500 -- (-979.324) [-968.833] (-967.125) (-985.908) * [-945.484] (-958.152) (-988.225) (-965.035) -- 0:01:58
724000 -- [-968.482] (-962.758) (-975.546) (-989.648) * [-952.415] (-976.138) (-993.729) (-974.096) -- 0:01:58
724500 -- (-963.724) [-956.729] (-984.831) (-966.499) * (-967.516) (-983.132) (-957.076) [-964.821] -- 0:01:58
725000 -- (-972.119) (-967.948) (-974.368) [-959.758] * (-975.295) (-980.841) (-982.282) [-959.341] -- 0:01:57
Average standard deviation of split frequencies: 0.011099
725500 -- (-978.103) [-965.477] (-963.427) (-961.725) * [-964.717] (-966.497) (-978.287) (-968.999) -- 0:01:57
726000 -- (-975.696) (-980.450) (-962.629) [-964.194] * (-985.364) (-957.489) (-997.930) [-962.974] -- 0:01:57
726500 -- [-949.481] (-989.229) (-979.618) (-961.540) * (-984.949) (-955.546) (-981.527) [-968.991] -- 0:01:57
727000 -- (-961.910) (-981.068) (-976.006) [-954.338] * (-979.848) [-966.569] (-967.584) (-969.818) -- 0:01:57
727500 -- (-960.296) (-980.490) [-953.480] (-967.434) * (-965.069) (-978.544) (-967.841) [-963.642] -- 0:01:56
728000 -- (-955.229) (-962.647) [-956.409] (-975.970) * [-955.268] (-969.831) (-983.422) (-964.018) -- 0:01:56
728500 -- [-940.679] (-977.340) (-949.202) (-999.446) * (-969.011) [-964.774] (-976.438) (-973.536) -- 0:01:56
729000 -- [-948.650] (-973.596) (-953.932) (-979.318) * (-959.021) [-952.067] (-965.756) (-956.178) -- 0:01:56
729500 -- [-956.394] (-967.975) (-962.533) (-980.717) * (-976.546) [-947.749] (-983.359) (-976.369) -- 0:01:56
730000 -- (-957.042) [-955.823] (-960.585) (-1016.355) * (-987.743) (-957.473) (-963.215) [-957.179] -- 0:01:55
Average standard deviation of split frequencies: 0.010827
730500 -- [-960.136] (-956.203) (-978.543) (-990.259) * (-969.339) [-965.995] (-979.124) (-978.367) -- 0:01:55
731000 -- (-973.066) [-956.584] (-962.723) (-993.239) * (-963.790) (-952.630) (-986.212) [-961.641] -- 0:01:55
731500 -- (-962.300) [-961.964] (-976.075) (-996.384) * (-975.839) [-963.152] (-977.529) (-976.068) -- 0:01:55
732000 -- [-958.438] (-972.924) (-967.540) (-992.107) * [-947.051] (-967.807) (-976.277) (-961.153) -- 0:01:54
732500 -- (-961.481) [-959.789] (-966.011) (-1004.056) * (-974.295) [-956.428] (-976.730) (-967.586) -- 0:01:54
733000 -- (-944.436) (-957.518) [-953.170] (-996.832) * (-981.014) [-972.198] (-983.588) (-959.440) -- 0:01:54
733500 -- (-953.784) (-964.381) [-945.076] (-993.626) * (-962.538) (-973.891) (-986.792) [-952.630] -- 0:01:54
734000 -- [-949.359] (-970.758) (-957.445) (-992.596) * (-970.369) (-972.117) (-972.786) [-950.968] -- 0:01:54
734500 -- [-955.390] (-977.556) (-953.611) (-991.766) * (-983.583) [-952.747] (-990.597) (-962.502) -- 0:01:53
735000 -- [-950.659] (-963.625) (-973.586) (-966.151) * (-977.837) (-969.855) (-992.527) [-948.671] -- 0:01:53
Average standard deviation of split frequencies: 0.010648
735500 -- (-973.155) [-942.588] (-968.478) (-967.285) * [-965.216] (-961.896) (-973.947) (-963.967) -- 0:01:53
736000 -- (-981.862) (-957.683) [-952.437] (-970.279) * (-972.029) [-951.411] (-966.905) (-972.800) -- 0:01:52
736500 -- (-977.325) (-960.640) [-949.380] (-974.486) * (-968.768) [-954.384] (-961.511) (-982.932) -- 0:01:53
737000 -- (-980.386) (-953.019) [-964.662] (-990.147) * (-971.982) [-953.623] (-964.628) (-966.913) -- 0:01:52
737500 -- (-971.711) (-961.154) [-950.891] (-990.812) * (-968.354) [-948.089] (-990.749) (-959.082) -- 0:01:52
738000 -- (-988.688) (-962.718) [-947.083] (-975.083) * (-976.009) (-948.354) (-996.537) [-946.718] -- 0:01:52
738500 -- (-971.244) (-976.150) [-944.527] (-991.355) * (-992.974) (-950.165) (-989.091) [-951.146] -- 0:01:51
739000 -- (-969.367) [-949.465] (-975.335) (-996.430) * [-966.935] (-962.855) (-986.440) (-962.040) -- 0:01:51
739500 -- (-970.295) (-963.239) [-968.885] (-984.595) * (-947.217) (-964.996) (-968.304) [-967.481] -- 0:01:51
740000 -- [-957.775] (-973.686) (-966.443) (-968.742) * (-950.119) (-971.736) (-965.441) [-962.787] -- 0:01:51
Average standard deviation of split frequencies: 0.010024
740500 -- (-958.889) [-960.148] (-979.219) (-984.019) * [-963.071] (-980.731) (-969.858) (-962.458) -- 0:01:51
741000 -- (-964.687) [-964.432] (-981.806) (-983.522) * [-953.502] (-972.418) (-975.956) (-969.761) -- 0:01:50
741500 -- (-958.749) [-956.560] (-983.370) (-979.702) * [-961.180] (-975.556) (-989.812) (-964.661) -- 0:01:50
742000 -- [-947.009] (-950.847) (-990.065) (-989.884) * (-992.260) (-970.767) (-993.020) [-962.504] -- 0:01:50
742500 -- [-948.062] (-966.877) (-979.904) (-953.758) * (-961.592) (-965.869) (-985.222) [-969.502] -- 0:01:50
743000 -- [-961.144] (-958.613) (-988.230) (-970.637) * [-957.837] (-964.539) (-963.945) (-974.802) -- 0:01:49
743500 -- (-970.096) [-956.081] (-985.130) (-972.319) * [-953.297] (-969.318) (-966.077) (-972.011) -- 0:01:49
744000 -- [-958.086] (-968.011) (-972.016) (-964.843) * (-963.990) [-969.101] (-979.319) (-971.384) -- 0:01:49
744500 -- (-962.384) (-960.891) [-971.117] (-986.293) * [-951.931] (-978.436) (-972.664) (-980.673) -- 0:01:49
745000 -- [-966.917] (-956.805) (-968.012) (-965.520) * (-981.109) (-975.242) [-963.732] (-960.577) -- 0:01:49
Average standard deviation of split frequencies: 0.009933
745500 -- (-971.960) (-973.402) (-971.435) [-957.557] * [-968.486] (-974.387) (-966.104) (-969.878) -- 0:01:48
746000 -- [-967.950] (-978.915) (-976.314) (-968.817) * [-971.150] (-980.844) (-989.969) (-981.488) -- 0:01:48
746500 -- (-967.205) (-968.064) (-978.743) [-964.840] * [-957.305] (-977.749) (-990.174) (-973.260) -- 0:01:48
747000 -- (-979.522) (-972.775) [-968.633] (-967.793) * (-956.726) (-987.334) (-992.623) [-958.456] -- 0:01:48
747500 -- [-946.556] (-977.174) (-988.008) (-973.221) * (-964.436) [-970.336] (-990.063) (-958.686) -- 0:01:48
748000 -- (-966.656) (-958.248) [-956.353] (-961.989) * [-952.182] (-977.511) (-981.534) (-954.921) -- 0:01:47
748500 -- (-965.535) (-979.615) [-952.089] (-972.307) * [-949.220] (-966.105) (-976.482) (-967.886) -- 0:01:47
749000 -- (-965.844) (-980.461) (-958.906) [-952.404] * (-962.023) (-977.268) (-971.254) [-948.031] -- 0:01:47
749500 -- (-961.211) (-966.413) [-964.353] (-954.007) * [-953.785] (-988.610) (-976.747) (-942.875) -- 0:01:47
750000 -- (-988.929) (-969.203) [-953.033] (-957.287) * [-946.773] (-976.034) (-972.570) (-965.573) -- 0:01:47
Average standard deviation of split frequencies: 0.010048
750500 -- (-973.999) (-978.135) [-945.276] (-973.447) * (-949.500) (-971.647) (-975.344) [-962.255] -- 0:01:46
751000 -- (-970.922) (-1001.400) [-958.985] (-966.923) * (-950.141) (-978.443) (-977.756) [-956.089] -- 0:01:46
751500 -- (-977.606) (-953.137) [-954.060] (-962.176) * [-945.911] (-977.662) (-961.904) (-977.414) -- 0:01:46
752000 -- (-956.178) (-962.766) [-950.308] (-957.489) * [-961.078] (-951.957) (-969.955) (-993.666) -- 0:01:45
752500 -- (-983.747) (-959.354) (-968.288) [-946.670] * [-951.297] (-965.151) (-975.754) (-984.787) -- 0:01:45
753000 -- (-983.865) (-964.196) [-957.095] (-964.568) * (-975.049) [-951.879] (-980.324) (-967.985) -- 0:01:45
753500 -- (-967.004) (-961.675) [-957.281] (-960.843) * (-968.355) (-964.696) [-982.816] (-960.062) -- 0:01:45
754000 -- (-973.751) [-956.602] (-986.220) (-957.336) * (-967.327) (-961.125) (-987.377) [-954.709] -- 0:01:45
754500 -- (-969.127) [-952.201] (-999.939) (-968.823) * (-962.684) [-959.685] (-996.705) (-972.436) -- 0:01:45
755000 -- (-959.249) (-954.721) (-980.277) [-955.211] * [-947.439] (-961.351) (-987.452) (-964.398) -- 0:01:44
Average standard deviation of split frequencies: 0.009957
755500 -- [-956.479] (-965.910) (-975.880) (-955.958) * [-954.795] (-951.021) (-997.876) (-947.856) -- 0:01:44
756000 -- [-944.679] (-974.701) (-980.040) (-976.335) * [-960.088] (-961.574) (-999.770) (-956.651) -- 0:01:44
756500 -- (-969.486) [-956.930] (-985.895) (-967.950) * (-951.309) (-957.857) (-991.403) [-963.782] -- 0:01:44
757000 -- (-981.774) (-975.652) (-982.675) [-953.590] * (-955.077) (-973.584) (-991.211) [-965.096] -- 0:01:44
757500 -- (-972.490) (-983.264) (-970.462) [-959.446] * (-960.466) (-959.141) (-982.671) [-944.455] -- 0:01:43
758000 -- (-985.171) (-975.771) (-967.926) [-968.398] * (-976.667) (-972.437) (-964.466) [-957.036] -- 0:01:43
758500 -- (-964.914) (-973.093) [-955.505] (-977.033) * (-995.149) (-950.991) (-987.079) [-952.199] -- 0:01:43
759000 -- (-974.867) [-966.311] (-977.262) (-963.974) * (-962.024) [-953.999] (-991.888) (-962.955) -- 0:01:42
759500 -- (-962.592) [-964.068] (-994.036) (-966.008) * (-969.158) (-979.110) (-975.092) [-960.117] -- 0:01:42
760000 -- (-971.780) (-967.850) (-995.067) [-961.187] * [-954.812] (-968.070) (-992.308) (-958.893) -- 0:01:42
Average standard deviation of split frequencies: 0.009896
760500 -- (-962.570) (-968.640) (-980.369) [-957.703] * (-967.265) (-976.352) (-985.265) [-953.967] -- 0:01:42
761000 -- (-980.344) (-973.995) (-970.929) [-966.416] * [-954.143] (-968.601) (-981.950) (-953.764) -- 0:01:42
761500 -- (-972.296) (-959.818) (-961.358) [-950.878] * (-986.401) (-962.909) [-955.009] (-963.622) -- 0:01:41
762000 -- (-976.949) (-957.535) (-962.456) [-954.207] * [-976.011] (-956.749) (-973.420) (-996.371) -- 0:01:41
762500 -- (-975.035) (-984.920) [-958.269] (-972.203) * (-960.598) (-967.143) [-965.442] (-972.167) -- 0:01:41
763000 -- (-959.428) (-966.206) (-987.984) [-951.600] * [-951.407] (-970.069) (-969.608) (-979.565) -- 0:01:41
763500 -- (-988.388) (-991.144) [-967.923] (-957.678) * [-943.159] (-975.472) (-978.098) (-973.066) -- 0:01:40
764000 -- (-1005.122) (-975.975) (-958.502) [-952.315] * [-948.794] (-983.493) (-974.259) (-970.566) -- 0:01:41
764500 -- (-991.208) (-972.379) (-960.170) [-956.755] * [-955.612] (-981.342) (-963.781) (-969.446) -- 0:01:40
765000 -- (-965.602) [-952.846] (-975.428) (-961.543) * (-956.725) (-984.645) [-948.304] (-968.158) -- 0:01:40
Average standard deviation of split frequencies: 0.009577
765500 -- (-959.456) (-963.884) (-989.553) [-957.974] * [-954.810] (-970.066) (-951.992) (-973.368) -- 0:01:40
766000 -- [-948.849] (-994.436) (-961.394) (-984.844) * (-960.564) (-992.549) [-947.629] (-984.061) -- 0:01:39
766500 -- [-955.483] (-990.479) (-953.759) (-964.730) * (-960.870) (-981.318) [-941.801] (-972.247) -- 0:01:39
767000 -- (-949.009) (-993.786) (-984.109) [-952.497] * [-940.860] (-962.833) (-973.818) (-957.303) -- 0:01:39
767500 -- [-953.538] (-974.426) (-964.386) (-970.104) * (-973.102) [-957.007] (-949.000) (-985.785) -- 0:01:39
768000 -- [-950.660] (-980.931) (-956.316) (-967.451) * (-970.823) [-954.977] (-956.328) (-998.869) -- 0:01:39
768500 -- [-946.115] (-977.819) (-978.234) (-962.000) * (-976.427) (-944.162) [-958.358] (-981.930) -- 0:01:38
769000 -- [-956.032] (-983.996) (-967.199) (-955.520) * [-961.904] (-971.885) (-965.076) (-975.988) -- 0:01:38
769500 -- [-958.006] (-967.481) (-977.836) (-951.484) * (-964.725) (-970.010) [-955.070] (-970.546) -- 0:01:38
770000 -- (-982.850) (-979.210) (-983.448) [-953.782] * (-974.160) (-963.591) [-954.628] (-987.348) -- 0:01:38
Average standard deviation of split frequencies: 0.008927
770500 -- (-971.524) (-977.314) (-995.066) [-960.005] * (-979.016) (-971.725) [-956.258] (-988.319) -- 0:01:37
771000 -- (-965.269) (-997.918) (-971.858) [-959.834] * (-965.828) (-971.739) [-956.681] (-977.779) -- 0:01:37
771500 -- [-951.235] (-957.461) (-978.147) (-968.336) * [-958.192] (-977.599) (-968.122) (-985.755) -- 0:01:37
772000 -- [-942.819] (-974.150) (-962.398) (-960.529) * (-963.142) (-968.052) [-965.248] (-972.972) -- 0:01:37
772500 -- [-964.167] (-976.858) (-948.770) (-953.509) * (-972.783) (-974.390) [-947.085] (-962.811) -- 0:01:37
773000 -- (-952.072) (-973.482) (-946.610) [-958.997] * (-985.114) (-977.668) [-950.188] (-987.921) -- 0:01:36
773500 -- (-962.079) (-969.231) [-967.155] (-991.313) * (-962.773) [-963.526] (-968.029) (-996.709) -- 0:01:36
774000 -- (-971.696) (-955.210) [-965.981] (-983.555) * (-961.333) (-985.081) [-965.060] (-972.524) -- 0:01:36
774500 -- [-955.832] (-952.989) (-971.389) (-963.883) * (-969.336) (-982.415) [-955.811] (-976.361) -- 0:01:36
775000 -- (-973.952) (-975.310) [-960.003] (-977.815) * (-974.158) (-968.861) [-963.731] (-976.425) -- 0:01:36
Average standard deviation of split frequencies: 0.008995
775500 -- (-976.099) (-988.254) [-956.447] (-977.802) * (-972.066) (-971.398) [-949.342] (-976.524) -- 0:01:35
776000 -- [-963.376] (-973.404) (-956.872) (-982.043) * (-972.241) (-978.321) [-954.130] (-970.360) -- 0:01:35
776500 -- (-977.886) (-973.794) (-961.663) [-951.199] * (-968.679) [-959.708] (-964.941) (-975.315) -- 0:01:35
777000 -- (-968.488) (-990.642) (-964.630) [-952.476] * [-954.624] (-975.660) (-972.142) (-977.278) -- 0:01:35
777500 -- [-955.871] (-975.546) (-962.403) (-967.884) * (-990.797) [-958.443] (-973.625) (-981.177) -- 0:01:35
778000 -- [-956.816] (-978.489) (-956.607) (-988.007) * (-962.900) [-952.628] (-963.055) (-973.139) -- 0:01:34
778500 -- (-973.468) (-963.412) [-959.840] (-971.779) * (-982.578) [-956.469] (-1003.694) (-976.488) -- 0:01:34
779000 -- (-980.962) [-965.073] (-976.115) (-972.206) * (-984.521) [-948.400] (-972.637) (-960.381) -- 0:01:34
779500 -- (-958.572) (-989.922) [-970.987] (-972.071) * (-980.693) [-952.386] (-973.119) (-956.556) -- 0:01:34
780000 -- (-957.872) (-970.267) [-953.137] (-979.989) * (-998.825) (-952.879) (-972.565) [-961.676] -- 0:01:33
Average standard deviation of split frequencies: 0.008727
780500 -- (-970.405) (-961.362) [-950.386] (-987.262) * (-983.109) (-968.433) [-958.597] (-944.250) -- 0:01:33
781000 -- (-959.402) (-961.908) (-961.070) [-964.365] * (-970.710) (-979.453) (-954.479) [-943.721] -- 0:01:33
781500 -- [-956.936] (-971.594) (-955.956) (-975.383) * (-985.779) [-967.158] (-984.132) (-962.586) -- 0:01:33
782000 -- (-962.184) (-1001.774) [-955.280] (-973.300) * (-1000.879) [-951.281] (-969.645) (-962.133) -- 0:01:33
782500 -- [-951.216] (-972.955) (-966.006) (-1006.833) * (-994.789) [-949.486] (-964.089) (-980.699) -- 0:01:32
783000 -- [-965.152] (-963.217) (-972.574) (-982.769) * (-965.788) [-967.591] (-989.168) (-991.923) -- 0:01:32
783500 -- (-948.299) [-967.109] (-993.653) (-977.517) * (-970.053) [-955.588] (-979.829) (-974.912) -- 0:01:32
784000 -- [-960.269] (-973.649) (-993.583) (-976.320) * [-957.590] (-960.573) (-957.124) (-974.919) -- 0:01:32
784500 -- [-964.852] (-961.302) (-978.394) (-996.940) * (-982.464) (-972.576) [-976.602] (-972.826) -- 0:01:32
785000 -- (-990.281) [-953.915] (-979.582) (-999.640) * (-959.433) (-970.319) [-956.341] (-976.978) -- 0:01:31
Average standard deviation of split frequencies: 0.008669
785500 -- (-975.448) [-960.010] (-963.743) (-999.658) * (-960.706) (-966.617) [-952.246] (-977.032) -- 0:01:31
786000 -- (-985.086) [-955.025] (-965.141) (-992.102) * [-958.829] (-962.732) (-959.837) (-976.859) -- 0:01:31
786500 -- (-968.293) [-944.644] (-995.645) (-993.989) * (-977.982) [-957.513] (-958.705) (-998.057) -- 0:01:30
787000 -- [-961.273] (-948.680) (-984.699) (-984.160) * [-957.341] (-959.263) (-969.286) (-984.874) -- 0:01:30
787500 -- [-948.173] (-957.377) (-961.296) (-985.770) * (-973.916) (-981.098) (-982.589) [-972.595] -- 0:01:30
788000 -- (-970.595) [-945.408] (-955.959) (-999.971) * (-992.211) (-970.677) [-974.775] (-969.012) -- 0:01:30
788500 -- [-966.141] (-957.071) (-980.509) (-995.567) * (-978.294) [-957.253] (-983.422) (-969.010) -- 0:01:30
789000 -- [-967.196] (-959.978) (-975.139) (-973.106) * (-973.988) (-960.089) (-970.929) [-951.096] -- 0:01:29
789500 -- (-968.818) [-961.662] (-963.838) (-963.635) * (-984.435) (-963.376) (-963.101) [-961.239] -- 0:01:29
790000 -- [-960.276] (-954.304) (-977.512) (-949.947) * (-983.765) [-966.467] (-985.477) (-959.514) -- 0:01:29
Average standard deviation of split frequencies: 0.008889
790500 -- (-968.417) [-959.301] (-967.653) (-974.932) * (-980.407) (-960.148) (-968.276) [-963.790] -- 0:01:29
791000 -- (-972.949) (-968.030) (-990.623) [-963.830] * (-973.528) [-958.450] (-967.012) (-956.589) -- 0:01:29
791500 -- (-962.071) [-950.976] (-979.567) (-994.241) * (-967.847) (-979.290) (-967.938) [-942.439] -- 0:01:28
792000 -- (-968.253) [-944.054] (-993.214) (-954.449) * (-981.046) (-953.946) (-977.833) [-960.666] -- 0:01:28
792500 -- (-983.116) [-963.044] (-975.097) (-960.810) * (-971.628) (-977.830) [-963.614] (-947.206) -- 0:01:28
793000 -- [-951.390] (-1006.364) (-972.359) (-963.431) * [-949.397] (-978.817) (-962.616) (-960.948) -- 0:01:28
793500 -- (-956.758) (-999.560) (-966.505) [-957.391] * [-955.355] (-966.514) (-979.564) (-959.633) -- 0:01:27
794000 -- (-957.273) (-973.138) (-977.934) [-965.043] * (-975.238) (-970.741) (-987.016) [-951.012] -- 0:01:27
794500 -- [-950.662] (-966.145) (-970.838) (-976.140) * (-988.295) (-976.708) (-980.321) [-948.991] -- 0:01:27
795000 -- (-952.198) (-990.275) (-986.253) [-979.851] * (-976.313) (-967.048) (-982.412) [-958.606] -- 0:01:27
Average standard deviation of split frequencies: 0.008828
795500 -- (-953.051) [-966.076] (-973.525) (-991.455) * (-985.374) (-970.551) (-955.037) [-961.529] -- 0:01:27
796000 -- (-967.190) (-977.480) [-967.504] (-958.465) * (-974.572) (-961.377) (-977.032) [-963.765] -- 0:01:26
796500 -- (-962.548) [-963.095] (-978.091) (-951.854) * (-969.977) [-956.424] (-996.255) (-971.224) -- 0:01:26
797000 -- (-968.930) (-962.008) (-991.319) [-965.296] * (-964.772) (-959.455) (-992.111) [-967.143] -- 0:01:26
797500 -- (-976.127) [-962.361] (-1000.958) (-959.698) * (-969.742) [-964.713] (-981.549) (-966.916) -- 0:01:26
798000 -- (-957.429) (-962.599) (-982.844) [-952.613] * (-997.450) (-964.151) [-961.948] (-975.622) -- 0:01:26
798500 -- [-959.304] (-999.021) (-966.392) (-962.238) * (-989.746) [-953.697] (-980.672) (-981.916) -- 0:01:25
799000 -- (-973.313) [-953.290] (-960.078) (-979.397) * (-982.593) [-961.687] (-967.626) (-970.200) -- 0:01:25
799500 -- [-956.651] (-961.113) (-978.259) (-974.153) * [-956.198] (-963.602) (-988.619) (-968.749) -- 0:01:25
800000 -- [-948.627] (-987.656) (-985.840) (-978.186) * [-952.048] (-973.584) (-973.255) (-958.770) -- 0:01:25
Average standard deviation of split frequencies: 0.008758
800500 -- [-951.484] (-989.627) (-976.354) (-971.868) * [-964.438] (-972.200) (-996.271) (-973.403) -- 0:01:24
801000 -- (-976.985) [-971.905] (-969.588) (-968.406) * [-955.238] (-970.577) (-975.894) (-974.133) -- 0:01:24
801500 -- (-961.280) [-960.039] (-979.893) (-960.719) * [-957.180] (-970.403) (-972.723) (-963.466) -- 0:01:24
802000 -- [-959.679] (-964.445) (-972.398) (-987.165) * [-951.476] (-972.543) (-979.095) (-964.335) -- 0:01:24
802500 -- (-972.477) [-954.911] (-967.934) (-992.940) * [-948.644] (-973.946) (-968.697) (-964.930) -- 0:01:24
803000 -- (-968.843) (-996.808) [-967.363] (-959.935) * (-975.334) (-994.825) (-972.427) [-954.786] -- 0:01:23
803500 -- (-977.710) [-965.186] (-966.199) (-975.277) * [-965.334] (-979.316) (-969.865) (-962.830) -- 0:01:23
804000 -- (-977.488) [-969.869] (-977.132) (-972.818) * (-957.575) (-961.746) (-985.223) [-968.526] -- 0:01:23
804500 -- (-985.043) (-959.495) (-971.686) [-968.797] * [-959.649] (-961.661) (-965.602) (-974.744) -- 0:01:23
805000 -- (-975.655) [-955.309] (-975.704) (-961.540) * [-959.121] (-956.027) (-965.372) (-977.610) -- 0:01:23
Average standard deviation of split frequencies: 0.008590
805500 -- (-977.746) (-956.314) (-981.397) [-958.112] * (-971.316) [-962.372] (-972.088) (-985.769) -- 0:01:22
806000 -- (-958.770) (-980.692) (-989.499) [-964.036] * (-971.665) (-963.349) (-983.003) [-964.614] -- 0:01:22
806500 -- (-957.452) [-964.675] (-993.678) (-961.006) * [-950.218] (-964.910) (-984.765) (-981.655) -- 0:01:22
807000 -- (-969.928) (-979.728) (-980.658) [-956.415] * [-947.363] (-949.506) (-973.801) (-976.210) -- 0:01:22
807500 -- (-984.430) [-957.162] (-988.261) (-964.175) * (-978.281) (-972.241) (-971.828) [-959.174] -- 0:01:22
808000 -- (-989.805) [-944.899] (-973.553) (-976.628) * [-956.532] (-958.659) (-977.289) (-967.464) -- 0:01:21
808500 -- (-984.236) (-958.501) (-979.579) [-962.761] * (-962.163) (-975.071) (-974.155) [-971.239] -- 0:01:21
809000 -- [-964.944] (-964.562) (-995.043) (-975.671) * (-958.477) (-980.917) (-966.378) [-953.288] -- 0:01:21
809500 -- [-968.690] (-964.737) (-981.949) (-959.470) * [-963.864] (-981.586) (-970.765) (-971.654) -- 0:01:20
810000 -- [-945.504] (-955.379) (-971.507) (-973.342) * (-966.244) [-960.760] (-965.298) (-980.435) -- 0:01:20
Average standard deviation of split frequencies: 0.008486
810500 -- (-949.643) (-993.439) [-963.578] (-1008.051) * (-958.490) (-966.649) (-988.244) [-970.716] -- 0:01:20
811000 -- [-950.391] (-966.015) (-979.732) (-988.962) * [-942.362] (-949.865) (-984.439) (-964.680) -- 0:01:20
811500 -- [-960.830] (-982.809) (-986.763) (-971.327) * [-948.009] (-962.377) (-979.662) (-988.288) -- 0:01:20
812000 -- [-961.917] (-972.449) (-975.141) (-963.240) * (-968.932) [-956.526] (-990.305) (-980.946) -- 0:01:19
812500 -- [-951.877] (-959.634) (-972.450) (-977.685) * (-979.428) (-966.831) (-983.217) [-963.463] -- 0:01:19
813000 -- [-961.811] (-966.084) (-983.507) (-964.692) * (-963.272) [-968.083] (-987.670) (-971.389) -- 0:01:19
813500 -- (-979.849) (-968.218) (-999.982) [-954.542] * [-950.920] (-976.543) (-985.750) (-975.726) -- 0:01:19
814000 -- [-952.771] (-964.682) (-986.012) (-970.350) * (-963.084) [-957.768] (-985.247) (-989.362) -- 0:01:19
814500 -- [-966.562] (-979.068) (-984.628) (-986.029) * [-961.154] (-967.779) (-984.370) (-979.145) -- 0:01:18
815000 -- [-949.102] (-976.158) (-977.316) (-974.206) * (-954.919) [-952.004] (-972.580) (-971.662) -- 0:01:18
Average standard deviation of split frequencies: 0.008088
815500 -- [-953.857] (-975.103) (-972.558) (-977.243) * (-966.780) [-955.535] (-962.706) (-982.678) -- 0:01:18
816000 -- [-962.295] (-976.202) (-999.843) (-981.625) * (-943.911) [-962.614] (-976.772) (-982.518) -- 0:01:18
816500 -- (-961.719) (-981.065) (-972.947) [-963.945] * [-960.729] (-968.887) (-983.891) (-958.027) -- 0:01:17
817000 -- (-985.766) [-962.007] (-974.468) (-956.800) * (-968.475) [-945.191] (-962.126) (-962.057) -- 0:01:17
817500 -- (-978.250) (-983.151) [-969.167] (-957.781) * [-952.991] (-979.211) (-961.460) (-974.136) -- 0:01:17
818000 -- (-966.318) (-973.615) [-961.072] (-964.218) * (-989.107) (-967.971) [-981.291] (-975.948) -- 0:01:17
818500 -- (-964.934) [-968.045] (-977.578) (-963.610) * (-966.598) [-962.463] (-975.537) (-990.377) -- 0:01:17
819000 -- (-976.776) (-1001.203) [-950.674] (-953.065) * [-966.892] (-964.197) (-970.227) (-1003.543) -- 0:01:16
819500 -- (-976.611) (-970.626) [-964.393] (-970.345) * (-973.382) [-965.380] (-963.313) (-992.112) -- 0:01:16
820000 -- (-997.088) [-953.675] (-967.089) (-962.659) * (-963.238) [-952.355] (-967.002) (-990.253) -- 0:01:16
Average standard deviation of split frequencies: 0.008150
820500 -- (-985.572) (-955.964) (-973.294) [-958.099] * (-962.211) [-945.532] (-978.518) (-987.679) -- 0:01:16
821000 -- (-972.623) [-953.364] (-967.824) (-969.823) * [-960.652] (-976.134) (-996.787) (-1006.941) -- 0:01:16
821500 -- (-967.310) (-954.236) [-970.465] (-993.496) * [-951.344] (-964.842) (-982.072) (-988.669) -- 0:01:15
822000 -- (-957.481) (-979.627) [-956.352] (-983.342) * (-975.064) (-968.854) (-981.922) [-967.214] -- 0:01:15
822500 -- (-954.868) [-975.920] (-959.962) (-972.357) * (-971.731) [-955.957] (-1003.326) (-962.301) -- 0:01:15
823000 -- (-960.508) [-963.917] (-960.518) (-969.195) * [-956.716] (-970.470) (-988.951) (-961.413) -- 0:01:15
823500 -- (-970.429) [-965.774] (-968.503) (-974.621) * [-962.373] (-973.069) (-992.241) (-962.955) -- 0:01:15
824000 -- (-964.590) (-973.189) [-960.919] (-979.171) * (-962.373) (-968.018) (-975.037) [-956.452] -- 0:01:14
824500 -- [-951.639] (-970.042) (-961.889) (-980.553) * [-961.013] (-986.616) (-988.978) (-963.421) -- 0:01:14
825000 -- (-957.981) (-963.237) [-969.710] (-989.924) * [-947.408] (-978.631) (-984.803) (-965.748) -- 0:01:14
Average standard deviation of split frequencies: 0.008525
825500 -- (-976.392) [-955.267] (-958.085) (-955.405) * (-958.680) (-971.593) (-980.536) [-962.414] -- 0:01:14
826000 -- (-958.083) (-968.683) [-950.960] (-980.609) * (-965.434) (-989.000) (-959.889) [-951.817] -- 0:01:13
826500 -- (-969.714) [-952.788] (-972.450) (-991.105) * (-979.848) (-979.824) (-960.140) [-962.045] -- 0:01:13
827000 -- (-977.271) (-976.408) (-970.689) [-962.361] * (-978.962) (-956.111) [-958.275] (-977.346) -- 0:01:13
827500 -- (-962.307) [-950.063] (-990.153) (-958.875) * (-995.313) [-963.993] (-961.934) (-962.287) -- 0:01:13
828000 -- (-973.566) (-965.326) (-972.441) [-967.547] * [-975.156] (-966.840) (-975.383) (-971.534) -- 0:01:13
828500 -- [-954.207] (-955.930) (-987.751) (-977.566) * (-980.321) (-972.036) [-947.909] (-984.063) -- 0:01:12
829000 -- (-954.879) [-965.188] (-975.221) (-972.641) * (-954.630) (-982.790) [-948.454] (-984.066) -- 0:01:12
829500 -- [-959.966] (-953.534) (-984.971) (-980.756) * [-962.689] (-983.271) (-963.025) (-985.316) -- 0:01:12
830000 -- (-978.365) (-980.208) [-947.336] (-958.754) * [-946.274] (-975.883) (-970.983) (-989.138) -- 0:01:12
Average standard deviation of split frequencies: 0.008513
830500 -- (-954.868) (-969.394) [-952.365] (-965.343) * [-951.953] (-964.922) (-975.319) (-980.488) -- 0:01:12
831000 -- (-991.990) (-970.344) [-973.551] (-974.801) * (-961.767) (-983.674) [-946.397] (-1007.451) -- 0:01:11
831500 -- (-975.512) (-967.326) [-945.756] (-967.299) * [-956.588] (-983.513) (-957.173) (-990.336) -- 0:01:11
832000 -- (-979.201) (-975.074) [-959.901] (-972.348) * (-969.697) (-966.341) [-948.588] (-985.951) -- 0:01:11
832500 -- (-964.939) [-966.990] (-966.647) (-974.354) * (-983.454) [-955.641] (-970.078) (-989.573) -- 0:01:11
833000 -- [-954.405] (-957.726) (-985.227) (-971.977) * (-952.386) (-964.570) [-959.508] (-981.040) -- 0:01:10
833500 -- [-951.591] (-979.291) (-964.456) (-956.836) * (-954.313) (-969.425) [-957.546] (-977.409) -- 0:01:10
834000 -- (-977.227) (-977.698) (-965.703) [-959.281] * [-958.674] (-968.092) (-945.719) (-992.214) -- 0:01:10
834500 -- [-960.668] (-972.781) (-980.438) (-986.569) * [-949.991] (-950.048) (-961.103) (-984.080) -- 0:01:10
835000 -- [-955.215] (-976.816) (-953.982) (-963.556) * [-960.822] (-959.127) (-982.497) (-985.412) -- 0:01:10
Average standard deviation of split frequencies: 0.008300
835500 -- (-964.881) (-970.380) (-974.851) [-945.730] * [-962.849] (-958.139) (-981.721) (-987.275) -- 0:01:09
836000 -- (-966.400) (-963.807) (-984.358) [-952.852] * [-951.475] (-956.261) (-964.085) (-1007.758) -- 0:01:09
836500 -- [-962.167] (-978.470) (-962.082) (-953.643) * [-956.920] (-1005.817) (-955.935) (-1000.754) -- 0:01:09
837000 -- (-958.098) (-994.169) (-956.694) [-957.248] * [-945.618] (-965.375) (-959.181) (-984.344) -- 0:01:09
837500 -- (-961.065) (-988.498) (-961.543) [-963.301] * [-954.714] (-968.282) (-977.461) (-978.398) -- 0:01:09
838000 -- [-944.178] (-979.811) (-982.667) (-968.941) * [-956.149] (-971.698) (-967.466) (-991.697) -- 0:01:08
838500 -- [-935.494] (-969.350) (-958.520) (-972.292) * (-967.113) (-966.651) [-953.840] (-988.546) -- 0:01:08
839000 -- (-963.094) [-970.378] (-981.397) (-970.347) * (-982.716) (-973.240) [-951.904] (-972.442) -- 0:01:08
839500 -- (-961.401) (-985.319) (-961.932) [-966.605] * (-969.652) [-952.230] (-966.898) (-980.714) -- 0:01:08
840000 -- (-954.581) (-978.587) [-965.861] (-981.735) * (-951.047) [-969.237] (-970.884) (-993.822) -- 0:01:08
Average standard deviation of split frequencies: 0.008148
840500 -- [-971.627] (-979.654) (-977.639) (-973.877) * [-951.646] (-964.306) (-969.708) (-974.543) -- 0:01:07
841000 -- (-975.254) (-981.007) (-956.862) [-957.112] * [-936.628] (-966.851) (-967.263) (-990.404) -- 0:01:07
841500 -- (-990.644) [-955.483] (-979.175) (-966.904) * (-962.288) (-972.992) [-969.710] (-989.356) -- 0:01:07
842000 -- (-989.613) (-957.466) [-958.852] (-964.228) * (-964.470) (-975.372) [-949.318] (-974.221) -- 0:01:07
842500 -- (-974.640) [-950.159] (-965.848) (-982.816) * [-960.203] (-976.766) (-961.070) (-979.599) -- 0:01:07
843000 -- (-979.516) [-957.214] (-974.881) (-960.377) * [-965.434] (-977.125) (-972.665) (-987.712) -- 0:01:06
843500 -- (-976.839) (-949.810) (-981.080) [-974.344] * (-947.314) (-976.894) [-960.372] (-997.612) -- 0:01:06
844000 -- [-952.885] (-961.993) (-968.760) (-983.119) * (-958.031) (-958.828) [-971.912] (-1004.678) -- 0:01:06
844500 -- (-981.359) [-952.403] (-962.756) (-988.846) * (-947.479) [-953.366] (-978.316) (-985.087) -- 0:01:06
845000 -- [-963.919] (-970.024) (-963.755) (-986.886) * [-963.211] (-963.259) (-980.206) (-985.753) -- 0:01:06
Average standard deviation of split frequencies: 0.008027
845500 -- (-962.869) [-959.055] (-984.094) (-990.072) * [-964.673] (-961.666) (-972.773) (-993.416) -- 0:01:05
846000 -- [-951.314] (-965.843) (-959.040) (-997.317) * [-959.963] (-968.553) (-979.172) (-990.902) -- 0:01:05
846500 -- (-959.048) [-962.718] (-980.001) (-985.213) * [-949.375] (-961.394) (-984.092) (-982.199) -- 0:01:05
847000 -- (-1007.227) (-963.722) [-960.901] (-962.128) * (-950.971) (-982.667) [-975.024] (-977.676) -- 0:01:05
847500 -- (-978.258) (-969.372) (-964.698) [-960.729] * [-946.227] (-988.059) (-990.099) (-995.503) -- 0:01:04
848000 -- [-962.222] (-964.578) (-1009.856) (-969.056) * (-950.405) [-957.603] (-963.663) (-979.513) -- 0:01:04
848500 -- (-973.297) (-998.468) [-956.449] (-964.732) * (-953.635) (-959.242) (-983.858) [-977.005] -- 0:01:04
849000 -- (-964.465) [-964.507] (-974.678) (-975.864) * (-963.043) [-950.800] (-984.059) (-985.939) -- 0:01:04
849500 -- [-966.993] (-997.338) (-963.911) (-986.789) * (-989.591) [-946.744] (-986.706) (-995.069) -- 0:01:04
850000 -- (-965.794) (-965.413) [-957.062] (-988.653) * (-951.641) [-953.724] (-971.956) (-992.993) -- 0:01:03
Average standard deviation of split frequencies: 0.007758
850500 -- (-984.151) (-968.386) [-952.274] (-993.507) * (-962.217) [-950.560] (-988.478) (-970.692) -- 0:01:03
851000 -- (-957.101) [-960.328] (-962.252) (-985.977) * (-960.667) [-955.910] (-981.032) (-992.416) -- 0:01:03
851500 -- [-942.863] (-983.549) (-976.904) (-978.415) * (-957.695) [-956.279] (-973.009) (-976.240) -- 0:01:03
852000 -- (-973.204) (-971.278) [-953.711] (-990.933) * (-962.344) (-965.967) [-963.064] (-988.183) -- 0:01:03
852500 -- (-972.479) (-957.675) [-945.366] (-987.523) * (-950.992) [-947.275] (-978.372) (-984.015) -- 0:01:02
853000 -- [-969.826] (-970.093) (-968.319) (-980.439) * [-953.877] (-964.321) (-987.505) (-990.072) -- 0:01:02
853500 -- (-969.740) [-959.859] (-978.276) (-969.297) * [-949.905] (-962.246) (-984.515) (-974.283) -- 0:01:02
854000 -- (-969.131) (-979.694) (-965.347) [-949.891] * [-951.413] (-954.483) (-982.809) (-969.902) -- 0:01:02
854500 -- [-963.418] (-973.536) (-959.337) (-969.311) * (-960.576) [-962.846] (-968.004) (-981.937) -- 0:01:01
855000 -- (-975.894) [-959.309] (-957.033) (-967.391) * (-965.187) [-945.067] (-968.465) (-973.969) -- 0:01:01
Average standard deviation of split frequencies: 0.007550
855500 -- (-970.047) [-934.912] (-970.189) (-980.420) * (-972.882) [-956.758] (-969.820) (-977.246) -- 0:01:01
856000 -- (-986.785) (-964.565) (-959.005) [-973.177] * [-960.972] (-956.468) (-975.239) (-978.698) -- 0:01:01
856500 -- (-989.790) [-964.143] (-975.831) (-971.607) * (-979.716) (-966.718) [-966.549] (-1000.016) -- 0:01:01
857000 -- (-976.773) (-974.863) [-960.730] (-961.723) * (-967.209) (-972.082) [-971.382] (-989.414) -- 0:01:00
857500 -- (-979.207) (-971.257) [-966.225] (-967.750) * [-965.027] (-970.694) (-973.142) (-978.900) -- 0:01:00
858000 -- (-977.497) [-956.900] (-986.562) (-979.378) * [-954.356] (-974.659) (-975.637) (-991.755) -- 0:01:00
858500 -- (-971.209) [-957.591] (-988.012) (-976.367) * [-973.730] (-978.811) (-967.933) (-983.796) -- 0:01:00
859000 -- (-986.757) [-961.749] (-963.642) (-978.879) * (-965.331) [-961.307] (-962.520) (-980.852) -- 0:01:00
859500 -- (-984.849) [-968.114] (-971.663) (-969.087) * [-961.141] (-959.063) (-980.565) (-972.821) -- 0:00:59
860000 -- (-977.836) (-973.616) (-990.788) [-954.663] * [-957.664] (-950.759) (-967.874) (-986.926) -- 0:00:59
Average standard deviation of split frequencies: 0.007103
860500 -- (-973.455) (-965.621) (-1007.386) [-950.448] * (-972.093) [-946.752] (-960.010) (-996.063) -- 0:00:59
861000 -- (-959.768) [-964.590] (-998.459) (-961.837) * (-983.359) [-963.808] (-957.946) (-988.404) -- 0:00:59
861500 -- (-959.061) (-949.644) (-990.247) [-957.445] * (-959.108) (-962.984) [-947.105] (-973.390) -- 0:00:59
862000 -- (-967.639) (-963.399) (-996.604) [-943.866] * (-977.435) [-964.369] (-960.852) (-971.091) -- 0:00:58
862500 -- (-977.427) (-964.418) (-995.468) [-952.121] * (-967.332) (-966.163) (-954.192) [-952.419] -- 0:00:58
863000 -- (-969.608) (-967.640) (-997.659) [-958.803] * (-983.055) (-976.263) (-982.572) [-957.441] -- 0:00:58
863500 -- [-968.569] (-966.389) (-972.781) (-978.950) * (-972.573) (-962.514) [-952.726] (-964.317) -- 0:00:58
864000 -- (-959.658) [-957.964] (-987.928) (-958.999) * (-956.801) [-954.481] (-953.777) (-985.047) -- 0:00:57
864500 -- (-971.128) [-957.554] (-987.265) (-954.496) * (-963.726) [-963.419] (-967.539) (-976.981) -- 0:00:57
865000 -- [-956.028] (-969.124) (-988.171) (-981.499) * [-956.418] (-971.219) (-965.306) (-960.772) -- 0:00:57
Average standard deviation of split frequencies: 0.007332
865500 -- (-966.966) [-963.733] (-982.659) (-960.711) * [-948.694] (-967.692) (-966.955) (-973.119) -- 0:00:57
866000 -- (-978.259) (-961.538) (-984.253) [-954.751] * (-962.251) [-965.574] (-963.088) (-970.608) -- 0:00:56
866500 -- (-966.779) [-964.575] (-972.242) (-957.748) * (-960.491) [-960.037] (-955.704) (-991.874) -- 0:00:56
867000 -- (-966.653) [-960.690] (-979.080) (-963.864) * (-971.544) (-975.392) [-953.328] (-964.742) -- 0:00:56
867500 -- (-973.355) [-964.321] (-984.761) (-976.034) * (-978.929) (-977.813) [-952.365] (-989.198) -- 0:00:56
868000 -- (-995.106) [-948.675] (-964.004) (-965.725) * [-958.602] (-985.801) (-962.524) (-964.224) -- 0:00:56
868500 -- (-978.370) (-970.652) (-981.510) [-957.619] * [-947.056] (-962.777) (-977.281) (-978.251) -- 0:00:56
869000 -- (-1006.558) [-955.232] (-980.453) (-963.492) * (-957.337) [-945.436] (-983.034) (-980.757) -- 0:00:55
869500 -- (-987.822) [-957.331] (-972.398) (-960.607) * (-975.674) (-979.161) [-959.750] (-967.794) -- 0:00:55
870000 -- (-1000.362) (-968.126) (-990.985) [-968.989] * (-965.623) (-964.149) [-954.770] (-973.113) -- 0:00:55
Average standard deviation of split frequencies: 0.006899
870500 -- (-999.413) [-963.593] (-975.997) (-959.633) * (-964.228) (-974.426) [-956.515] (-977.415) -- 0:00:55
871000 -- (-986.719) (-965.878) (-982.550) [-957.473] * (-963.381) (-987.504) [-961.608] (-975.011) -- 0:00:54
871500 -- (-992.229) (-980.035) (-981.770) [-951.882] * (-982.749) [-965.057] (-959.313) (-978.836) -- 0:00:54
872000 -- (-983.031) [-954.115] (-986.980) (-955.107) * (-967.021) (-964.554) [-946.730] (-965.265) -- 0:00:54
872500 -- (-976.809) [-940.541] (-984.886) (-973.869) * (-960.595) (-972.020) [-959.887] (-962.628) -- 0:00:54
873000 -- (-985.653) [-946.368] (-985.859) (-990.101) * (-985.388) (-981.052) [-953.058] (-967.205) -- 0:00:53
873500 -- (-964.788) [-945.816] (-974.660) (-979.781) * (-964.501) (-979.830) (-982.462) [-952.719] -- 0:00:53
874000 -- (-970.921) [-951.602] (-976.445) (-971.196) * (-972.735) (-969.610) [-958.870] (-956.518) -- 0:00:53
874500 -- (-969.471) [-964.559] (-978.096) (-972.764) * (-971.327) (-962.955) [-963.253] (-992.100) -- 0:00:53
875000 -- (-977.949) [-950.771] (-978.230) (-978.405) * (-978.704) (-972.290) [-952.549] (-992.177) -- 0:00:53
Average standard deviation of split frequencies: 0.007048
875500 -- (-974.512) [-950.752] (-967.111) (-968.572) * [-968.659] (-978.412) (-966.020) (-994.741) -- 0:00:52
876000 -- (-964.116) (-971.022) (-971.706) [-964.139] * (-977.173) (-969.493) [-957.774] (-978.212) -- 0:00:52
876500 -- [-957.533] (-960.087) (-961.882) (-974.612) * (-978.072) [-955.643] (-982.444) (-990.553) -- 0:00:52
877000 -- [-962.492] (-964.591) (-966.411) (-977.311) * (-980.836) (-963.048) [-964.349] (-981.543) -- 0:00:52
877500 -- (-963.967) (-980.803) [-970.757] (-974.079) * (-979.118) (-955.337) [-962.512] (-970.143) -- 0:00:52
878000 -- (-949.927) (-980.956) (-980.880) [-954.424] * (-981.748) (-970.633) [-955.242] (-975.019) -- 0:00:51
878500 -- [-953.578] (-963.329) (-989.688) (-961.670) * (-989.481) [-948.793] (-959.855) (-978.907) -- 0:00:51
879000 -- (-964.506) (-964.096) (-1003.337) [-954.684] * (-984.068) (-971.465) [-951.518] (-987.551) -- 0:00:51
879500 -- [-950.290] (-980.500) (-968.955) (-962.116) * (-979.883) [-944.436] (-975.277) (-968.368) -- 0:00:51
880000 -- [-960.141] (-975.470) (-976.295) (-962.548) * (-969.990) (-960.356) [-955.566] (-962.811) -- 0:00:51
Average standard deviation of split frequencies: 0.007080
880500 -- [-953.801] (-973.115) (-978.208) (-963.228) * (-988.679) (-973.715) [-953.940] (-966.514) -- 0:00:50
881000 -- (-965.341) (-964.551) [-957.453] (-961.038) * (-963.240) [-942.160] (-961.972) (-970.037) -- 0:00:50
881500 -- [-958.107] (-961.827) (-966.750) (-976.619) * (-969.688) [-947.397] (-969.389) (-987.988) -- 0:00:50
882000 -- [-951.975] (-966.003) (-977.882) (-974.680) * (-952.578) [-966.201] (-975.809) (-991.343) -- 0:00:50
882500 -- (-958.411) (-996.492) (-963.495) [-948.561] * (-968.347) [-960.426] (-983.509) (-973.234) -- 0:00:49
883000 -- (-965.927) (-985.559) (-961.033) [-951.462] * [-959.374] (-965.778) (-978.830) (-975.864) -- 0:00:49
883500 -- (-969.914) (-996.073) (-972.629) [-964.204] * [-951.913] (-959.302) (-986.099) (-974.312) -- 0:00:49
884000 -- [-976.531] (-987.395) (-968.871) (-965.137) * [-960.480] (-956.960) (-972.849) (-982.023) -- 0:00:49
884500 -- (-975.377) (-977.230) (-965.889) [-954.763] * [-949.287] (-969.229) (-974.584) (-980.978) -- 0:00:49
885000 -- (-973.338) (-998.742) (-973.063) [-948.265] * [-946.904] (-960.021) (-980.140) (-966.688) -- 0:00:48
Average standard deviation of split frequencies: 0.006985
885500 -- (-967.020) (-1004.380) (-992.437) [-961.387] * (-966.087) [-948.670] (-980.389) (-974.655) -- 0:00:48
886000 -- (-963.122) (-998.935) (-986.498) [-953.721] * [-964.070] (-963.927) (-984.581) (-969.997) -- 0:00:48
886500 -- [-960.606] (-989.308) (-969.700) (-955.348) * (-961.615) [-965.692] (-980.403) (-987.942) -- 0:00:48
887000 -- (-975.853) (-983.033) [-960.199] (-963.525) * [-947.423] (-979.844) (-995.261) (-979.503) -- 0:00:48
887500 -- (-969.866) (-974.329) [-951.557] (-963.290) * (-988.657) [-964.561] (-968.344) (-965.688) -- 0:00:47
888000 -- [-953.283] (-975.425) (-978.875) (-960.751) * (-965.717) (-959.755) (-981.053) [-947.414] -- 0:00:47
888500 -- (-956.007) (-980.376) (-962.799) [-956.298] * [-970.740] (-979.061) (-980.279) (-951.640) -- 0:00:47
889000 -- (-964.037) (-973.062) (-953.125) [-966.337] * (-979.988) [-952.404] (-967.692) (-952.940) -- 0:00:47
889500 -- (-957.920) (-977.695) [-949.684] (-972.999) * [-960.446] (-961.018) (-986.916) (-964.716) -- 0:00:46
890000 -- (-967.611) (-971.059) (-953.887) [-955.560] * (-975.514) [-955.819] (-989.150) (-944.645) -- 0:00:46
Average standard deviation of split frequencies: 0.006915
890500 -- (-973.090) (-995.377) [-968.039] (-959.855) * (-965.640) (-969.365) (-980.545) [-957.695] -- 0:00:46
891000 -- [-965.900] (-973.000) (-964.486) (-967.444) * [-964.056] (-972.558) (-987.000) (-970.367) -- 0:00:46
891500 -- [-963.898] (-988.694) (-967.751) (-963.870) * (-974.079) (-963.420) [-950.960] (-966.204) -- 0:00:46
892000 -- (-953.598) (-974.724) (-959.036) [-960.491] * (-976.665) (-945.698) [-946.286] (-965.405) -- 0:00:45
892500 -- (-969.087) (-993.314) (-958.545) [-956.449] * (-990.598) [-951.185] (-949.546) (-973.725) -- 0:00:45
893000 -- (-965.789) (-981.784) [-963.385] (-954.332) * (-988.302) (-973.143) (-954.810) [-955.418] -- 0:00:45
893500 -- (-979.475) (-994.052) [-961.082] (-958.560) * (-972.534) [-959.427] (-955.702) (-974.948) -- 0:00:45
894000 -- (-968.633) (-977.455) [-945.820] (-961.995) * (-972.822) (-966.140) [-949.343] (-980.871) -- 0:00:45
894500 -- (-972.447) (-968.737) [-968.117] (-964.082) * (-961.368) (-973.047) [-949.256] (-977.015) -- 0:00:44
895000 -- (-987.055) [-962.196] (-971.933) (-961.624) * (-966.620) (-954.268) [-964.991] (-972.036) -- 0:00:44
Average standard deviation of split frequencies: 0.006568
895500 -- (-976.325) (-967.848) [-960.639] (-973.640) * (-983.703) (-967.449) [-955.384] (-960.246) -- 0:00:44
896000 -- (-985.325) [-960.742] (-961.983) (-971.761) * (-989.949) (-973.847) [-957.897] (-982.603) -- 0:00:44
896500 -- (-990.541) (-954.370) (-970.120) [-950.730] * [-962.299] (-971.733) (-977.050) (-971.266) -- 0:00:43
897000 -- (-969.621) (-972.308) [-947.467] (-978.307) * [-967.059] (-956.140) (-961.602) (-985.540) -- 0:00:43
897500 -- [-950.254] (-989.327) (-961.010) (-974.116) * (-985.334) [-955.363] (-967.585) (-967.137) -- 0:00:43
898000 -- (-962.219) (-981.913) [-962.170] (-982.038) * (-972.608) [-950.814] (-995.075) (-958.686) -- 0:00:43
898500 -- (-966.476) (-960.866) [-947.644] (-979.995) * (-978.031) [-954.425] (-970.865) (-968.397) -- 0:00:43
899000 -- (-986.718) [-955.387] (-972.632) (-966.457) * (-988.186) (-974.534) (-962.258) [-956.783] -- 0:00:42
899500 -- (-997.165) (-965.206) (-979.063) [-951.535] * (-970.673) [-958.543] (-962.057) (-979.260) -- 0:00:42
900000 -- (-972.239) (-975.255) (-948.261) [-969.742] * (-958.216) (-968.217) (-971.505) [-953.470] -- 0:00:42
Average standard deviation of split frequencies: 0.006493
900500 -- (-974.236) (-984.790) [-961.182] (-962.532) * (-959.687) (-971.470) (-965.310) [-956.709] -- 0:00:42
901000 -- (-970.081) [-961.631] (-977.329) (-974.998) * [-950.170] (-973.078) (-983.399) (-966.976) -- 0:00:41
901500 -- (-958.142) [-968.170] (-986.628) (-986.348) * [-960.642] (-1001.104) (-979.101) (-972.839) -- 0:00:41
902000 -- (-956.740) (-959.139) [-947.786] (-965.787) * [-952.879] (-981.253) (-970.152) (-960.262) -- 0:00:41
902500 -- (-989.108) (-961.599) (-957.576) [-957.515] * [-953.994] (-962.195) (-987.712) (-957.972) -- 0:00:41
903000 -- (-973.485) [-951.535] (-966.988) (-966.022) * [-947.755] (-964.510) (-974.522) (-954.208) -- 0:00:41
903500 -- (-980.457) (-973.858) (-979.013) [-966.130] * [-948.530] (-959.728) (-967.824) (-983.213) -- 0:00:40
904000 -- (-973.654) (-971.924) (-980.272) [-952.881] * (-958.000) [-955.757] (-991.021) (-975.066) -- 0:00:40
904500 -- [-957.174] (-970.338) (-974.462) (-964.773) * (-972.584) [-960.604] (-982.916) (-969.267) -- 0:00:40
905000 -- (-969.078) (-987.591) (-991.532) [-952.541] * (-951.510) (-961.286) (-992.935) [-952.274] -- 0:00:40
Average standard deviation of split frequencies: 0.006683
905500 -- (-969.839) (-975.083) (-979.102) [-963.651] * [-964.071] (-954.706) (-991.059) (-964.146) -- 0:00:40
906000 -- (-961.979) (-1001.818) (-972.612) [-951.202] * (-973.820) (-971.875) (-971.815) [-963.439] -- 0:00:39
906500 -- (-961.489) (-979.149) (-951.935) [-955.469] * (-984.280) (-978.360) [-967.218] (-965.423) -- 0:00:39
907000 -- (-976.613) (-968.758) [-941.739] (-965.082) * (-966.849) (-962.564) (-987.718) [-960.319] -- 0:00:39
907500 -- (-962.773) (-963.921) [-960.795] (-976.429) * (-964.039) (-958.422) (-974.473) [-963.350] -- 0:00:39
908000 -- (-963.213) (-971.404) [-949.298] (-979.375) * (-973.090) [-957.772] (-970.983) (-983.229) -- 0:00:39
908500 -- [-953.875] (-963.153) (-957.172) (-968.416) * (-976.473) (-963.356) [-956.679] (-956.678) -- 0:00:38
909000 -- (-953.214) (-969.129) [-958.349] (-968.367) * (-965.721) [-963.539] (-973.370) (-992.430) -- 0:00:38
909500 -- (-943.744) [-943.560] (-993.337) (-980.885) * (-961.692) (-971.680) [-961.531] (-994.254) -- 0:00:38
910000 -- [-950.740] (-955.839) (-987.656) (-980.899) * [-954.416] (-971.654) (-981.800) (-954.524) -- 0:00:38
Average standard deviation of split frequencies: 0.006519
910500 -- (-972.596) [-951.337] (-974.524) (-955.242) * (-959.793) (-966.568) [-960.410] (-978.012) -- 0:00:37
911000 -- (-969.794) [-942.424] (-976.731) (-1000.382) * (-1003.122) (-966.046) [-965.949] (-959.211) -- 0:00:37
911500 -- (-966.379) [-951.658] (-968.410) (-989.364) * (-964.209) (-977.095) (-952.807) [-946.745] -- 0:00:37
912000 -- (-965.765) [-954.001] (-962.953) (-994.745) * [-966.948] (-995.008) (-957.426) (-961.360) -- 0:00:37
912500 -- (-969.461) (-954.259) (-980.009) [-962.725] * (-974.787) (-974.594) [-969.328] (-972.400) -- 0:00:37
913000 -- (-1008.041) [-950.011] (-964.462) (-969.830) * (-975.472) (-973.423) [-956.049] (-988.275) -- 0:00:36
913500 -- (-978.885) (-968.279) [-954.980] (-978.442) * (-973.304) (-966.112) [-964.383] (-984.662) -- 0:00:36
914000 -- [-974.740] (-973.921) (-970.967) (-1002.945) * (-969.606) [-968.789] (-1004.662) (-971.610) -- 0:00:36
914500 -- (-981.579) [-948.598] (-960.820) (-970.036) * (-988.330) (-978.517) (-982.996) [-951.834] -- 0:00:36
915000 -- (-977.302) [-940.796] (-960.664) (-984.815) * (-972.853) (-970.812) (-979.867) [-966.196] -- 0:00:36
Average standard deviation of split frequencies: 0.006562
915500 -- (-963.956) (-959.976) [-948.298] (-979.619) * (-969.581) [-972.594] (-973.996) (-963.594) -- 0:00:35
916000 -- (-974.721) (-958.912) [-960.080] (-998.701) * (-982.970) [-959.696] (-968.434) (-969.378) -- 0:00:35
916500 -- (-968.658) (-962.948) [-956.904] (-998.300) * (-972.542) [-962.129] (-984.808) (-972.131) -- 0:00:35
917000 -- (-974.446) (-965.635) (-966.828) [-977.355] * (-993.133) (-962.166) (-948.648) [-960.148] -- 0:00:35
917500 -- (-979.805) [-959.949] (-967.439) (-975.391) * (-986.286) [-945.649] (-962.903) (-961.195) -- 0:00:34
918000 -- (-975.882) [-971.290] (-967.028) (-971.936) * [-948.507] (-975.323) (-965.026) (-985.440) -- 0:00:34
918500 -- (-986.152) (-967.256) (-976.886) [-956.300] * [-963.834] (-965.423) (-959.622) (-964.109) -- 0:00:34
919000 -- (-979.528) (-973.985) [-951.101] (-971.201) * (-964.212) (-973.383) [-964.484] (-963.416) -- 0:00:34
919500 -- (-969.568) (-967.268) [-947.037] (-956.085) * (-984.062) (-999.495) (-967.490) [-946.051] -- 0:00:34
920000 -- (-970.677) (-979.448) [-957.458] (-955.326) * (-981.601) (-981.596) (-974.220) [-953.496] -- 0:00:33
Average standard deviation of split frequencies: 0.006784
920500 -- (-990.690) (-983.436) (-966.118) [-962.329] * (-981.044) [-966.522] (-977.907) (-964.038) -- 0:00:33
921000 -- (-971.292) (-978.068) [-950.678] (-965.563) * [-968.431] (-964.110) (-984.852) (-974.890) -- 0:00:33
921500 -- (-979.691) [-953.797] (-963.026) (-984.530) * (-974.046) [-962.591] (-975.701) (-978.550) -- 0:00:33
922000 -- [-957.907] (-959.448) (-955.441) (-981.018) * (-977.259) [-965.627] (-963.239) (-969.695) -- 0:00:33
922500 -- (-966.840) [-957.334] (-962.247) (-966.427) * (-982.914) [-959.423] (-975.703) (-993.131) -- 0:00:32
923000 -- (-976.889) (-961.212) [-950.466] (-966.354) * (-984.251) (-951.974) [-960.687] (-961.741) -- 0:00:32
923500 -- (-975.254) (-960.988) (-953.554) [-955.002] * (-996.045) (-959.523) [-955.841] (-957.516) -- 0:00:32
924000 -- (-972.493) (-960.541) [-962.579] (-963.455) * (-994.310) [-960.097] (-973.146) (-978.799) -- 0:00:32
924500 -- (-972.795) (-964.519) [-957.379] (-969.033) * (-984.465) (-974.560) [-967.806] (-979.528) -- 0:00:32
925000 -- (-970.551) (-969.631) [-948.280] (-971.907) * (-977.880) (-974.401) [-961.614] (-985.007) -- 0:00:31
Average standard deviation of split frequencies: 0.006634
925500 -- (-969.270) (-983.109) [-951.814] (-972.679) * (-989.359) (-969.923) [-940.748] (-984.631) -- 0:00:31
926000 -- [-954.090] (-969.107) (-955.164) (-974.732) * (-986.446) (-954.311) [-961.530] (-984.746) -- 0:00:31
926500 -- (-961.552) (-974.591) [-963.954] (-986.400) * (-989.008) (-960.866) [-952.567] (-974.579) -- 0:00:31
927000 -- (-957.064) (-974.036) [-965.486] (-972.511) * (-1002.762) [-960.712] (-969.543) (-970.990) -- 0:00:30
927500 -- (-951.794) [-958.491] (-962.373) (-980.529) * [-958.721] (-962.923) (-966.636) (-973.073) -- 0:00:30
928000 -- (-966.989) (-976.642) [-946.330] (-981.152) * [-957.393] (-972.091) (-970.974) (-965.076) -- 0:00:30
928500 -- [-954.497] (-970.307) (-962.583) (-966.128) * [-954.830] (-955.939) (-994.220) (-968.747) -- 0:00:30
929000 -- (-962.978) (-1000.855) [-964.055] (-971.340) * [-943.117] (-971.867) (-996.089) (-962.884) -- 0:00:30
929500 -- (-972.165) (-987.329) [-963.565] (-978.004) * [-944.225] (-971.673) (-967.823) (-962.096) -- 0:00:29
930000 -- (-966.370) (-965.400) [-942.221] (-974.512) * (-964.722) [-966.379] (-974.497) (-967.489) -- 0:00:29
Average standard deviation of split frequencies: 0.006759
930500 -- [-955.444] (-967.294) (-945.590) (-962.798) * (-963.699) [-948.166] (-966.727) (-970.908) -- 0:00:29
931000 -- (-956.634) (-974.271) [-943.921] (-961.268) * (-961.029) [-947.688] (-978.592) (-955.574) -- 0:00:29
931500 -- (-960.380) (-978.254) [-953.788] (-967.711) * (-964.767) [-944.068] (-956.638) (-962.987) -- 0:00:29
932000 -- (-985.644) [-967.429] (-953.714) (-995.404) * (-967.042) [-951.762] (-979.181) (-969.117) -- 0:00:28
932500 -- (-976.366) [-948.113] (-968.927) (-971.064) * [-954.683] (-966.784) (-958.552) (-972.319) -- 0:00:28
933000 -- (-987.512) (-970.050) [-965.035] (-952.481) * (-965.217) [-961.497] (-965.972) (-970.474) -- 0:00:28
933500 -- (-977.353) (-969.289) (-958.716) [-959.520] * [-965.558] (-975.143) (-965.405) (-966.466) -- 0:00:28
934000 -- (-977.156) (-972.195) (-964.472) [-951.687] * (-957.985) (-989.544) [-967.213] (-960.067) -- 0:00:27
934500 -- (-977.500) [-954.928] (-977.437) (-974.142) * [-955.488] (-983.963) (-986.995) (-960.441) -- 0:00:27
935000 -- [-950.422] (-956.050) (-963.658) (-980.241) * (-968.565) (-971.180) (-976.079) [-953.752] -- 0:00:27
Average standard deviation of split frequencies: 0.006783
935500 -- (-958.865) [-950.628] (-973.165) (-974.145) * (-983.064) (-964.633) (-983.938) [-947.374] -- 0:00:27
936000 -- [-954.908] (-950.380) (-1010.952) (-967.937) * (-981.435) (-958.031) [-947.962] (-961.172) -- 0:00:27
936500 -- (-962.199) (-958.151) (-971.409) [-958.816] * (-969.804) (-980.823) [-967.021] (-958.867) -- 0:00:26
937000 -- (-994.257) (-963.231) (-965.261) [-957.554] * (-976.344) (-966.317) (-977.390) [-962.166] -- 0:00:26
937500 -- (-999.190) (-977.171) [-944.742] (-949.269) * (-990.614) [-952.637] (-966.287) (-992.135) -- 0:00:26
938000 -- (-983.142) (-981.790) [-949.137] (-955.420) * (-973.651) [-942.583] (-969.600) (-975.813) -- 0:00:26
938500 -- (-997.341) (-963.846) [-959.675] (-977.442) * (-986.401) (-947.909) [-973.368] (-979.616) -- 0:00:26
939000 -- (-986.989) (-965.937) (-974.169) [-959.649] * (-965.872) (-961.150) [-954.759] (-972.597) -- 0:00:25
939500 -- (-981.839) [-946.242] (-964.600) (-957.884) * (-977.626) [-964.577] (-971.665) (-976.907) -- 0:00:25
940000 -- (-996.489) [-968.584] (-962.358) (-969.859) * (-988.215) (-967.233) [-949.360] (-967.822) -- 0:00:25
Average standard deviation of split frequencies: 0.006844
940500 -- (-985.402) [-951.349] (-980.310) (-963.943) * (-987.691) (-971.246) (-971.043) [-964.303] -- 0:00:25
941000 -- (-973.120) [-953.658] (-978.105) (-991.134) * (-970.683) (-967.485) [-951.763] (-965.216) -- 0:00:24
941500 -- [-965.975] (-953.619) (-975.972) (-982.613) * (-977.712) (-964.026) [-953.819] (-968.083) -- 0:00:24
942000 -- (-971.422) [-954.266] (-965.464) (-966.478) * (-981.909) (-959.286) [-958.867] (-978.974) -- 0:00:24
942500 -- (-972.531) [-959.840] (-988.552) (-991.436) * (-984.884) [-965.855] (-950.570) (-979.665) -- 0:00:24
943000 -- (-975.961) [-957.776] (-968.758) (-991.938) * (-991.122) [-965.886] (-985.376) (-974.580) -- 0:00:24
943500 -- (-978.064) [-945.637] (-964.752) (-994.540) * (-968.008) (-964.713) [-941.469] (-968.721) -- 0:00:23
944000 -- (-981.540) (-970.784) [-966.354] (-986.953) * (-975.636) [-961.062] (-960.559) (-959.261) -- 0:00:23
944500 -- (-978.451) (-947.476) [-959.382] (-983.307) * (-968.960) [-950.886] (-971.001) (-974.090) -- 0:00:23
945000 -- [-967.514] (-957.391) (-943.781) (-985.450) * (-990.635) [-960.392] (-972.183) (-963.078) -- 0:00:23
Average standard deviation of split frequencies: 0.006618
945500 -- (-991.536) [-946.739] (-957.989) (-979.293) * (-958.219) (-960.575) [-973.609] (-965.919) -- 0:00:23
946000 -- [-973.865] (-955.865) (-977.411) (-1009.629) * (-960.894) (-967.994) (-969.731) [-963.396] -- 0:00:22
946500 -- (-957.394) [-960.468] (-985.454) (-984.415) * (-977.124) (-968.165) [-953.797] (-971.293) -- 0:00:22
947000 -- (-973.367) (-961.796) [-967.799] (-969.031) * (-962.505) (-958.353) [-962.299] (-968.901) -- 0:00:22
947500 -- (-982.641) [-969.170] (-976.913) (-971.970) * [-954.916] (-969.077) (-975.287) (-979.335) -- 0:00:22
948000 -- (-984.956) (-981.504) (-963.469) [-967.584] * [-962.349] (-978.748) (-977.885) (-983.340) -- 0:00:21
948500 -- (-981.171) (-979.940) [-970.371] (-969.565) * (-987.921) (-976.322) [-960.248] (-968.874) -- 0:00:21
949000 -- (-995.681) (-976.278) [-946.326] (-987.740) * (-992.719) (-1000.060) (-957.024) [-953.075] -- 0:00:21
949500 -- (-1003.230) (-966.068) [-959.267] (-979.801) * [-959.575] (-974.175) (-990.943) (-972.355) -- 0:00:21
950000 -- (-993.849) (-973.053) [-945.122] (-980.633) * (-978.792) (-975.562) [-958.828] (-980.844) -- 0:00:21
Average standard deviation of split frequencies: 0.006648
950500 -- (-987.998) (-958.171) [-953.170] (-973.703) * (-962.033) (-962.771) [-950.506] (-995.583) -- 0:00:20
951000 -- (-988.813) [-971.718] (-968.227) (-968.514) * (-971.290) (-970.380) [-958.339] (-962.584) -- 0:00:20
951500 -- (-993.443) (-976.527) [-958.591] (-979.426) * (-990.995) (-969.230) [-954.962] (-954.861) -- 0:00:20
952000 -- [-973.432] (-983.783) (-967.541) (-981.728) * (-973.382) (-965.277) [-947.927] (-961.074) -- 0:00:20
952500 -- (-966.360) (-988.895) [-956.575] (-969.070) * (-980.676) [-954.702] (-962.520) (-975.680) -- 0:00:20
953000 -- (-976.127) (-989.613) [-953.755] (-964.542) * (-955.304) (-958.056) [-951.297] (-978.028) -- 0:00:19
953500 -- (-982.379) (-981.124) (-955.599) [-961.880] * (-960.830) [-960.890] (-984.498) (-988.854) -- 0:00:19
954000 -- (-983.702) (-984.214) (-955.520) [-950.323] * (-972.771) (-967.510) (-971.884) [-956.094] -- 0:00:19
954500 -- (-978.048) (-973.505) (-969.890) [-961.326] * (-972.851) [-951.871] (-977.113) (-958.804) -- 0:00:19
955000 -- (-995.759) (-972.922) (-967.788) [-957.997] * (-980.540) [-957.907] (-953.754) (-975.510) -- 0:00:19
Average standard deviation of split frequencies: 0.006873
955500 -- (-984.761) [-948.822] (-975.667) (-953.755) * [-960.214] (-961.401) (-947.352) (-982.848) -- 0:00:18
956000 -- (-970.263) (-970.713) [-946.772] (-952.238) * (-950.162) [-951.886] (-959.556) (-979.474) -- 0:00:18
956500 -- (-984.821) (-999.976) [-947.926] (-959.603) * (-952.383) [-953.515] (-978.106) (-988.225) -- 0:00:18
957000 -- (-978.923) (-980.109) [-956.644] (-958.666) * (-943.358) [-949.771] (-978.140) (-966.023) -- 0:00:18
957500 -- (-981.503) (-978.145) [-964.708] (-970.591) * [-949.335] (-967.513) (-974.688) (-972.351) -- 0:00:18
958000 -- (-972.082) (-985.586) [-966.501] (-974.925) * (-957.889) (-962.954) (-984.250) [-951.609] -- 0:00:17
958500 -- [-961.001] (-961.668) (-964.645) (-956.198) * (-980.804) [-953.223] (-969.883) (-976.470) -- 0:00:17
959000 -- (-987.133) (-984.184) [-956.971] (-964.316) * (-985.455) (-959.256) [-961.194] (-989.625) -- 0:00:17
959500 -- (-988.143) (-973.181) (-954.331) [-964.524] * (-966.945) [-952.048] (-971.322) (-963.339) -- 0:00:17
960000 -- (-978.001) (-959.990) (-971.350) [-958.769] * [-954.050] (-958.438) (-969.641) (-961.076) -- 0:00:16
Average standard deviation of split frequencies: 0.006717
960500 -- (-974.841) (-968.765) [-952.708] (-960.000) * (-969.966) (-968.731) (-970.368) [-959.983] -- 0:00:16
961000 -- (-982.166) (-974.251) (-966.548) [-948.003] * (-961.630) [-958.202] (-975.685) (-965.982) -- 0:00:16
961500 -- (-981.059) [-958.379] (-951.640) (-948.912) * (-976.358) [-947.205] (-978.026) (-965.307) -- 0:00:16
962000 -- (-965.193) [-942.323] (-982.138) (-954.088) * [-951.198] (-953.732) (-971.374) (-966.227) -- 0:00:16
962500 -- (-964.481) [-950.379] (-983.339) (-963.312) * (-972.999) [-964.159] (-978.867) (-976.990) -- 0:00:15
963000 -- (-973.982) [-949.290] (-964.161) (-988.021) * (-950.896) [-967.058] (-992.344) (-976.679) -- 0:00:15
963500 -- (-964.224) (-972.847) [-952.326] (-958.451) * [-958.615] (-971.311) (-977.763) (-973.047) -- 0:00:15
964000 -- (-995.640) (-955.212) [-954.552] (-976.816) * [-939.714] (-966.006) (-984.773) (-948.648) -- 0:00:15
964500 -- (-984.110) (-984.555) [-953.848] (-956.726) * [-959.209] (-977.730) (-993.467) (-976.864) -- 0:00:15
965000 -- (-981.509) (-996.241) (-961.999) [-956.323] * (-970.253) [-969.123] (-988.457) (-986.025) -- 0:00:14
Average standard deviation of split frequencies: 0.006649
965500 -- (-987.712) (-970.834) [-961.021] (-959.028) * (-960.268) [-964.551] (-984.037) (-984.084) -- 0:00:14
966000 -- (-979.498) (-979.236) (-962.360) [-946.882] * (-965.626) [-958.040] (-980.621) (-975.819) -- 0:00:14
966500 -- (-999.012) (-963.974) (-959.522) [-969.291] * (-980.160) [-956.434] (-984.403) (-969.119) -- 0:00:14
967000 -- (-972.691) (-976.897) [-979.769] (-982.569) * (-967.813) [-953.840] (-988.687) (-957.897) -- 0:00:13
967500 -- [-965.499] (-970.394) (-966.675) (-957.418) * [-969.037] (-961.094) (-998.259) (-970.582) -- 0:00:13
968000 -- (-987.622) (-970.696) [-961.565] (-962.982) * [-970.108] (-949.697) (-984.624) (-973.620) -- 0:00:13
968500 -- (-984.237) (-962.519) (-964.528) [-958.014] * (-967.294) [-956.523] (-985.761) (-955.237) -- 0:00:13
969000 -- (-985.193) (-972.547) (-964.426) [-947.493] * (-977.801) [-944.190] (-986.400) (-956.374) -- 0:00:13
969500 -- (-972.198) (-972.576) [-959.517] (-947.113) * (-988.308) [-972.333] (-981.811) (-975.636) -- 0:00:12
970000 -- (-981.045) (-954.266) (-980.038) [-954.996] * (-979.903) [-956.488] (-991.991) (-978.382) -- 0:00:12
Average standard deviation of split frequencies: 0.006966
970500 -- [-970.335] (-971.424) (-977.177) (-964.714) * [-969.329] (-947.728) (-988.065) (-984.285) -- 0:00:12
971000 -- (-990.287) (-969.236) [-957.381] (-971.233) * (-991.449) [-953.718] (-985.230) (-968.025) -- 0:00:12
971500 -- (-967.649) [-959.938] (-972.303) (-996.530) * (-962.976) [-956.645] (-983.600) (-966.313) -- 0:00:12
972000 -- (-995.374) [-959.441] (-977.872) (-981.458) * (-967.842) [-954.323] (-981.591) (-962.385) -- 0:00:11
972500 -- (-991.489) [-949.786] (-971.774) (-952.372) * (-972.479) [-961.017] (-977.744) (-968.258) -- 0:00:11
973000 -- (-985.689) (-958.785) (-978.498) [-959.056] * (-961.478) (-968.966) (-973.170) [-961.998] -- 0:00:11
973500 -- (-982.436) (-963.664) [-954.051] (-975.708) * [-963.083] (-970.762) (-989.202) (-969.927) -- 0:00:11
974000 -- (-968.188) (-974.890) [-959.319] (-972.315) * [-958.119] (-970.302) (-989.340) (-969.796) -- 0:00:10
974500 -- (-975.914) (-968.180) [-977.283] (-979.231) * [-955.987] (-952.594) (-977.705) (-973.468) -- 0:00:10
975000 -- (-981.098) (-994.443) [-948.754] (-973.872) * (-974.817) [-958.859] (-966.414) (-973.928) -- 0:00:10
Average standard deviation of split frequencies: 0.006943
975500 -- (-973.860) (-980.908) [-949.148] (-984.810) * (-961.497) (-966.106) [-964.527] (-966.781) -- 0:00:10
976000 -- (-975.155) (-970.418) [-970.530] (-977.260) * [-961.164] (-984.621) (-971.540) (-973.733) -- 0:00:10
976500 -- (-974.874) (-976.969) [-970.168] (-963.705) * [-944.772] (-976.959) (-970.446) (-960.986) -- 0:00:09
977000 -- (-988.716) (-966.754) (-983.895) [-967.279] * (-976.792) (-978.014) (-975.962) [-964.658] -- 0:00:09
977500 -- (-970.753) (-961.113) [-956.845] (-972.437) * [-965.519] (-947.937) (-953.091) (-958.592) -- 0:00:09
978000 -- [-977.328] (-965.855) (-968.440) (-974.075) * (-966.758) [-952.218] (-954.807) (-976.724) -- 0:00:09
978500 -- (-979.091) (-975.094) [-954.531] (-973.528) * (-975.568) [-954.573] (-963.339) (-977.852) -- 0:00:09
979000 -- (-976.275) (-975.008) [-960.253] (-967.909) * (-963.261) [-955.837] (-958.011) (-991.499) -- 0:00:08
979500 -- (-978.584) [-957.449] (-960.737) (-968.772) * [-969.847] (-974.850) (-951.878) (-984.666) -- 0:00:08
980000 -- (-977.038) [-947.462] (-957.700) (-960.227) * (-969.633) (-970.663) [-954.726] (-989.396) -- 0:00:08
Average standard deviation of split frequencies: 0.007060
980500 -- (-953.376) (-973.319) [-950.626] (-970.168) * [-956.720] (-980.530) (-949.186) (-985.126) -- 0:00:08
981000 -- (-947.746) (-983.969) [-959.749] (-992.070) * [-979.222] (-973.524) (-973.655) (-980.145) -- 0:00:08
981500 -- [-938.195] (-953.066) (-964.075) (-996.159) * (-976.874) (-971.106) [-965.143] (-979.468) -- 0:00:07
982000 -- (-951.561) [-957.145] (-971.084) (-979.623) * [-955.502] (-953.600) (-960.561) (-1004.288) -- 0:00:07
982500 -- (-994.392) (-974.316) [-956.172] (-971.305) * [-974.163] (-969.971) (-973.191) (-980.141) -- 0:00:07
983000 -- (-953.107) (-959.269) [-944.858] (-972.894) * (-969.277) (-966.013) [-955.558] (-984.615) -- 0:00:07
983500 -- (-986.777) (-963.902) (-957.471) [-956.754] * (-959.885) [-964.866] (-972.179) (-985.050) -- 0:00:06
984000 -- (-968.692) [-968.528] (-963.238) (-983.357) * [-964.485] (-956.964) (-968.016) (-987.419) -- 0:00:06
984500 -- (-955.441) [-963.774] (-975.874) (-976.857) * (-975.716) (-978.449) [-956.538] (-981.314) -- 0:00:06
985000 -- [-971.779] (-969.809) (-958.328) (-966.437) * (-970.235) [-963.051] (-968.467) (-989.858) -- 0:00:06
Average standard deviation of split frequencies: 0.007201
985500 -- (-984.118) (-984.174) (-960.428) [-963.554] * [-956.026] (-976.688) (-972.421) (-984.194) -- 0:00:06
986000 -- (-964.979) [-954.339] (-953.477) (-977.977) * [-959.640] (-967.422) (-983.926) (-999.980) -- 0:00:05
986500 -- [-950.582] (-968.489) (-964.786) (-972.158) * [-950.307] (-973.904) (-972.426) (-974.567) -- 0:00:05
987000 -- (-959.950) [-948.146] (-971.051) (-972.767) * [-961.005] (-961.867) (-969.952) (-973.990) -- 0:00:05
987500 -- (-957.011) (-956.549) [-950.388] (-962.050) * [-967.382] (-957.961) (-979.420) (-980.929) -- 0:00:05
988000 -- [-968.878] (-947.144) (-970.418) (-979.812) * (-959.233) [-949.890] (-972.592) (-980.897) -- 0:00:05
988500 -- (-986.220) (-952.327) (-970.383) [-961.621] * (-970.024) [-965.453] (-980.270) (-977.674) -- 0:00:04
989000 -- (-981.225) [-962.270] (-968.651) (-966.597) * (-976.196) [-969.396] (-952.069) (-987.333) -- 0:00:04
989500 -- (-983.184) [-950.173] (-970.567) (-982.198) * (-968.441) (-980.865) [-956.908] (-983.307) -- 0:00:04
990000 -- (-971.146) (-957.392) [-964.963] (-977.943) * (-975.415) [-962.281] (-956.298) (-980.310) -- 0:00:04
Average standard deviation of split frequencies: 0.007346
990500 -- [-963.147] (-970.759) (-982.367) (-973.997) * [-956.556] (-966.865) (-959.940) (-984.307) -- 0:00:04
991000 -- [-964.593] (-966.560) (-966.002) (-982.422) * [-958.196] (-957.879) (-973.223) (-979.769) -- 0:00:03
991500 -- [-965.041] (-970.434) (-987.616) (-978.919) * [-957.078] (-954.533) (-998.170) (-979.884) -- 0:00:03
992000 -- [-951.233] (-984.298) (-975.326) (-986.505) * (-954.449) (-978.791) [-969.223] (-980.269) -- 0:00:03
992500 -- [-958.143] (-987.020) (-996.585) (-975.104) * [-947.797] (-999.178) (-965.203) (-966.578) -- 0:00:03
993000 -- [-962.936] (-984.649) (-975.495) (-983.365) * [-950.554] (-988.033) (-978.657) (-961.514) -- 0:00:02
993500 -- (-961.501) [-958.726] (-968.279) (-984.764) * [-957.394] (-977.194) (-989.075) (-977.088) -- 0:00:02
994000 -- [-960.223] (-964.112) (-978.184) (-982.463) * (-970.371) (-975.974) (-975.063) [-959.830] -- 0:00:02
994500 -- [-956.356] (-977.893) (-979.405) (-982.736) * (-967.546) [-957.352] (-973.816) (-964.686) -- 0:00:02
995000 -- [-944.938] (-963.060) (-968.689) (-985.687) * [-964.405] (-984.672) (-984.436) (-968.167) -- 0:00:02
Average standard deviation of split frequencies: 0.007307
995500 -- [-944.622] (-975.801) (-972.242) (-986.638) * (-960.888) (-970.441) [-965.686] (-984.681) -- 0:00:01
996000 -- (-953.889) (-1001.387) [-952.924] (-979.806) * [-949.660] (-988.660) (-982.099) (-979.218) -- 0:00:01
996500 -- [-950.268] (-1001.795) (-953.143) (-973.151) * (-967.853) (-969.782) [-965.559] (-962.834) -- 0:00:01
997000 -- [-945.597] (-965.408) (-959.263) (-981.570) * [-951.353] (-974.301) (-959.395) (-962.922) -- 0:00:01
997500 -- [-954.976] (-976.434) (-972.971) (-979.558) * [-961.152] (-967.584) (-969.534) (-976.275) -- 0:00:01
998000 -- (-964.191) (-961.620) (-977.312) [-961.037] * [-955.666] (-971.232) (-963.508) (-991.847) -- 0:00:00
998500 -- (-965.956) [-949.473] (-974.261) (-973.325) * [-954.667] (-971.337) (-967.594) (-995.387) -- 0:00:00
999000 -- (-976.242) [-955.694] (-966.307) (-984.563) * [-955.393] (-969.925) (-980.589) (-979.998) -- 0:00:00
999500 -- (-977.761) [-951.643] (-981.433) (-966.926) * [-946.306] (-982.088) (-975.765) (-954.967) -- 0:00:00
1000000 -- (-996.955) [-941.969] (-968.953) (-968.114) * (-959.847) (-969.963) (-966.484) [-968.080] -- 0:00:00
Average standard deviation of split frequencies: 0.007199
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -996.954757 -- 26.821094
Chain 1 -- -996.954756 -- 26.821094
Chain 2 -- -941.968863 -- 34.805223
Chain 2 -- -941.968865 -- 34.805223
Chain 3 -- -968.953317 -- 23.979970
Chain 3 -- -968.953325 -- 23.979970
Chain 4 -- -968.114480 -- 29.926580
Chain 4 -- -968.114466 -- 29.926580
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -959.847357 -- 31.950326
Chain 1 -- -959.847358 -- 31.950326
Chain 2 -- -969.963425 -- 25.302727
Chain 2 -- -969.963425 -- 25.302727
Chain 3 -- -966.484176 -- 30.554054
Chain 3 -- -966.484172 -- 30.554054
Chain 4 -- -968.080010 -- 27.011800
Chain 4 -- -968.080016 -- 27.011800
Analysis completed in 7 mins 2 seconds
Analysis used 422.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -932.41
Likelihood of best state for "cold" chain of run 2 was -935.02
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
40.7 % ( 32 %) Dirichlet(Revmat{all})
65.1 % ( 54 %) Slider(Revmat{all})
35.6 % ( 35 %) Dirichlet(Pi{all})
36.5 % ( 30 %) Slider(Pi{all})
35.9 % ( 24 %) Multiplier(Alpha{1,2})
46.6 % ( 19 %) Multiplier(Alpha{3})
64.9 % ( 33 %) Slider(Pinvar{all})
45.8 % ( 44 %) ExtSPR(Tau{all},V{all})
15.0 % ( 13 %) ExtTBR(Tau{all},V{all})
53.8 % ( 59 %) NNI(Tau{all},V{all})
37.1 % ( 35 %) ParsSPR(Tau{all},V{all})
27.3 % ( 30 %) Multiplier(V{all})
59.6 % ( 50 %) Nodeslider(V{all})
26.0 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
41.6 % ( 17 %) Dirichlet(Revmat{all})
65.5 % ( 51 %) Slider(Revmat{all})
35.8 % ( 29 %) Dirichlet(Pi{all})
35.7 % ( 32 %) Slider(Pi{all})
35.8 % ( 19 %) Multiplier(Alpha{1,2})
46.6 % ( 22 %) Multiplier(Alpha{3})
65.4 % ( 44 %) Slider(Pinvar{all})
46.0 % ( 45 %) ExtSPR(Tau{all},V{all})
15.1 % ( 16 %) ExtTBR(Tau{all},V{all})
54.0 % ( 58 %) NNI(Tau{all},V{all})
36.7 % ( 43 %) ParsSPR(Tau{all},V{all})
27.4 % ( 20 %) Multiplier(V{all})
59.7 % ( 62 %) Nodeslider(V{all})
25.7 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.51 0.20 0.06
2 | 167280 0.54 0.22
3 | 165692 166775 0.55
4 | 167303 166472 166478
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.51 0.20 0.06
2 | 166649 0.54 0.23
3 | 166553 166913 0.55
4 | 166123 166944 166818
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -953.97
| 1 2 2 |
| 12 2 2 1 1 |
|1 1 * 1 1 2 2 * |
|21 1 1 2 12 2 1 1 2 1|
| 1112 2 12 1 2 |
| 1 2 2 2 2 2 2 1 2 1 |
| 22 221 2 22 2 1 1 11 1 |
| 1 * 1 2 1 1 2 1 2 22 2 1 |
| 2 2 2 1 12 2 1 2 |
| 2 2 1 1 21 2 1 1 2|
| 2 1 1 2 * 2 1 |
| 1 1 1 2 1 2 |
| 1 1 1 2 |
| 2 1 2 |
| 11 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -961.54
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -941.72 -979.63
2 -941.91 -984.24
--------------------------------------
TOTAL -941.81 -983.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.284241 0.071519 0.819832 1.798684 1.243649 533.06 719.34 1.002
r(A<->C){all} 0.052870 0.000491 0.014432 0.096465 0.050331 651.63 694.94 1.003
r(A<->G){all} 0.182709 0.003526 0.076589 0.300048 0.176887 362.76 393.55 1.000
r(A<->T){all} 0.016335 0.000170 0.000001 0.040703 0.013252 439.45 587.58 1.000
r(C<->G){all} 0.009389 0.000078 0.000003 0.026448 0.006890 744.40 819.67 1.000
r(C<->T){all} 0.716030 0.005516 0.565985 0.850447 0.720446 333.78 384.20 1.001
r(G<->T){all} 0.022666 0.000152 0.002607 0.047007 0.020660 362.65 614.03 1.000
pi(A){all} 0.261494 0.000570 0.216056 0.308144 0.260412 1076.43 1094.60 1.000
pi(C){all} 0.215484 0.000519 0.173447 0.261379 0.215106 513.09 822.57 1.000
pi(G){all} 0.290855 0.000629 0.239508 0.336884 0.291105 1099.73 1165.36 1.000
pi(T){all} 0.232167 0.000543 0.189275 0.279048 0.231033 968.25 1088.37 1.000
alpha{1,2} 0.160170 0.001649 0.091637 0.245280 0.155157 1114.69 1175.96 1.000
alpha{3} 1.655989 0.479472 0.530707 3.007114 1.530987 996.14 998.82 1.001
pinvar{all} 0.210514 0.009180 0.009376 0.365474 0.216725 893.98 927.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
13 -- C13
14 -- C14
15 -- C15
16 -- C16
17 -- C17
18 -- C18
19 -- C19
20 -- C20
21 -- C21
22 -- C22
Key to taxon bipartitions (saved to file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------------------
1 -- .*********************
2 -- .*....................
3 -- ..*...................
4 -- ...*..................
5 -- ....*.................
6 -- .....*................
7 -- ......*...............
8 -- .......*..............
9 -- ........*.............
10 -- .........*............
11 -- ..........*...........
12 -- ...........*..........
13 -- ............*.........
14 -- .............*........
15 -- ..............*.......
16 -- ...............*......
17 -- ................*.....
18 -- .................*....
19 -- ..................*...
20 -- ...................*..
21 -- ....................*.
22 -- .....................*
23 -- ................******
24 -- .................**..*
25 -- ...................**.
26 -- .................**...
27 -- .............**.......
28 -- ............***.......
29 -- .....*....*****.......
30 -- .......**.............
31 -- .....*....*****.******
32 -- ................***..*
33 -- ...*******************
34 -- ................*..**.
35 -- .................*****
36 -- ..********************
37 -- ............***.******
38 -- ....*..........*......
39 -- .........*......******
40 -- .*.*******************
41 -- .....*.....*..........
42 -- .....*....**..........
43 -- .....*....*...........
44 -- ..........**..........
45 -- .**...................
46 -- .....*....*.***.......
47 -- .............**.******
48 -- .*..*..........*......
49 -- .....*......***.......
50 -- ..........*****.......
51 -- .....*.....****.......
52 -- ..........*.***.......
53 -- ...........****.......
54 -- .*.............*......
----------------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
23 3002 1.000000 0.000000 1.000000 1.000000 2
24 3001 0.999667 0.000471 0.999334 1.000000 2
25 2996 0.998001 0.001884 0.996669 0.999334 2
26 2472 0.823451 0.005653 0.819454 0.827448 2
27 2298 0.765490 0.009422 0.758827 0.772152 2
28 1760 0.586276 0.017901 0.573618 0.598934 2
29 1751 0.583278 0.011777 0.574950 0.591606 2
30 1725 0.574617 0.010835 0.566955 0.582278 2
31 1467 0.488674 0.001413 0.487675 0.489674 2
32 1102 0.367089 0.020728 0.352432 0.381746 2
33 1083 0.360759 0.009893 0.353764 0.367755 2
34 1013 0.337442 0.007066 0.332445 0.342438 2
35 887 0.295470 0.013662 0.285809 0.305130 2
36 825 0.274817 0.006124 0.270486 0.279147 2
37 726 0.241839 0.001884 0.240506 0.243171 2
38 648 0.215856 0.013191 0.206529 0.225183 2
39 600 0.199867 0.006595 0.195203 0.204530 2
40 589 0.196203 0.005182 0.192538 0.199867 2
41 532 0.177215 0.009422 0.170553 0.183877 2
42 514 0.171219 0.004711 0.167888 0.174550 2
43 512 0.170553 0.001884 0.169221 0.171885 2
44 507 0.168887 0.015546 0.157895 0.179880 2
45 481 0.160227 0.000471 0.159893 0.160560 2
46 383 0.127582 0.009893 0.120586 0.134577 2
47 377 0.125583 0.002355 0.123917 0.127249 2
48 376 0.125250 0.003769 0.122585 0.127915 2
49 370 0.123251 0.009422 0.116589 0.129913 2
50 350 0.116589 0.001884 0.115256 0.117921 2
51 350 0.116589 0.009422 0.109927 0.123251 2
52 327 0.108927 0.003298 0.106596 0.111259 2
53 323 0.107595 0.010835 0.099933 0.115256 2
54 300 0.099933 0.003769 0.097268 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.008922 0.000075 0.000001 0.026611 0.006351 1.000 2
length{all}[2] 0.028847 0.000272 0.003576 0.060125 0.025664 1.000 2
length{all}[3] 0.090790 0.001329 0.030725 0.162747 0.084659 1.000 2
length{all}[4] 0.021096 0.000175 0.001341 0.046801 0.018298 1.000 2
length{all}[5] 0.032177 0.000326 0.002894 0.066699 0.028513 1.000 2
length{all}[6] 0.013717 0.000114 0.000041 0.033431 0.011144 1.000 2
length{all}[7] 0.013597 0.000118 0.000030 0.034398 0.010805 1.000 2
length{all}[8] 0.016838 0.000164 0.000413 0.041646 0.013560 1.000 2
length{all}[9] 0.016022 0.000144 0.000008 0.038482 0.012921 1.000 2
length{all}[10] 0.018295 0.000174 0.000000 0.043230 0.015667 1.000 2
length{all}[11] 0.013692 0.000106 0.000091 0.033563 0.011004 1.000 2
length{all}[12] 0.013274 0.000110 0.000008 0.032926 0.010736 1.001 2
length{all}[13] 0.015204 0.000130 0.000067 0.037205 0.012431 1.000 2
length{all}[14] 0.014523 0.000123 0.000038 0.036428 0.011922 1.000 2
length{all}[15] 0.013852 0.000128 0.000014 0.035310 0.011055 1.000 2
length{all}[16] 0.031316 0.000302 0.004585 0.065935 0.028123 1.000 2
length{all}[17] 0.104403 0.002012 0.030033 0.196033 0.097163 1.000 2
length{all}[18] 0.028394 0.000271 0.003495 0.060227 0.025215 1.000 2
length{all}[19] 0.020874 0.000201 0.000331 0.047926 0.017848 1.001 2
length{all}[20] 0.014650 0.000136 0.000021 0.036859 0.011739 1.000 2
length{all}[21] 0.013392 0.000111 0.000011 0.033818 0.011083 1.000 2
length{all}[22] 0.049531 0.000576 0.008118 0.096468 0.045917 1.000 2
length{all}[23] 0.330356 0.010750 0.162427 0.540503 0.314540 1.002 2
length{all}[24] 0.087844 0.001739 0.020541 0.169929 0.080358 1.000 2
length{all}[25] 0.073238 0.001401 0.010749 0.145814 0.067323 1.001 2
length{all}[26] 0.020022 0.000250 0.000008 0.050884 0.015732 1.001 2
length{all}[27] 0.015257 0.000149 0.000043 0.039607 0.012272 1.000 2
length{all}[28] 0.014229 0.000133 0.000108 0.036688 0.011156 1.001 2
length{all}[29] 0.026736 0.000281 0.000023 0.059344 0.023779 0.999 2
length{all}[30] 0.013323 0.000116 0.000041 0.033344 0.010840 1.000 2
length{all}[31] 0.025126 0.000225 0.000345 0.052198 0.022888 1.000 2
length{all}[32] 0.028192 0.000590 0.000085 0.075339 0.022295 0.999 2
length{all}[33] 0.014774 0.000135 0.000115 0.036740 0.012189 0.999 2
length{all}[34] 0.026600 0.000554 0.000003 0.072446 0.020518 0.999 2
length{all}[35] 0.025094 0.000519 0.000095 0.069589 0.018957 0.999 2
length{all}[36] 0.011095 0.000090 0.000017 0.029567 0.008663 0.999 2
length{all}[37] 0.013780 0.000122 0.000039 0.033663 0.011488 0.999 2
length{all}[38] 0.011975 0.000116 0.000010 0.032418 0.009097 1.000 2
length{all}[39] 0.018669 0.000163 0.000007 0.044027 0.015736 1.000 2
length{all}[40] 0.009983 0.000100 0.000062 0.028593 0.006745 0.998 2
length{all}[41] 0.007759 0.000076 0.000005 0.026775 0.004735 1.014 2
length{all}[42] 0.007901 0.000058 0.000007 0.023428 0.005577 1.004 2
length{all}[43] 0.007320 0.000059 0.000001 0.022222 0.004919 1.003 2
length{all}[44] 0.006936 0.000043 0.000019 0.020406 0.005008 0.999 2
length{all}[45] 0.007704 0.000060 0.000014 0.022575 0.005260 0.998 2
length{all}[46] 0.008167 0.000076 0.000016 0.025544 0.005830 1.000 2
length{all}[47] 0.013587 0.000157 0.000024 0.036671 0.009858 0.998 2
length{all}[48] 0.013343 0.000097 0.000053 0.029832 0.011119 0.997 2
length{all}[49] 0.007690 0.000057 0.000038 0.022801 0.005376 0.997 2
length{all}[50] 0.007317 0.000052 0.000006 0.021850 0.005358 0.999 2
length{all}[51] 0.007640 0.000070 0.000040 0.026031 0.004893 0.999 2
length{all}[52] 0.007897 0.000065 0.000038 0.023376 0.005941 0.997 2
length{all}[53] 0.007380 0.000060 0.000025 0.022910 0.004889 1.018 2
length{all}[54] 0.010375 0.000093 0.000033 0.029955 0.007622 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007199
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.018
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
|---------------------------------------------------------------------- C7 (7)
|
|---------------------------------------------------------------------- C10 (10)
|
|---------------------------------------------------------------------- C16 (16)
|
| /---------------------------------------------------- C17 (17)
| |
| | /----------------- C18 (18)
| | /--------82-------+
| | | \----------------- C19 (19)
+-------100-------+-------100------+
| | \----------------------------------- C22 (22)
| |
| | /----------------- C20 (20)
| \----------------100---------------+
| \----------------- C21 (21)
|
| /---------------------------------------------------- C6 (6)
| |
| |---------------------------------------------------- C11 (11)
| |
|--------58-------+---------------------------------------------------- C12 (12)
| |
| | /----------------------------------- C13 (13)
| | |
| \-------59-------+ /----------------- C14 (14)
| \--------77-------+
| \----------------- C15 (15)
|
| /----------------- C8 (8)
\-------------------------57-------------------------+
\----------------- C9 (9)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|---- C2 (2)
|
|------------- C3 (3)
|
|--- C4 (4)
|
|----- C5 (5)
|
|-- C7 (7)
|
|-- C10 (10)
|
|---- C16 (16)
|
| /--------------- C17 (17)
| |
| | /---- C18 (18)
| | /-+
| | | \--- C19 (19)
+-------------------------------------------------+------------+
| | \------- C22 (22)
| |
| | /-- C20 (20)
| \----------+
| \- C21 (21)
|
| /-- C6 (6)
| |
| |-- C11 (11)
| |
|---+- C12 (12)
| |
| | /-- C13 (13)
| | |
| \-+/-- C14 (14)
| \+
| \-- C15 (15)
|
| /-- C8 (8)
\-+
\-- C9 (9)
|--------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3002 trees sampled):
50 % credible set contains 1501 trees
90 % credible set contains 2702 trees
95 % credible set contains 2852 trees
99 % credible set contains 2972 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 22 ls = 279
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Reading seq #13: C13
Reading seq #14: C14
Reading seq #15: C15
Reading seq #16: C16
Reading seq #17: C17
Reading seq #18: C18
Reading seq #19: C19
Reading seq #20: C20
Reading seq #21: C21
Reading seq #22: C22
Sequences read..
Counting site patterns.. 0:00
79 patterns at 93 / 93 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22
1848 bytes for distance
77104 bytes for conP
10744 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
1 0.406524
2 0.298410
3 0.278108
4 0.274970
5 0.274663
6 0.274640
7 0.274633
8 0.274633
346968 bytes for conP, adjusted
0.020371 0.044398 0.124106 0.042953 0.068977 0.025592 0.019857 0.048359 0.366377 0.121054 0.125459 0.000000 0.039391 0.016658 0.081173 0.095900 0.017417 0.014256 0.014600 0.019030 0.024905 0.016962 0.005770 0.011704 0.012076 0.020805 0.015112 0.026709 0.021245 0.011441 0.300000 1.300000
ntime & nrate & np: 30 2 32
Bounds (np=32):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 32
lnL0 = -1132.356290
Iterating by ming2
Initial: fx= 1132.356290
x= 0.02037 0.04440 0.12411 0.04295 0.06898 0.02559 0.01986 0.04836 0.36638 0.12105 0.12546 0.00000 0.03939 0.01666 0.08117 0.09590 0.01742 0.01426 0.01460 0.01903 0.02490 0.01696 0.00577 0.01170 0.01208 0.02081 0.01511 0.02671 0.02124 0.01144 0.30000 1.30000
1 h-m-p 0.0000 0.0000 335.2759 ++ 1132.354970 m 0.0000 37 | 1/32
2 h-m-p 0.0000 0.0000 1096.2481 +YYCYYCCC 1126.754629 7 0.0000 84 | 1/32
3 h-m-p 0.0000 0.0000 1862.8541 +YYYYYYCCCC 1116.293124 10 0.0000 133 | 1/32
4 h-m-p 0.0000 0.0002 323.0522 +YYYYYC 1110.127059 5 0.0002 174 | 1/32
5 h-m-p 0.0000 0.0002 596.5853 YCCCC 1107.142158 4 0.0001 216 | 1/32
6 h-m-p 0.0005 0.0026 83.3722 +YCCCC 1103.041544 4 0.0016 259 | 1/32
7 h-m-p 0.0002 0.0009 298.4458 +YYYCYCCC 1094.823701 7 0.0008 306 | 1/32
8 h-m-p 0.0000 0.0001 1964.0653 +YYYCYCCC 1086.582833 7 0.0001 353 | 1/32
9 h-m-p 0.0000 0.0000 6348.5013 +CYCCC 1079.967848 4 0.0000 396 | 1/32
10 h-m-p 0.0000 0.0000 11398.6133 ++ 1077.942434 m 0.0000 431 | 1/32
11 h-m-p 0.0000 0.0000 25360.5926 +YYYYYCCCCC 1074.187282 9 0.0000 480 | 1/32
12 h-m-p 0.0000 0.0000 14327.2699 +YYCYC 1073.124153 4 0.0000 521 | 1/32
13 h-m-p 0.0000 0.0000 32632.1480 +CYYCCC 1069.087645 5 0.0000 565 | 1/32
14 h-m-p 0.0000 0.0000 11686.9682 ++ 1062.050724 m 0.0000 600 | 1/32
15 h-m-p -0.0000 -0.0000 4824.4293
h-m-p: -2.21457457e-21 -1.10728729e-20 4.82442927e+03 1062.050724
.. | 1/32
16 h-m-p 0.0000 0.0006 27742.7508 YYCYYCCC 1051.318540 7 0.0000 678 | 1/32
17 h-m-p 0.0000 0.0005 875.7116 +CYCCC 1034.932700 4 0.0001 722 | 1/32
18 h-m-p 0.0001 0.0005 302.4283 +CYCYCCC 1007.038730 6 0.0005 768 | 1/32
19 h-m-p 0.0000 0.0000 2179.8759 +YYYCYCCC 996.640695 7 0.0000 814 | 1/32
20 h-m-p 0.0000 0.0001 653.3180 +YYYYC 990.451396 4 0.0001 854 | 1/32
21 h-m-p 0.0000 0.0001 513.5301 +YYYCYCCC 986.158545 7 0.0001 900 | 1/32
22 h-m-p 0.0000 0.0000 3218.9273 +YYYYYC 981.942445 5 0.0000 941 | 1/32
23 h-m-p 0.0001 0.0006 344.8391 +YYYCCC 971.045608 5 0.0005 984 | 1/32
24 h-m-p 0.0000 0.0002 456.9240 +YYCCCC 968.854440 5 0.0001 1028 | 1/32
25 h-m-p 0.0002 0.0008 143.2487 +YYCCCC 965.845132 5 0.0005 1072 | 1/32
26 h-m-p 0.0003 0.0025 248.9726 +YCCCC 961.257224 4 0.0008 1115 | 1/32
27 h-m-p 0.0004 0.0019 167.2926 +YYYYYC 954.354402 5 0.0015 1156 | 1/32
28 h-m-p 0.0001 0.0004 740.3900 YCYC 951.999053 3 0.0002 1195 | 1/32
29 h-m-p 0.0001 0.0007 233.2245 +YYCCC 949.267844 4 0.0004 1237 | 1/32
30 h-m-p 0.0001 0.0004 232.9041 YCCC 948.632620 3 0.0001 1277 | 1/32
31 h-m-p 0.0004 0.0030 83.2655 +YCC 947.180034 2 0.0011 1316 | 1/32
32 h-m-p 0.0002 0.0012 208.2722 YCCCC 945.259471 4 0.0006 1358 | 1/32
33 h-m-p 0.0003 0.0013 201.8244 CCC 944.518135 2 0.0003 1397 | 1/32
34 h-m-p 0.0003 0.0013 143.5093 CCCC 943.788376 3 0.0004 1438 | 1/32
35 h-m-p 0.0002 0.0010 54.1798 CCCC 943.620606 3 0.0003 1479 | 1/32
36 h-m-p 0.0009 0.0061 17.8370 CCC 943.535558 2 0.0008 1518 | 1/32
37 h-m-p 0.0012 0.0058 10.4976 YC 943.514572 1 0.0005 1554 | 1/32
38 h-m-p 0.0010 0.0261 5.1005 YC 943.470243 1 0.0022 1590 | 1/32
39 h-m-p 0.0017 0.0122 6.6645 YCC 943.429190 2 0.0012 1628 | 1/32
40 h-m-p 0.0008 0.0106 9.3998 CC 943.350775 1 0.0011 1665 | 1/32
41 h-m-p 0.0010 0.0244 9.8196 +YCCC 942.030613 3 0.0091 1706 | 1/32
42 h-m-p 0.0005 0.0023 62.5690 +YCYCC 940.582958 4 0.0013 1748 | 1/32
43 h-m-p 0.0008 0.0041 80.3623 +YYCCCC 936.151183 5 0.0026 1792 | 0/32
44 h-m-p 0.0002 0.0009 319.5957 CCCC 935.010510 3 0.0003 1833 | 0/32
45 h-m-p 0.0002 0.0010 123.1474 YCCCC 934.186451 4 0.0004 1875 | 0/32
46 h-m-p 0.0009 0.0043 33.8101 YCC 933.991195 2 0.0006 1913 | 0/32
47 h-m-p 0.0023 0.0114 3.9947 YC 933.985905 1 0.0004 1949 | 0/32
48 h-m-p 0.0008 0.0259 2.0988 +YCC 933.962767 2 0.0021 1988 | 0/32
49 h-m-p 0.0007 0.1266 6.4451 +++YCYCCC 928.137440 5 0.0876 2034 | 0/32
50 h-m-p 0.2837 1.4186 0.5685 YCCCC 926.360180 4 0.6164 2076 | 0/32
51 h-m-p 0.3953 1.9763 0.6445 YCCCC 923.207042 4 0.9185 2150 | 0/32
52 h-m-p 0.2683 1.3414 0.6725 YCCC 921.636032 3 0.6737 2222 | 0/32
53 h-m-p 0.3013 1.5065 0.6865 YCCCC 920.394232 4 0.5730 2296 | 0/32
54 h-m-p 0.4367 2.1836 0.5394 YCCC 919.409661 3 0.8377 2368 | 0/32
55 h-m-p 0.4536 2.2682 0.6025 YCCC 918.459784 3 0.9719 2440 | 0/32
56 h-m-p 1.1063 5.5315 0.5270 CCCC 917.614872 3 1.8579 2513 | 0/32
57 h-m-p 0.8388 4.1941 0.7093 CCCC 917.067007 3 1.1821 2586 | 0/32
58 h-m-p 0.5966 2.9829 0.6974 CCCC 916.753490 3 0.8442 2659 | 0/32
59 h-m-p 1.3268 8.0000 0.4437 CCC 916.562796 2 1.2929 2730 | 0/32
60 h-m-p 1.6000 8.0000 0.3120 YCC 916.485983 2 1.1251 2800 | 0/32
61 h-m-p 1.6000 8.0000 0.1435 CCC 916.437296 2 1.8344 2871 | 0/32
62 h-m-p 1.6000 8.0000 0.0108 CC 916.400991 1 2.3347 2940 | 0/32
63 h-m-p 1.1433 8.0000 0.0222 YC 916.375097 1 2.0346 3008 | 0/32
64 h-m-p 1.6000 8.0000 0.0052 +YC 916.310346 1 4.7617 3077 | 0/32
65 h-m-p 0.1911 8.0000 0.1295 ++YYC 916.211294 2 2.7101 3148 | 0/32
66 h-m-p 1.6000 8.0000 0.0640 CC 916.135015 1 2.1882 3217 | 0/32
67 h-m-p 1.6000 8.0000 0.0560 CC 916.088639 1 2.2215 3286 | 0/32
68 h-m-p 1.6000 8.0000 0.0292 YCC 916.023854 2 3.1762 3356 | 0/32
69 h-m-p 1.6000 8.0000 0.0124 YCCC 915.863450 3 3.3667 3428 | 0/32
70 h-m-p 1.2711 6.3556 0.0246 CYCCC 915.717677 4 2.0019 3502 | 0/32
71 h-m-p 0.1617 8.0000 0.3047 +YC 915.648653 1 1.1074 3571 | 0/32
72 h-m-p 1.5301 7.6505 0.1398 YCC 915.628705 2 1.0100 3641 | 0/32
73 h-m-p 1.6000 8.0000 0.0220 YC 915.625468 1 1.1027 3709 | 0/32
74 h-m-p 1.6000 8.0000 0.0058 CC 915.625056 1 1.2987 3778 | 0/32
75 h-m-p 1.6000 8.0000 0.0016 C 915.624998 0 1.3568 3845 | 0/32
76 h-m-p 1.6000 8.0000 0.0008 C 915.624987 0 1.3278 3912 | 0/32
77 h-m-p 1.0819 8.0000 0.0010 C 915.624986 0 1.4589 3979 | 0/32
78 h-m-p 1.6000 8.0000 0.0004 C 915.624986 0 1.6772 4046 | 0/32
79 h-m-p 1.6000 8.0000 0.0000 Y 915.624986 0 1.2742 4113 | 0/32
80 h-m-p 1.6000 8.0000 0.0000 C 915.624986 0 1.6000 4180 | 0/32
81 h-m-p 0.6603 8.0000 0.0000 Y 915.624986 0 0.3044 4247 | 0/32
82 h-m-p 0.2235 8.0000 0.0000 ----C 915.624986 0 0.0002 4318
Out..
lnL = -915.624986
4319 lfun, 4319 eigenQcodon, 129570 P(t)
Time used: 0:26
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
1 1.902820
2 0.649569
3 0.641535
4 0.640741
5 0.640682
6 0.640681
7 0.640681
0.023160 0.042757 0.120944 0.039448 0.065243 0.022155 0.022602 0.055377 0.338597 0.127133 0.108250 0.000000 0.040467 0.018847 0.082209 0.086489 0.025727 0.020130 0.018902 0.029851 0.020408 0.030602 0.022485 0.026193 0.029624 0.017956 0.013818 0.028989 0.011355 0.011597 8.949661 0.505928 0.395715
ntime & nrate & np: 30 2 33
Bounds (np=33):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 2.108608
np = 33
lnL0 = -952.040682
Iterating by ming2
Initial: fx= 952.040682
x= 0.02316 0.04276 0.12094 0.03945 0.06524 0.02216 0.02260 0.05538 0.33860 0.12713 0.10825 0.00000 0.04047 0.01885 0.08221 0.08649 0.02573 0.02013 0.01890 0.02985 0.02041 0.03060 0.02248 0.02619 0.02962 0.01796 0.01382 0.02899 0.01135 0.01160 8.94966 0.50593 0.39572
1 h-m-p 0.0000 0.0006 590.5758 +YYCCCC 949.630621 5 0.0001 47 | 0/33
2 h-m-p 0.0001 0.0005 171.6779 YCYCCC 944.866846 5 0.0003 91 | 0/33
3 h-m-p 0.0001 0.0006 102.6283 YCCCC 943.547426 4 0.0003 134 | 0/33
4 h-m-p 0.0001 0.0005 262.8131 +YYYYCCC 939.264482 6 0.0004 179 | 0/33
5 h-m-p 0.0000 0.0001 1455.9026 +YYYCCC 932.993170 5 0.0001 223 | 0/33
6 h-m-p 0.0000 0.0001 2073.3063 +YYCYCCC 925.022347 6 0.0001 269 | 0/33
7 h-m-p 0.0002 0.0008 96.0873 YCC 924.740774 2 0.0001 308 | 0/33
8 h-m-p 0.0004 0.0020 27.2817 CCCC 924.537793 3 0.0006 350 | 0/33
9 h-m-p 0.0001 0.0018 124.9275 YCC 924.201125 2 0.0003 389 | 0/33
10 h-m-p 0.0003 0.0015 76.1555 CCC 923.981723 2 0.0003 429 | 0/33
11 h-m-p 0.0002 0.0012 60.8562 CCC 923.855789 2 0.0003 469 | 0/33
12 h-m-p 0.0003 0.0017 33.9082 YYC 923.798343 2 0.0003 507 | 0/33
13 h-m-p 0.0004 0.0039 19.8515 CYC 923.756724 2 0.0004 546 | 0/33
14 h-m-p 0.0004 0.0037 18.3828 CC 923.719180 1 0.0004 584 | 0/33
15 h-m-p 0.0004 0.0055 20.4444 CC 923.678700 1 0.0004 622 | 0/33
16 h-m-p 0.0004 0.0024 24.6476 CYC 923.637969 2 0.0004 661 | 0/33
17 h-m-p 0.0004 0.0042 22.2108 CCC 923.578601 2 0.0005 701 | 0/33
18 h-m-p 0.0005 0.0036 25.6815 YC 923.528971 1 0.0004 738 | 0/33
19 h-m-p 0.0006 0.0051 14.8635 CCC 923.464397 2 0.0007 778 | 0/33
20 h-m-p 0.0008 0.0044 11.7013 CCCC 923.340067 3 0.0010 820 | 0/33
21 h-m-p 0.0006 0.0047 21.3953 YCCC 922.856406 3 0.0014 861 | 0/33
22 h-m-p 0.0007 0.0035 30.9716 +YCYCCC 921.260713 5 0.0020 906 | 0/33
23 h-m-p 0.0002 0.0011 129.7646 YCCCC 919.840882 4 0.0004 949 | 0/33
24 h-m-p 0.0003 0.0017 34.6272 YCCCC 919.312964 4 0.0007 992 | 0/33
25 h-m-p 0.0003 0.0013 56.7033 YCCCC 918.850141 4 0.0005 1035 | 0/33
26 h-m-p 0.0002 0.0011 73.9101 CCCC 918.584771 3 0.0003 1077 | 0/33
27 h-m-p 0.0008 0.0041 11.4247 CC 918.569752 1 0.0002 1115 | 0/33
28 h-m-p 0.0007 0.0183 3.8530 YC 918.553032 1 0.0014 1152 | 0/33
29 h-m-p 0.0003 0.0099 15.8165 +YC 918.509838 1 0.0009 1190 | 0/33
30 h-m-p 0.0009 0.0044 9.3643 YC 918.496486 1 0.0004 1227 | 0/33
31 h-m-p 0.0005 0.0803 7.3201 ++CC 918.221989 1 0.0083 1267 | 0/33
32 h-m-p 0.0014 0.0069 5.2726 CCCC 918.167352 3 0.0014 1309 | 0/33
33 h-m-p 0.0004 0.0139 20.5590 +CC 917.904036 1 0.0015 1348 | 0/33
34 h-m-p 0.0036 0.0460 8.7987 +YYC 916.617392 2 0.0121 1387 | 0/33
35 h-m-p 0.6346 4.0060 0.1680 CYCC 915.198559 3 0.8189 1428 | 0/33
36 h-m-p 0.8237 4.1185 0.1131 YYC 914.631418 2 0.6405 1499 | 0/33
37 h-m-p 0.5742 4.5240 0.1262 YCCC 914.106146 3 0.9976 1573 | 0/33
38 h-m-p 0.7047 3.5237 0.0785 YCCCC 913.718247 4 1.3174 1649 | 0/33
39 h-m-p 1.1197 5.5987 0.0148 CCC 913.610919 2 0.9326 1722 | 0/33
40 h-m-p 0.5961 8.0000 0.0232 YCCC 913.534993 3 1.1862 1796 | 0/33
41 h-m-p 1.2284 8.0000 0.0224 CCC 913.484328 2 1.7676 1869 | 0/33
42 h-m-p 1.6000 8.0000 0.0040 CC 913.451585 1 1.8436 1940 | 0/33
43 h-m-p 0.8167 8.0000 0.0091 YC 913.434631 1 1.5114 2010 | 0/33
44 h-m-p 1.4939 8.0000 0.0092 CC 913.425047 1 1.3486 2081 | 0/33
45 h-m-p 1.6000 8.0000 0.0024 YC 913.422210 1 1.1612 2151 | 0/33
46 h-m-p 0.9873 8.0000 0.0028 C 913.421804 0 1.0704 2220 | 0/33
47 h-m-p 1.0435 8.0000 0.0029 CC 913.421623 1 1.5726 2291 | 0/33
48 h-m-p 1.6000 8.0000 0.0024 C 913.421509 0 1.6260 2360 | 0/33
49 h-m-p 1.6000 8.0000 0.0014 Y 913.421488 0 1.0251 2429 | 0/33
50 h-m-p 1.6000 8.0000 0.0009 Y 913.421487 0 1.2265 2498 | 0/33
51 h-m-p 1.5696 8.0000 0.0007 C 913.421486 0 1.9624 2567 | 0/33
52 h-m-p 1.4354 8.0000 0.0009 C 913.421486 0 1.7946 2636 | 0/33
53 h-m-p 1.6000 8.0000 0.0008 Y 913.421485 0 1.2503 2705 | 0/33
54 h-m-p 1.6000 8.0000 0.0001 Y 913.421485 0 1.0601 2774 | 0/33
55 h-m-p 1.6000 8.0000 0.0000 C 913.421485 0 1.3457 2843 | 0/33
56 h-m-p 1.6000 8.0000 0.0000 Y 913.421485 0 0.8437 2912 | 0/33
57 h-m-p 1.6000 8.0000 0.0000 -Y 913.421485 0 0.1000 2982
Out..
lnL = -913.421485
2983 lfun, 8949 eigenQcodon, 178980 P(t)
Time used: 1:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
1 0.376105
2 0.229001
3 0.217099
4 0.214775
5 0.214607
6 0.214606
7 0.214606
initial w for M2:NSpselection reset.
0.024275 0.050205 0.125711 0.045300 0.062270 0.018789 0.018378 0.050818 0.376410 0.129556 0.127278 0.000000 0.043569 0.017839 0.085294 0.095875 0.010553 0.017753 0.008386 0.015288 0.018055 0.014997 0.010647 0.016189 0.018301 0.014686 0.010447 0.023801 0.017739 0.013190 9.447009 1.691300 0.190355 0.258734 2.577279
ntime & nrate & np: 30 3 35
Bounds (np=35):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.040285
np = 35
lnL0 = -940.047720
Iterating by ming2
Initial: fx= 940.047720
x= 0.02428 0.05020 0.12571 0.04530 0.06227 0.01879 0.01838 0.05082 0.37641 0.12956 0.12728 0.00000 0.04357 0.01784 0.08529 0.09588 0.01055 0.01775 0.00839 0.01529 0.01806 0.01500 0.01065 0.01619 0.01830 0.01469 0.01045 0.02380 0.01774 0.01319 9.44701 1.69130 0.19035 0.25873 2.57728
1 h-m-p 0.0000 0.0008 611.4990 +YYCCCC 936.229223 5 0.0001 49 | 0/35
2 h-m-p 0.0002 0.0008 110.0764 +YYCCCC 933.047640 5 0.0005 96 | 0/35
3 h-m-p 0.0002 0.0010 158.0331 +YYCCCC 928.730455 5 0.0007 143 | 0/35
4 h-m-p 0.0001 0.0004 367.9620 +YCYCCC 925.576491 5 0.0002 190 | 0/35
5 h-m-p 0.0002 0.0008 113.7590 YCCCC 924.561827 4 0.0003 235 | 0/35
6 h-m-p 0.0015 0.0086 24.9420 CCCC 923.900008 3 0.0024 279 | 0/35
7 h-m-p 0.0006 0.0029 89.5878 CYCC 923.528265 3 0.0005 322 | 0/35
8 h-m-p 0.0005 0.0024 63.1704 CCCC 923.139967 3 0.0008 366 | 0/35
9 h-m-p 0.0010 0.0110 46.3364 YCCC 923.015343 3 0.0004 409 | 0/35
10 h-m-p 0.0007 0.0075 30.1983 +CYCCC 922.435380 4 0.0033 455 | 0/35
11 h-m-p 0.0005 0.0033 196.5302 CCC 922.007541 2 0.0004 497 | 0/35
12 h-m-p 0.0005 0.0025 53.1150 CCCC 921.843018 3 0.0006 541 | 0/35
13 h-m-p 0.0009 0.0091 34.8673 CCCC 921.634638 3 0.0014 585 | 0/35
14 h-m-p 0.0006 0.0028 66.2878 CCCC 921.440099 3 0.0007 629 | 0/35
15 h-m-p 0.0008 0.0088 60.2894 +YCCC 920.931748 3 0.0022 673 | 0/35
16 h-m-p 0.0003 0.0017 164.8494 CCCC 920.578719 3 0.0006 717 | 0/35
17 h-m-p 0.0009 0.0045 99.6917 CCCC 920.156918 3 0.0012 761 | 0/35
18 h-m-p 0.0005 0.0029 234.4407 CCCC 919.501123 3 0.0008 805 | 0/35
19 h-m-p 0.0004 0.0021 284.6941 YCCCC 918.478162 4 0.0009 850 | 0/35
20 h-m-p 0.0002 0.0012 494.6883 CCCCC 917.838845 4 0.0004 896 | 0/35
21 h-m-p 0.0003 0.0017 125.2079 CCCC 917.641136 3 0.0005 940 | 0/35
22 h-m-p 0.0006 0.0031 64.2444 YCC 917.567599 2 0.0004 981 | 0/35
23 h-m-p 0.0010 0.0048 17.2780 CC 917.551976 1 0.0003 1021 | 0/35
24 h-m-p 0.0004 0.0081 13.2256 CC 917.532727 1 0.0006 1061 | 0/35
25 h-m-p 0.0007 0.0076 10.9477 YC 917.525975 1 0.0003 1100 | 0/35
26 h-m-p 0.0005 0.0219 7.1625 CC 917.516564 1 0.0007 1140 | 0/35
27 h-m-p 0.0008 0.0123 6.5851 YC 917.511781 1 0.0004 1179 | 0/35
28 h-m-p 0.0004 0.0355 6.6838 +CC 917.482558 1 0.0024 1220 | 0/35
29 h-m-p 0.0005 0.0075 29.8445 YCC 917.420277 2 0.0011 1261 | 0/35
30 h-m-p 0.0003 0.0041 105.2876 YCCC 917.307148 3 0.0006 1304 | 0/35
31 h-m-p 0.0010 0.0057 56.6778 CCCC 917.150555 3 0.0014 1348 | 0/35
32 h-m-p 0.0002 0.0031 390.7801 +YCCCCC 915.747978 5 0.0016 1396 | 0/35
33 h-m-p 0.0004 0.0021 282.7050 CCCC 915.459139 3 0.0005 1440 | 0/35
34 h-m-p 0.0717 0.3587 1.2530 ++ 914.060634 m 0.3587 1478 | 1/35
35 h-m-p 1.6000 8.0000 0.1162 CYCC 913.772657 3 0.5562 1521 | 1/35
36 h-m-p 0.5764 5.8641 0.1122 CYC 913.635984 2 0.7234 1596 | 1/35
37 h-m-p 1.3682 8.0000 0.0593 YYC 913.563593 2 1.1648 1670 | 1/35
38 h-m-p 0.6163 3.0816 0.0354 CCCC 913.472298 3 0.9109 1748 | 1/35
39 h-m-p 0.7708 5.3810 0.0418 CCC 913.430669 2 0.8433 1824 | 1/35
40 h-m-p 0.6296 8.0000 0.0560 C 913.422435 0 0.6144 1896 | 1/35
41 h-m-p 1.6000 8.0000 0.0058 YC 913.421611 1 0.7383 1969 | 1/35
42 h-m-p 1.4493 8.0000 0.0029 YC 913.421501 1 0.8628 2042 | 1/35
43 h-m-p 1.6000 8.0000 0.0015 Y 913.421489 0 0.6784 2114 | 1/35
44 h-m-p 1.0655 8.0000 0.0010 C 913.421487 0 0.9263 2186 | 1/35
45 h-m-p 0.9552 8.0000 0.0009 C 913.421487 0 1.1509 2258 | 1/35
46 h-m-p 0.9411 8.0000 0.0011 Y 913.421486 0 1.7953 2330 | 1/35
47 h-m-p 1.6000 8.0000 0.0013 Y 913.421486 0 1.0923 2402 | 1/35
48 h-m-p 1.6000 8.0000 0.0006 Y 913.421485 0 0.8932 2474 | 1/35
49 h-m-p 1.6000 8.0000 0.0001 Y 913.421485 0 0.7774 2546 | 1/35
50 h-m-p 1.6000 8.0000 0.0000 C 913.421485 0 0.4000 2618 | 1/35
51 h-m-p 0.7860 8.0000 0.0000 Y 913.421485 0 0.3272 2690 | 1/35
52 h-m-p 0.2562 8.0000 0.0000 C 913.421485 0 0.2562 2762 | 1/35
53 h-m-p 0.4319 8.0000 0.0000 ----------------.. | 1/35
54 h-m-p 0.0160 8.0000 0.0008 ------------- | 1/35
55 h-m-p 0.0160 8.0000 0.0008 -------------
Out..
lnL = -913.421485
3015 lfun, 12060 eigenQcodon, 271350 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -922.315887 S = -873.875684 -40.696948
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 79 patterns 1:56
did 20 / 79 patterns 1:56
did 30 / 79 patterns 1:56
did 40 / 79 patterns 1:56
did 50 / 79 patterns 1:56
did 60 / 79 patterns 1:56
did 70 / 79 patterns 1:56
did 79 / 79 patterns 1:56
Time used: 1:56
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
1 0.540976
2 0.370597
3 0.356755
4 0.355009
5 0.354461
6 0.354452
7 0.354450
8 0.354450
0.021492 0.046834 0.126387 0.042845 0.062674 0.021333 0.023254 0.045689 0.354832 0.122311 0.122885 0.000000 0.039690 0.016515 0.087138 0.096572 0.012770 0.020448 0.008934 0.023313 0.016023 0.014059 0.008777 0.020419 0.021681 0.015609 0.015936 0.032557 0.019938 0.013623 9.447008 0.501534 0.481712 0.067115 0.168885 0.217073
ntime & nrate & np: 30 4 36
Bounds (np=36):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 3.938193
np = 36
lnL0 = -921.333379
Iterating by ming2
Initial: fx= 921.333379
x= 0.02149 0.04683 0.12639 0.04284 0.06267 0.02133 0.02325 0.04569 0.35483 0.12231 0.12288 0.00000 0.03969 0.01652 0.08714 0.09657 0.01277 0.02045 0.00893 0.02331 0.01602 0.01406 0.00878 0.02042 0.02168 0.01561 0.01594 0.03256 0.01994 0.01362 9.44701 0.50153 0.48171 0.06711 0.16888 0.21707
1 h-m-p 0.0000 0.0005 340.0418 ++YYCC 916.733914 3 0.0001 83 | 0/36
2 h-m-p 0.0001 0.0005 107.3329 YCYCCC 915.380302 5 0.0002 166 | 0/36
3 h-m-p 0.0001 0.0005 64.5423 YCYCCC 915.019014 5 0.0002 249 | 0/36
4 h-m-p 0.0002 0.0008 76.1153 CCCCC 914.687757 4 0.0002 332 | 0/36
5 h-m-p 0.0002 0.0008 71.4939 +YC 913.957525 1 0.0007 409 | 0/36
6 h-m-p 0.0000 0.0000 131.0014 ++ 913.825610 m 0.0000 484 | 1/36
7 h-m-p 0.0000 0.0027 64.5146 +YC 913.687138 1 0.0003 561 | 1/36
8 h-m-p 0.0005 0.0023 48.2772 YCC 913.604898 2 0.0003 638 | 1/36
9 h-m-p 0.0004 0.0032 35.0960 CYC 913.538554 2 0.0004 715 | 1/36
10 h-m-p 0.0007 0.0050 20.6423 CC 913.518807 1 0.0003 791 | 1/36
11 h-m-p 0.0004 0.0188 12.1545 +YC 913.478080 1 0.0012 867 | 1/36
12 h-m-p 0.0006 0.0032 25.4810 YC 913.463065 1 0.0002 942 | 1/36
13 h-m-p 0.0005 0.0188 11.1485 +YC 913.426434 1 0.0016 1018 | 1/36
14 h-m-p 0.0003 0.0042 55.9215 YC 913.336532 1 0.0008 1093 | 1/36
15 h-m-p 0.0003 0.0023 149.0151 CCCC 913.204966 3 0.0004 1173 | 1/36
16 h-m-p 0.0007 0.0034 42.3703 YCC 913.170291 2 0.0004 1250 | 1/36
17 h-m-p 0.0002 0.0033 74.2435 YCCC 913.085064 3 0.0006 1329 | 1/36
18 h-m-p 0.0009 0.0044 30.4999 CC 913.070674 1 0.0003 1405 | 1/36
19 h-m-p 0.0004 0.0059 20.0619 C 913.057393 0 0.0004 1479 | 1/36
20 h-m-p 0.0005 0.0138 15.2088 CC 913.038696 1 0.0008 1555 | 1/36
21 h-m-p 0.0003 0.0066 35.8565 CC 913.021981 1 0.0003 1631 | 1/36
22 h-m-p 0.0006 0.0198 18.7675 CC 913.007544 1 0.0005 1707 | 1/36
23 h-m-p 0.0007 0.0046 14.3600 CC 913.003111 1 0.0002 1783 | 1/36
24 h-m-p 0.0005 0.0132 7.0303 CC 912.999331 1 0.0004 1859 | 1/36
25 h-m-p 0.0006 0.0209 4.9102 CC 912.994727 1 0.0008 1935 | 1/36
26 h-m-p 0.0003 0.0150 13.5275 CC 912.989230 1 0.0003 2011 | 1/36
27 h-m-p 0.0015 0.0386 3.0556 YC 912.978046 1 0.0028 2086 | 1/36
28 h-m-p 0.0002 0.0210 51.7283 +YC 912.875403 1 0.0016 2162 | 1/36
29 h-m-p 0.0007 0.0037 110.2691 CYCCC 912.679253 4 0.0013 2243 | 1/36
30 h-m-p 0.0002 0.0023 806.9564 CCCC 912.389149 3 0.0003 2323 | 1/36
31 h-m-p 0.0003 0.0015 106.1424 YYC 912.358215 2 0.0002 2399 | 1/36
32 h-m-p 0.0006 0.0171 39.2998 +YCC 912.274683 2 0.0016 2477 | 1/36
33 h-m-p 0.0014 0.0070 3.1174 -YC 912.274082 1 0.0002 2553 | 1/36
34 h-m-p 0.0047 2.3399 0.6317 +++CCC 911.971139 2 0.2852 2634 | 1/36
35 h-m-p 0.6499 3.2493 0.1962 YYC 911.874187 2 0.5486 2710 | 1/36
36 h-m-p 0.4428 6.0073 0.2430 CCCC 911.810033 3 0.6063 2790 | 1/36
37 h-m-p 1.2592 8.0000 0.1170 CCC 911.754903 2 1.7108 2868 | 1/36
38 h-m-p 1.6000 8.0000 0.1125 YYC 911.729754 2 1.3876 2944 | 1/36
39 h-m-p 1.6000 8.0000 0.0856 CC 911.715394 1 2.2672 3020 | 1/36
40 h-m-p 1.4786 8.0000 0.1312 CCC 911.702117 2 1.8749 3098 | 1/36
41 h-m-p 1.2080 8.0000 0.2036 YC 911.691792 1 0.9754 3173 | 1/36
42 h-m-p 1.4069 8.0000 0.1412 CC 911.685329 1 2.0079 3249 | 1/36
43 h-m-p 1.6000 8.0000 0.0671 C 911.683235 0 1.5674 3323 | 1/36
44 h-m-p 1.4626 8.0000 0.0719 CC 911.682262 1 1.7697 3399 | 1/36
45 h-m-p 1.6000 8.0000 0.0356 YC 911.681477 1 2.6900 3474 | 1/36
46 h-m-p 1.6000 8.0000 0.0252 C 911.681245 0 1.3630 3548 | 1/36
47 h-m-p 1.6000 8.0000 0.0050 Y 911.681234 0 1.0774 3622 | 1/36
48 h-m-p 1.6000 8.0000 0.0014 C 911.681233 0 1.5068 3696 | 1/36
49 h-m-p 1.0495 8.0000 0.0019 Y 911.681233 0 1.9259 3770 | 1/36
50 h-m-p 1.6000 8.0000 0.0004 Y 911.681233 0 1.2254 3844 | 1/36
51 h-m-p 1.6000 8.0000 0.0001 Y 911.681233 0 1.1610 3918 | 1/36
52 h-m-p 1.6000 8.0000 0.0000 Y 911.681233 0 0.7179 3992 | 1/36
53 h-m-p 1.6000 8.0000 0.0000 Y 911.681233 0 0.8470 4066 | 1/36
54 h-m-p 1.6000 8.0000 0.0000 C 911.681233 0 1.6000 4140 | 1/36
55 h-m-p 1.6000 8.0000 0.0000 C 911.681233 0 1.6000 4214 | 1/36
56 h-m-p 1.2420 8.0000 0.0000 ----C 911.681233 0 0.0012 4292
Out..
lnL = -911.681233
4293 lfun, 17172 eigenQcodon, 386370 P(t)
Time used: 3:14
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
1 0.438092
2 0.208664
3 0.198766
4 0.198441
5 0.198384
6 0.198376
7 0.198375
8 0.198375
0.025569 0.047115 0.124694 0.043504 0.065209 0.018124 0.018137 0.048096 0.382335 0.127887 0.125980 0.000000 0.041029 0.016503 0.085074 0.094548 0.010958 0.016037 0.008763 0.017300 0.018247 0.015165 0.007300 0.014274 0.014111 0.011913 0.012457 0.024945 0.014262 0.014287 9.103305 1.031212 1.979183
ntime & nrate & np: 30 1 33
Bounds (np=33):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 3.022641
np = 33
lnL0 = -926.867023
Iterating by ming2
Initial: fx= 926.867023
x= 0.02557 0.04712 0.12469 0.04350 0.06521 0.01812 0.01814 0.04810 0.38233 0.12789 0.12598 0.00000 0.04103 0.01650 0.08507 0.09455 0.01096 0.01604 0.00876 0.01730 0.01825 0.01517 0.00730 0.01427 0.01411 0.01191 0.01246 0.02495 0.01426 0.01429 9.10330 1.03121 1.97918
1 h-m-p 0.0000 0.0006 364.2119 ++YCYCCC 922.959402 5 0.0001 81 | 0/33
2 h-m-p 0.0001 0.0006 87.6571 YCYCCC 921.842826 5 0.0003 158 | 0/33
3 h-m-p 0.0002 0.0011 53.8100 CCCC 921.483222 3 0.0003 233 | 0/33
4 h-m-p 0.0004 0.0026 46.7637 CCC 921.278798 2 0.0003 306 | 0/33
5 h-m-p 0.0003 0.0032 60.9235 +YYCC 920.768379 3 0.0008 380 | 0/33
6 h-m-p 0.0006 0.0053 84.5783 +YCCC 919.649445 3 0.0014 455 | 0/33
7 h-m-p 0.0002 0.0012 138.6105 +YYCCCC 918.600206 5 0.0007 533 | 0/33
8 h-m-p 0.0002 0.0011 549.8269 +YCCCC 916.062884 4 0.0005 610 | 0/33
9 h-m-p 0.0002 0.0009 488.7114 CCCCC 915.017903 4 0.0002 687 | 0/33
10 h-m-p 0.0002 0.0012 127.2628 CCCC 914.654947 3 0.0003 762 | 0/33
11 h-m-p 0.0005 0.0025 78.6549 YCC 914.440886 2 0.0004 834 | 0/33
12 h-m-p 0.0006 0.0033 47.4422 YCC 914.301561 2 0.0005 906 | 0/33
13 h-m-p 0.0004 0.0021 40.5362 YC 914.252325 1 0.0002 976 | 0/33
14 h-m-p 0.0009 0.0060 9.4981 YC 914.240092 1 0.0004 1046 | 0/33
15 h-m-p 0.0003 0.0094 12.4195 YC 914.215429 1 0.0007 1116 | 0/33
16 h-m-p 0.0004 0.0045 20.0679 YCC 914.198616 2 0.0003 1188 | 0/33
17 h-m-p 0.0005 0.0168 13.5207 +YC 914.157530 1 0.0013 1259 | 0/33
18 h-m-p 0.0003 0.0036 54.8119 CC 914.105949 1 0.0004 1330 | 0/33
19 h-m-p 0.0004 0.0089 59.4148 +YYC 913.930542 2 0.0012 1402 | 0/33
20 h-m-p 0.0005 0.0025 74.4774 YC 913.888661 1 0.0002 1472 | 0/33
21 h-m-p 0.0004 0.0085 51.1778 +CCCC 913.638347 3 0.0021 1548 | 0/33
22 h-m-p 0.0002 0.0016 490.5313 CCC 913.232162 2 0.0004 1621 | 0/33
23 h-m-p 0.0003 0.0017 198.5335 CCCC 913.029571 3 0.0004 1696 | 0/33
24 h-m-p 0.0004 0.0020 238.3745 YYC 912.849807 2 0.0003 1767 | 0/33
25 h-m-p 0.0014 0.0070 24.0711 CCC 912.835946 2 0.0003 1840 | 0/33
26 h-m-p 0.0004 0.0096 18.2496 YC 912.811551 1 0.0007 1910 | 0/33
27 h-m-p 0.0005 0.0058 24.4673 YC 912.799156 1 0.0003 1980 | 0/33
28 h-m-p 0.0024 0.0147 2.8880 YC 912.797874 1 0.0004 2050 | 0/33
29 h-m-p 0.0003 0.0179 3.3515 CC 912.796842 1 0.0003 2121 | 0/33
30 h-m-p 0.0035 0.2134 0.2781 YC 912.790667 1 0.0070 2191 | 0/33
31 h-m-p 0.0002 0.0454 9.2122 ++CCC 912.590869 2 0.0049 2266 | 0/33
32 h-m-p 0.0008 0.0038 8.3709 CC 912.583746 1 0.0002 2337 | 0/33
33 h-m-p 0.0004 0.1343 3.7460 ++YCCC 912.335124 3 0.0144 2413 | 0/33
34 h-m-p 0.4055 8.0000 0.1327 +CC 912.225661 1 1.4016 2485 | 0/33
35 h-m-p 1.6000 8.0000 0.1071 CCC 912.157271 2 2.0881 2558 | 0/33
36 h-m-p 1.0331 8.0000 0.2165 YCCC 912.086498 3 2.0713 2632 | 0/33
37 h-m-p 1.6000 8.0000 0.1753 YYC 912.051002 2 1.3184 2703 | 0/33
38 h-m-p 1.6000 8.0000 0.0187 CCC 912.035291 2 1.5601 2776 | 0/33
39 h-m-p 0.3738 8.0000 0.0781 +YC 912.031689 1 0.9372 2847 | 0/33
40 h-m-p 1.6000 8.0000 0.0143 YC 912.031317 1 1.0426 2917 | 0/33
41 h-m-p 1.6000 8.0000 0.0089 C 912.031239 0 1.3852 2986 | 0/33
42 h-m-p 1.5235 8.0000 0.0081 C 912.031185 0 2.2823 3055 | 0/33
43 h-m-p 1.6000 8.0000 0.0094 C 912.031153 0 1.4410 3124 | 0/33
44 h-m-p 1.6000 8.0000 0.0019 Y 912.031149 0 0.9998 3193 | 0/33
45 h-m-p 1.6000 8.0000 0.0002 Y 912.031149 0 0.8625 3262 | 0/33
46 h-m-p 1.6000 8.0000 0.0000 Y 912.031149 0 0.7703 3331 | 0/33
47 h-m-p 1.6000 8.0000 0.0000 Y 912.031149 0 1.0282 3400 | 0/33
48 h-m-p 1.4765 8.0000 0.0000 Y 912.031149 0 1.0227 3469 | 0/33
49 h-m-p 1.6000 8.0000 0.0000 +Y 912.031149 0 6.4000 3539 | 0/33
50 h-m-p 1.1519 8.0000 0.0000 --------Y 912.031149 0 0.0000 3616
Out..
lnL = -912.031149
3617 lfun, 39787 eigenQcodon, 1085100 P(t)
Time used: 6:47
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
1 0.552538
2 0.277604
3 0.255360
4 0.251015
5 0.250028
6 0.249854
7 0.249853
8 0.249853
initial w for M8:NSbetaw>1 reset.
0.022052 0.048046 0.122351 0.046064 0.065290 0.021106 0.019638 0.051016 0.372337 0.125566 0.123153 0.000000 0.040328 0.021770 0.083158 0.093427 0.011235 0.013147 0.014088 0.018495 0.020756 0.016107 0.011354 0.011084 0.018255 0.012267 0.012273 0.025716 0.011531 0.013351 9.128344 0.900000 0.429434 1.778062 2.978184
ntime & nrate & np: 30 2 35
Bounds (np=35):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 2.585586
np = 35
lnL0 = -927.172579
Iterating by ming2
Initial: fx= 927.172579
x= 0.02205 0.04805 0.12235 0.04606 0.06529 0.02111 0.01964 0.05102 0.37234 0.12557 0.12315 0.00000 0.04033 0.02177 0.08316 0.09343 0.01123 0.01315 0.01409 0.01849 0.02076 0.01611 0.01135 0.01108 0.01825 0.01227 0.01227 0.02572 0.01153 0.01335 9.12834 0.90000 0.42943 1.77806 2.97818
1 h-m-p 0.0000 0.0008 341.3310 ++YYCCC 921.980394 4 0.0002 83 | 0/35
2 h-m-p 0.0001 0.0007 123.8476 ++ 915.933216 m 0.0007 156 | 1/35
3 h-m-p 0.0001 0.0006 101.7424 CCC 915.681682 2 0.0001 233 | 1/35
4 h-m-p 0.0002 0.0017 72.4703 CYC 915.462288 2 0.0002 308 | 1/35
5 h-m-p 0.0002 0.0026 67.9660 YC 915.102658 1 0.0004 381 | 1/35
6 h-m-p 0.0004 0.0022 33.7448 CC 914.958661 1 0.0004 455 | 1/35
7 h-m-p 0.0003 0.0025 55.1550 YCCC 914.702722 3 0.0005 532 | 1/35
8 h-m-p 0.0005 0.0024 55.8825 YC 914.560263 1 0.0003 605 | 1/35
9 h-m-p 0.0003 0.0040 55.8917 YC 914.335778 1 0.0006 678 | 1/35
10 h-m-p 0.0004 0.0021 62.1714 YCC 914.232082 2 0.0003 753 | 1/35
11 h-m-p 0.0005 0.0039 32.7840 CCC 914.123578 2 0.0005 829 | 1/35
12 h-m-p 0.0007 0.0086 25.2142 CCC 914.042793 2 0.0006 905 | 1/35
13 h-m-p 0.0004 0.0026 33.0564 YCC 913.978776 2 0.0003 980 | 1/35
14 h-m-p 0.0007 0.0034 15.2754 YCC 913.934038 2 0.0005 1055 | 1/35
15 h-m-p 0.0003 0.0030 27.1293 CCC 913.857466 2 0.0004 1131 | 1/35
16 h-m-p 0.0007 0.0082 15.4654 YCC 913.687956 2 0.0013 1206 | 1/35
17 h-m-p 0.0003 0.0016 45.4167 CCCC 913.528112 3 0.0004 1284 | 1/35
18 h-m-p 0.0005 0.0026 35.5204 CCCC 913.220586 3 0.0008 1362 | 1/35
19 h-m-p 0.0003 0.0015 33.7733 CCCC 913.028285 3 0.0005 1440 | 1/35
20 h-m-p 0.0002 0.0009 38.3069 C 912.956526 0 0.0002 1512 | 1/35
21 h-m-p 0.0009 0.0119 7.9059 CC 912.933634 1 0.0008 1586 | 1/35
22 h-m-p 0.0004 0.0041 14.9820 YC 912.920870 1 0.0003 1659 | 1/35
23 h-m-p 0.0006 0.0208 7.3172 YC 912.906480 1 0.0009 1732 | 1/35
24 h-m-p 0.0009 0.0060 7.3295 CC 912.903957 1 0.0002 1806 | 1/35
25 h-m-p 0.0006 0.0293 2.6007 YC 912.899770 1 0.0014 1879 | 1/35
26 h-m-p 0.0006 0.0324 5.8001 +CC 912.885466 1 0.0023 1954 | 1/35
27 h-m-p 0.0003 0.0070 38.0716 CC 912.873282 1 0.0003 2028 | 1/35
28 h-m-p 0.0014 0.0288 8.0341 YC 912.864212 1 0.0011 2101 | 1/35
29 h-m-p 0.0012 0.0114 7.0154 CC 912.860531 1 0.0005 2175 | 1/35
30 h-m-p 0.0002 0.0824 14.4705 ++YC 912.705334 1 0.0092 2250 | 1/35
31 h-m-p 0.0009 0.0046 67.4503 YCC 912.676743 2 0.0004 2325 | 1/35
32 h-m-p 0.0002 0.0160 109.5454 ++CCCCC 912.081329 4 0.0045 2407 | 1/35
33 h-m-p 0.0017 0.0086 3.1106 -CC 912.080990 1 0.0001 2482 | 1/35
34 h-m-p 0.0160 8.0000 0.1604 +++YCC 912.043664 2 0.8531 2560 | 1/35
35 h-m-p 1.6000 8.0000 0.0752 YC 912.034046 1 1.0311 2633 | 1/35
36 h-m-p 1.6000 8.0000 0.0351 CC 912.031835 1 1.3606 2707 | 1/35
37 h-m-p 1.6000 8.0000 0.0115 YC 912.031645 1 0.8546 2780 | 1/35
38 h-m-p 1.6000 8.0000 0.0030 Y 912.031631 0 1.2690 2852 | 1/35
39 h-m-p 1.1473 8.0000 0.0034 +Y 912.031615 0 3.6848 2925 | 1/35
40 h-m-p 1.6000 8.0000 0.0030 Y 912.031612 0 1.1098 2997 | 1/35
41 h-m-p 1.6000 8.0000 0.0005 Y 912.031611 0 1.2518 3069 | 1/35
42 h-m-p 1.4775 8.0000 0.0004 C 912.031611 0 1.5540 3141 | 1/35
43 h-m-p 1.6000 8.0000 0.0003 Y 912.031611 0 2.7147 3213 | 1/35
44 h-m-p 1.2832 8.0000 0.0006 ++ 912.031610 m 8.0000 3285 | 1/35
45 h-m-p 0.2007 8.0000 0.0229 ++C 912.031599 0 3.2896 3359 | 1/35
46 h-m-p 1.6000 8.0000 0.0465 ++ 912.031471 m 8.0000 3431 | 1/35
47 h-m-p 0.1076 8.0000 3.4569 ------------C 912.031471 0 0.0000 3515 | 1/35
48 h-m-p 0.0011 0.5280 1.2825 +++++ 912.031282 m 0.5280 3590 | 2/35
49 h-m-p 0.9774 8.0000 0.0252 C 912.031209 0 0.9900 3662 | 2/35
50 h-m-p 1.6000 8.0000 0.0001 Y 912.031209 0 0.7769 3733 | 2/35
51 h-m-p 1.6000 8.0000 0.0000 Y 912.031209 0 0.9695 3804 | 2/35
52 h-m-p 1.6000 8.0000 0.0000 C 912.031209 0 1.6000 3875 | 2/35
53 h-m-p 1.6000 8.0000 0.0000 -C 912.031209 0 0.1247 3947
Out..
lnL = -912.031209
3948 lfun, 47376 eigenQcodon, 1302840 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -920.601313 S = -874.234054 -39.580294
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 79 patterns 11:06
did 20 / 79 patterns 11:06
did 30 / 79 patterns 11:06
did 40 / 79 patterns 11:06
did 50 / 79 patterns 11:06
did 60 / 79 patterns 11:06
did 70 / 79 patterns 11:07
did 79 / 79 patterns 11:07
Time used: 11:07
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=22, Len=93
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr VEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr VEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQIMDLGHMCDATMS
gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr VEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKCYIQIMDLGHMCDATMS
gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYHMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYVQIMDLGHMCDATMS
gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCHIQIMDLGHMCDATMS
gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYHMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSTYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATNLGVNKCHVQIMDLGHMCDATMS
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFVTTLGVNKCHVQIMDLGHMCDATMS
.*:****.:*:*****.***:**** *.:*:***::**************
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSAWVVYVTCHHKKGEARRSRR
gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr YERPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRR
gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR
gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDIDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEAQRSRR
gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCQHKKGEARRSRR
gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHRKKGEARRSRR
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGETRRSRR
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
** ***********:***** **:**** **::****::****
>gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr GTGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr GTGGAGGTCACTAGACGTGGGAATGCATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACAATGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr GTGGAGGTCACCAGACGTGGGAGTGCATACTATATGTACTTAGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGGTGAATAAGT GTTACATACAGATCATGGATCTTGGACACATGTGTGATGCCACAATGAGC TATGAATGCCCTATGTTGGATGAGGGGGTAGAACCAGATGACGTCGATTG CTGGTGCAACACGACATCGACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAGGCACGGAGATCTAGAAGA >gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCGTACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACATATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATATCATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTTACATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGATAGAAA CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTTATGTACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGTAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAACGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACACTGGGGATGAATAAGT GTCATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGTCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAA CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG TTGGTGCAACATGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTATATGTACTTGGACAGAAA CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAGCTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGAAA CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACATCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGAAA CGATGCTGGGGAGGCCATATCTTTCCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACAGAGATCTAGAAGA >gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTGCATACCACATGTACTTGGACAGAAA CGATGCTGGGGAGGCCATATCTTTCCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTGGATGAGGGGGTGGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCATCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGGTCACTAGACGTGGGAGTACATACTATATGTACTTGGACAGAAG CGATGCTGGGGAGGCCATATCTTTTCCAACCACATTGGGGATGAATAAGT GTTATATACAGATCATGGATCTTGGACACATGTGTGATGCCACCATGAGC TATGAATGCCCTATGCTAGATGAGGGGGTAGAACCAGATGACGTCGATTG TTGGTGCAACACGACGTCAACTTGGGTTGTGTACGGAACCTGCCACCACA AAAAAGGTGAAGCACGGAGATCTAGAAGA >gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr GCGGAGATTACCAGACGTGGAAGTGCATACTACATGTACTTGGACAGGAG CGATGCTGGGAAGGCCATCTCCTTTGCTACCAACTTGGGAGTTAACAAAT GCCATGTACAGATCATGGATCTCGGGCACATGTGTGACGCCACCATGAGT TATGAGTGCCCTATGTTGGACGAGGGAGTGGAACCAGATGATGTCGATTG CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCACA AAAAAGGTGAAGCACGGCGATCTAGAAGA >gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr GCCGAGATCACTAGACGTGGGAGTGCATACTACATGTACTTGGACAGGAG CGATGCTGGTAAGGCCATTTCTTTTGCCACCACATTGGGGGTGAACAAAT GCCATGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT TATGAGTGCCCCATGCTAGACGAGGGAGTGGAGCCAGATGACGTCGATTG CTGGTGCAACACGACATCGACTTGGGTTGTGTACGGAACCTGTCATCATA AAAAAGGTGAAGCACGACGATCCAGAAGA >gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr GCCGAGATCACCAGACGTGGGAGTGCATACTACATGTACTTGGACAGGAG CGATGCTGGTAAGGCCATTTCTTTTGCTACCACATTGGGGGTGAACAAAT GCCATGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT TATGAGTGCCCCATGCTGGACGAGGGAGTGGAGCCAGATGACGTCGATTG CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCAACATA AAAAAGGTGAAGCACGACGATCCAGAAGA >gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGATAGGAG CGATGCCGGGAAGGCCATTTCGTTTGCTACCACATTGGGAGTGAACAAGT GCCACGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT TATGAGTGCCCTATGCTGGATGAGGGAGTGGAACCAGATGATGTCGATTG CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCGCA AAAAAGGTGAGGCACGGCGATCTAGAAGA >gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGATAGGAG CGATGCCGGGAAGGCCATTTCGTTTGCTACCACATTGGGAGTGAACAAGT GCCACGTACAGATCATGGACCTCGGGCACATGTGTGACGCCACCATGAGT TATGAGTGCCCTATGCTGGATGAGGGAGTGGAACCAGATGATGTCGATTG CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCACA AAAAAGGTGAGACACGGCGATCTAGAAGA >gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr GCAGAGATCACTAGACGCGGGAGTGCATACTACATGTACTTGGACAGGAG CGATGCTGGTAAGGCCATTTCTTTCGTTACCACACTGGGGGTGAACAAAT GCCATGTGCAGATCATGGACCTCGGGCATATGTGTGACGCCACCATGAGT TATGAGTGCCCCATGCTGGACGAGGGAGTGGAGCCAGATGACGTCGATTG CTGGTGCAACACGACATCAACTTGGGTTGTGTACGGAACCTGTCATCATA AAAAAGGTGAAGCACGACGATCCAGAAGA
>gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr VEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr VEVTRRGNAYYMYLDRSDAGEAISFPTTMGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr VEVTRRGSAYYMYLDRSDAGEAISFPTTLGVNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYHMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSAWVVYVTCHHKKGEARRSRR >gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YERPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR >gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRSDAGEAISFPTTLGMNKCHIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNMTSTWVVYGTCHHKKGEARRSRR >gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSAWVVYGTCHHKKGEARRSRR >gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDIDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEAQRSRR >gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSAYHMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr AEVTRRGSTYYMYLDRSDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATNLGVNKCHVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR >gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCQHKKGEARRSRR >gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHRKKGEARRSRR >gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFATTLGVNKCHVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGETRRSRR >gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr AEITRRGSAYYMYLDRSDAGKAISFVTTLGVNKCHVQIMDLGHMCDATMS YECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRR
Reading sequence file aligned.fasta
Allocating space for 22 taxa and 279 sites
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 7.1%
Found 53 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Using a window size of 100 with k as 19
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 48 polymorphic sites
p-Value(s)
----------
NSS: 6.59e-01 (1000 permutations)
Max Chi^2: 2.17e-01 (1000 permutations)
PHI (Permutation): 8.89e-01 (1000 permutations)
PHI (Normal): 8.78e-01
#NEXUS
[ID: 8231515016]
begin taxa;
dimensions ntax=22;
taxlabels
gb_KY241680|Organism_Zika_virus|Strain_Name_ZIKV-SG-010|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KU955593|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KX601167|Organism_Zika_virus|Strain_Name_ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY241691|Organism_Zika_virus|Strain_Name_ZIKV-SG-021|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KX051560|Organism_Zika_virus|Strain_Name_SK364/13AS|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY785451|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY241727|Organism_Zika_virus|Strain_Name_ZIKV-SG-057|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY241688|Organism_Zika_virus|Strain_Name_ZIKV-SG-018|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY241751|Organism_Zika_virus|Strain_Name_ZIKV-SG-081|Protein_Name_protein_pr|Gene_Symbol_pr
gb_LC219720|Organism_Zika_virus|Strain_Name_ZIKV/Hu/NIID123/2016|Protein_Name_protein_pr|Gene_Symbol_pr
gb_LC191864|Organism_Zika_virus|Strain_Name_ZIKV/Hu/Chiba/S36/2016|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KX811222|Organism_Zika_virus|Strain_Name_Brazil_2015_MG|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY785413|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY075935|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KY785468|Organism_Zika_virus|Strain_Name_Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KU179098|Organism_Zika_virus|Strain_Name_JMB-185|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KF268948|Organism_Zika_virus|Strain_Name_ARB13565|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KU955591|Organism_Zika_virus|Strain_Name_Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KF383116|Organism_Zika_virus|Strain_Name_ArD7117|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KX377335|Organism_Zika_virus|Strain_Name_MR-766|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KF383118|Organism_Zika_virus|Strain_Name_ArD157995|Protein_Name_protein_pr|Gene_Symbol_pr
gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_protein_pr|Gene_Symbol_pr
;
end;
begin trees;
translate
1 gb_KY241680|Organism_Zika_virus|Strain_Name_ZIKV-SG-010|Protein_Name_protein_pr|Gene_Symbol_pr,
2 gb_KU955593|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name_protein_pr|Gene_Symbol_pr,
3 gb_KX601167|Organism_Zika_virus|Strain_Name_ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name_protein_pr|Gene_Symbol_pr,
4 gb_KY241691|Organism_Zika_virus|Strain_Name_ZIKV-SG-021|Protein_Name_protein_pr|Gene_Symbol_pr,
5 gb_KX051560|Organism_Zika_virus|Strain_Name_SK364/13AS|Protein_Name_protein_pr|Gene_Symbol_pr,
6 gb_KY785451|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name_protein_pr|Gene_Symbol_pr,
7 gb_KY241727|Organism_Zika_virus|Strain_Name_ZIKV-SG-057|Protein_Name_protein_pr|Gene_Symbol_pr,
8 gb_KY241688|Organism_Zika_virus|Strain_Name_ZIKV-SG-018|Protein_Name_protein_pr|Gene_Symbol_pr,
9 gb_KY241751|Organism_Zika_virus|Strain_Name_ZIKV-SG-081|Protein_Name_protein_pr|Gene_Symbol_pr,
10 gb_LC219720|Organism_Zika_virus|Strain_Name_ZIKV/Hu/NIID123/2016|Protein_Name_protein_pr|Gene_Symbol_pr,
11 gb_LC191864|Organism_Zika_virus|Strain_Name_ZIKV/Hu/Chiba/S36/2016|Protein_Name_protein_pr|Gene_Symbol_pr,
12 gb_KX811222|Organism_Zika_virus|Strain_Name_Brazil_2015_MG|Protein_Name_protein_pr|Gene_Symbol_pr,
13 gb_KY785413|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name_protein_pr|Gene_Symbol_pr,
14 gb_KY075935|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name_protein_pr|Gene_Symbol_pr,
15 gb_KY785468|Organism_Zika_virus|Strain_Name_Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name_protein_pr|Gene_Symbol_pr,
16 gb_KU179098|Organism_Zika_virus|Strain_Name_JMB-185|Protein_Name_protein_pr|Gene_Symbol_pr,
17 gb_KF268948|Organism_Zika_virus|Strain_Name_ARB13565|Protein_Name_protein_pr|Gene_Symbol_pr,
18 gb_KU955591|Organism_Zika_virus|Strain_Name_Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name_protein_pr|Gene_Symbol_pr,
19 gb_KF383116|Organism_Zika_virus|Strain_Name_ArD7117|Protein_Name_protein_pr|Gene_Symbol_pr,
20 gb_KX377335|Organism_Zika_virus|Strain_Name_MR-766|Protein_Name_protein_pr|Gene_Symbol_pr,
21 gb_KF383118|Organism_Zika_virus|Strain_Name_ArD157995|Protein_Name_protein_pr|Gene_Symbol_pr,
22 gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_protein_pr|Gene_Symbol_pr
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.006351442,2:0.02566421,3:0.08465882,4:0.01829769,5:0.028513,7:0.01080489,10:0.01566682,16:0.02812311,(17:0.097163,((18:0.02521458,19:0.01784817)0.823:0.01573217,22:0.04591707)1.000:0.08035784,(20:0.01173943,21:0.01108289)0.998:0.06732258)1.000:0.3145398,(6:0.01114421,11:0.01100416,12:0.01073644,(13:0.01243056,(14:0.01192239,15:0.01105496)0.765:0.01227202)0.586:0.01115587)0.583:0.02377893,(8:0.01356042,9:0.01292086)0.575:0.01084031);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.006351442,2:0.02566421,3:0.08465882,4:0.01829769,5:0.028513,7:0.01080489,10:0.01566682,16:0.02812311,(17:0.097163,((18:0.02521458,19:0.01784817):0.01573217,22:0.04591707):0.08035784,(20:0.01173943,21:0.01108289):0.06732258):0.3145398,(6:0.01114421,11:0.01100416,12:0.01073644,(13:0.01243056,(14:0.01192239,15:0.01105496):0.01227202):0.01115587):0.02377893,(8:0.01356042,9:0.01292086):0.01084031);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -941.72 -979.63
2 -941.91 -984.24
--------------------------------------
TOTAL -941.81 -983.56
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.284241 0.071519 0.819832 1.798684 1.243649 533.06 719.34 1.002
r(A<->C){all} 0.052870 0.000491 0.014432 0.096465 0.050331 651.63 694.94 1.003
r(A<->G){all} 0.182709 0.003526 0.076589 0.300048 0.176887 362.76 393.55 1.000
r(A<->T){all} 0.016335 0.000170 0.000001 0.040703 0.013252 439.45 587.58 1.000
r(C<->G){all} 0.009389 0.000078 0.000003 0.026448 0.006890 744.40 819.67 1.000
r(C<->T){all} 0.716030 0.005516 0.565985 0.850447 0.720446 333.78 384.20 1.001
r(G<->T){all} 0.022666 0.000152 0.002607 0.047007 0.020660 362.65 614.03 1.000
pi(A){all} 0.261494 0.000570 0.216056 0.308144 0.260412 1076.43 1094.60 1.000
pi(C){all} 0.215484 0.000519 0.173447 0.261379 0.215106 513.09 822.57 1.000
pi(G){all} 0.290855 0.000629 0.239508 0.336884 0.291105 1099.73 1165.36 1.000
pi(T){all} 0.232167 0.000543 0.189275 0.279048 0.231033 968.25 1088.37 1.000
alpha{1,2} 0.160170 0.001649 0.091637 0.245280 0.155157 1114.69 1175.96 1.000
alpha{3} 1.655989 0.479472 0.530707 3.007114 1.530987 996.14 998.82 1.001
pinvar{all} 0.210514 0.009180 0.009376 0.365474 0.216725 893.98 927.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS1/ZikaADOPSresults/pr/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 22 ls = 93
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 2 3 2 3 | Cys TGT 3 3 2 3 3 3
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 3 3 4 3 3 3 | TGC 3 3 4 3 3 3
Leu TTA 0 0 1 0 0 0 | TCA 1 1 0 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 2 | TCG 0 0 1 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 0 1 2 1 1 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 2 3 2 1 3 2 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 1 1 2 2 1 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 1 2 2 2 | Asn AAT 1 2 1 1 1 1 | Ser AGT 1 0 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 2 | AGC 2 2 2 2 2 1
ATA 2 2 2 2 2 2 | ACA 1 1 3 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 5 5 5 5 5 5
Met ATG 6 7 5 6 6 6 | ACG 2 2 1 2 2 2 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 7 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 1 | GGC 0 0 0 0 0 0
GTA 1 1 1 1 1 0 | GCA 2 2 2 1 2 2 | Glu GAA 3 3 2 3 3 3 | GGA 2 2 2 2 2 2
GTG 2 2 3 1 1 2 | GCG 0 0 0 2 1 1 | GAG 3 3 4 3 3 3 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 2 3 3 | Cys TGT 3 3 3 4 3 3
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 3 3 2 2 3 3
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 2 1 1 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 0 0 1 0 0 0
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 1 1 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 1 1 2 2 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 2 2 | AGC 2 2 2 2 1 1
ATA 1 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 5 5 5 5 5 5
Met ATG 6 6 6 6 7 6 | ACG 2 2 2 2 1 2 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 2 2 1 1 2 | Asp GAT 6 6 6 6 6 6 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 2 2 1 1 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 3 3 3 3 3 3 | GGA 2 1 2 2 2 2
GTG 1 1 1 1 2 2 | GCG 1 1 1 1 1 1 | GAG 3 3 3 3 3 3 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 0 0 1 1 1 | Ser TCT 2 2 2 2 1 1 | Tyr TAT 2 2 2 3 1 1 | Cys TGT 3 3 3 3 2 2
TTC 0 1 1 0 0 0 | TCC 0 0 0 0 1 1 | TAC 4 4 3 3 4 4 | TGC 3 3 3 3 4 4
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 3 2 | TCG 0 0 0 0 0 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 0 0 | Pro CCT 1 1 1 1 1 0 | His CAT 1 1 1 0 2 3 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 1 1 | CCC 0 0 0 0 0 1 | CAC 2 2 3 3 2 1 | CGC 0 0 0 0 0 0
CTA 0 0 0 1 0 1 | CCA 2 2 2 2 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 1 2
CTG 1 1 1 0 0 0 | CCG 0 0 0 0 0 0 | CAG 1 2 1 1 1 1 | CGG 1 0 1 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 1 1 | Thr ACT 2 2 2 2 1 2 | Asn AAT 1 1 1 1 0 0 | Ser AGT 1 1 1 1 2 2
ATC 2 1 1 1 2 2 | ACC 3 3 3 3 4 3 | AAC 2 2 2 1 3 2 | AGC 1 1 1 2 1 1
ATA 2 2 2 2 0 0 | ACA 1 1 1 2 1 2 | Lys AAA 2 2 2 2 3 3 | Arg AGA 5 5 5 5 3 3
Met ATG 6 6 6 6 5 5 | ACG 2 2 2 2 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 2 1 | Ala GCT 1 1 1 1 2 1 | Asp GAT 6 6 6 6 5 3 | Gly GGT 1 1 1 1 1 2
GTC 1 2 2 2 1 1 | GCC 2 2 2 2 2 4 | GAC 2 2 2 2 3 5 | GGC 0 0 0 0 0 0
GTA 0 0 0 1 1 1 | GCA 2 2 2 1 2 2 | Glu GAA 3 3 3 3 2 1 | GGA 2 2 2 2 4 2
GTG 2 2 2 1 2 3 | GCG 1 1 1 1 1 0 | GAG 3 3 3 3 3 4 | GGG 4 4 4 4 2 3
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 0 | Ser TCT 1 1 1 1 | Tyr TAT 1 1 1 1 | Cys TGT 2 2 2 2
TTC 0 0 0 1 | TCC 1 0 0 1 | TAC 4 4 4 4 | TGC 4 4 4 4
Leu TTA 0 0 0 0 | TCA 1 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 2 2 1 | TCG 0 1 1 0 | TAG 0 0 0 0 | Trp TGG 2 2 2 2
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 0 1 1 0 | His CAT 2 1 1 4 | Arg CGT 1 0 0 0
CTC 1 1 1 1 | CCC 1 0 0 1 | CAC 1 2 3 0 | CGC 0 2 1 1
CTA 0 0 0 0 | CCA 1 1 1 1 | Gln CAA 1 0 0 0 | CGA 2 1 1 2
CTG 1 1 1 2 | CCG 0 0 0 0 | CAG 1 1 1 1 | CGG 0 1 1 0
------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 | Thr ACT 1 2 2 2 | Asn AAT 0 0 0 0 | Ser AGT 2 2 2 2
ATC 2 2 2 2 | ACC 4 3 3 3 | AAC 2 2 2 2 | AGC 1 1 1 1
ATA 0 0 0 0 | ACA 2 2 3 2 | Lys AAA 3 2 2 3 | Arg AGA 3 3 3 3
Met ATG 5 5 5 5 | ACG 1 1 1 1 | AAG 1 2 2 1 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 2 | Ala GCT 2 1 1 1 | Asp GAT 3 6 6 3 | Gly GGT 2 1 1 2
GTC 1 1 1 1 | GCC 3 3 3 2 | GAC 5 2 2 5 | GGC 0 0 0 0
GTA 1 1 1 0 | GCA 2 3 2 3 | Glu GAA 1 1 1 1 | GGA 2 3 3 2
GTG 3 3 3 4 | GCG 0 0 0 0 | GAG 4 4 4 4 | GGG 3 3 3 3
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.32258 G:0.34409
position 2: T:0.21505 C:0.20430 A:0.31183 G:0.26882
position 3: T:0.27957 C:0.22581 A:0.22581 G:0.26882
Average T:0.23297 C:0.18638 A:0.28674 G:0.29391
#2: gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.11828 A:0.33333 G:0.34409
position 2: T:0.21505 C:0.20430 A:0.32258 G:0.25806
position 3: T:0.26882 C:0.23656 A:0.22581 G:0.26882
Average T:0.22939 C:0.18638 A:0.29391 G:0.29032
#3: gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.31183 G:0.35484
position 2: T:0.21505 C:0.20430 A:0.31183 G:0.26882
position 3: T:0.24731 C:0.24731 A:0.23656 G:0.26882
Average T:0.22581 C:0.18996 A:0.28674 G:0.29749
#4: gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.29032 C:0.21505 A:0.21505 G:0.27957
Average T:0.23297 C:0.18638 A:0.28315 G:0.29749
#5: gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.19355 C:0.13978 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.26882 C:0.23656 A:0.22581 G:0.26882
Average T:0.22222 C:0.19713 A:0.28674 G:0.29391
#6: gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.32258 G:0.25806
position 3: T:0.29032 C:0.21505 A:0.21505 G:0.27957
Average T:0.23656 C:0.18280 A:0.28674 G:0.29391
#7: gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.27957 C:0.22581 A:0.22581 G:0.26882
Average T:0.22939 C:0.18996 A:0.28315 G:0.29749
#8: gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.31183 G:0.35484
position 2: T:0.21505 C:0.21505 A:0.31183 G:0.25806
position 3: T:0.27957 C:0.22581 A:0.22581 G:0.26882
Average T:0.23297 C:0.18996 A:0.28315 G:0.29391
#9: gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.19355 C:0.13978 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.27957 C:0.22581 A:0.22581 G:0.26882
Average T:0.22581 C:0.19355 A:0.28315 G:0.29749
#10: gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.19355 C:0.13978 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.29032 C:0.21505 A:0.22581 G:0.26882
Average T:0.22939 C:0.18996 A:0.28674 G:0.29391
#11: gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.32258 G:0.34409
position 2: T:0.21505 C:0.20430 A:0.32258 G:0.25806
position 3: T:0.27957 C:0.22581 A:0.21505 G:0.27957
Average T:0.23656 C:0.18280 A:0.28674 G:0.29391
#12: gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.21505 A:0.32258 G:0.25806
position 3: T:0.27957 C:0.22581 A:0.21505 G:0.27957
Average T:0.23297 C:0.18638 A:0.28315 G:0.29749
#13: gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.33333 G:0.33333
position 2: T:0.20430 C:0.21505 A:0.32258 G:0.25806
position 3: T:0.26882 C:0.23656 A:0.21505 G:0.27957
Average T:0.22939 C:0.18996 A:0.29032 G:0.29032
#14: gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.33333 G:0.24731
position 3: T:0.25806 C:0.24731 A:0.21505 G:0.27957
Average T:0.22581 C:0.19355 A:0.29032 G:0.29032
#15: gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.32258 G:0.25806
position 3: T:0.25806 C:0.24731 A:0.21505 G:0.27957
Average T:0.22222 C:0.19713 A:0.28674 G:0.29391
#16: gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.33333 G:0.33333
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.26882 C:0.23656 A:0.23656 G:0.25806
Average T:0.22939 C:0.18996 A:0.29391 G:0.28674
#17: gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.21505 C:0.11828 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.20430 A:0.32258 G:0.26882
position 3: T:0.24731 C:0.30108 A:0.20430 G:0.24731
Average T:0.22222 C:0.20789 A:0.27957 G:0.29032
#18: gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.22581 C:0.32258 A:0.19355 G:0.25806
Average T:0.21147 C:0.22222 A:0.27240 G:0.29391
#19: gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.21505 C:0.32258 A:0.20430 G:0.25806
Average T:0.20789 C:0.22222 A:0.27599 G:0.29391
#20: gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.31183 G:0.35484
position 2: T:0.20430 C:0.21505 A:0.30108 G:0.27957
position 3: T:0.22581 C:0.29032 A:0.19355 G:0.29032
Average T:0.21147 C:0.21147 A:0.26882 G:0.30824
#21: gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.20430 C:0.12903 A:0.32258 G:0.34409
position 2: T:0.20430 C:0.21505 A:0.31183 G:0.26882
position 3: T:0.22581 C:0.29032 A:0.19355 G:0.29032
Average T:0.21147 C:0.21147 A:0.27599 G:0.30108
#22: gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr
position 1: T:0.19355 C:0.13978 A:0.31183 G:0.35484
position 2: T:0.21505 C:0.20430 A:0.31183 G:0.26882
position 3: T:0.22581 C:0.31183 A:0.19355 G:0.26882
Average T:0.21147 C:0.21864 A:0.27240 G:0.29749
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 19 | Ser S TCT 38 | Tyr Y TAT 48 | Cys C TGT 60
TTC 3 | TCC 4 | TAC 75 | TGC 71
Leu L TTA 1 | TCA 20 | *** * TAA 0 | *** * TGA 0
TTG 35 | TCG 4 | TAG 0 | Trp W TGG 44
------------------------------------------------------------------------------
Leu L CTT 16 | Pro P CCT 19 | His H CAT 29 | Arg R CGT 19
CTC 6 | CCC 3 | CAC 44 | CGC 5
CTA 2 | CCA 38 | Gln Q CAA 1 | CGA 9
CTG 27 | CCG 0 | CAG 23 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 38 | Asn N AAT 17 | Ser S AGT 27
ATC 29 | ACC 68 | AAC 35 | AGC 32
ATA 31 | ACA 31 | Lys K AAA 48 | Arg R AGA 98
Met M ATG 127 | ACG 36 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 27 | Asp D GAT 123 | Gly G GGT 25
GTC 37 | GCC 49 | GAC 53 | GGC 0
GTA 17 | GCA 44 | Glu E GAA 54 | GGA 47
GTG 44 | GCG 15 | GAG 72 | GGG 81
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20626 C:0.12659 A:0.31916 G:0.34800
position 2: T:0.20723 C:0.21212 A:0.31574 G:0.26491
position 3: T:0.26149 C:0.25122 A:0.21554 G:0.27175
Average T:0.22499 C:0.19664 A:0.28348 G:0.29488
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr 0.5371 (0.0092 0.0171)
gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr 0.0275 (0.0046 0.1667) 0.0725 (0.0138 0.1902)
gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr 0.1344 (0.0046 0.0341) 0.2632 (0.0138 0.0524) 0.0439 (0.0092 0.2093)
gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr 0.1773 (0.0092 0.0518) 0.5333 (0.0184 0.0345) 0.0736 (0.0138 0.1880) 0.0518 (0.0046 0.0884)
gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr 0.1764 (0.0092 0.0520) 0.3495 (0.0184 0.0527) 0.0593 (0.0138 0.2330) 0.0515 (0.0046 0.0888) 0.0849 (0.0092 0.1081)
gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr -1.0000 (0.0092 0.0000) 1.0850 (0.0184 0.0170) 0.0834 (0.0139 0.1661) 0.1349 (0.0046 0.0340) 0.1780 (0.0092 0.0516) 0.1771 (0.0092 0.0519)
gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr -1.0000 (0.0138 0.0000) 1.3542 (0.0231 0.0171) 0.1110 (0.0185 0.1668) 0.2693 (0.0092 0.0341) 0.2666 (0.0138 0.0518) 0.2652 (0.0138 0.0520)-1.0000 (0.0138 0.0000)
gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr -1.0000 (0.0138 0.0000) 1.3645 (0.0231 0.0170) 0.1119 (0.0185 0.1657) 0.2714 (0.0092 0.0339) 0.2686 (0.0138 0.0515) 0.2672 (0.0138 0.0517)-1.0000 (0.0139 0.0000)-1.0000 (0.0092 0.0000)
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr 0.5444 (0.0092 0.0169) 0.5333 (0.0184 0.0345) 0.0736 (0.0138 0.1880) 0.0884 (0.0046 0.0518) 0.1312 (0.0092 0.0700) 0.1305 (0.0092 0.0703) 0.5465 (0.0092 0.0168) 0.8185 (0.0138 0.0169) 0.8246 (0.0138 0.0168)
gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr 0.3982 (0.0138 0.0346) 0.6576 (0.0230 0.0350) 0.0867 (0.0184 0.2127) 0.1292 (0.0092 0.0708) 0.1534 (0.0138 0.0898) 0.2651 (0.0046 0.0172) 0.3998 (0.0138 0.0345) 0.5322 (0.0184 0.0346) 0.5363 (0.0184 0.0344) 0.2619 (0.0138 0.0526)
gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr 0.4028 (0.0138 0.0343) 0.6653 (0.0231 0.0347) 0.0878 (0.0185 0.2106) 0.1307 (0.0092 0.0702) 0.1552 (0.0138 0.0889) 0.2682 (0.0046 0.0170) 0.4044 (0.0138 0.0342) 0.2675 (0.0092 0.0343) 0.2695 (0.0092 0.0341) 0.2650 (0.0138 0.0521)-1.0000 (0.0091 0.0000)
gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr 0.2644 (0.0138 0.0522) 0.4366 (0.0231 0.0528) 0.0790 (0.0185 0.2338) 0.1029 (0.0092 0.0891) 0.1272 (0.0138 0.1084) 0.1320 (0.0046 0.0346) 0.2654 (0.0138 0.0520) 0.3533 (0.0184 0.0522) 0.3561 (0.0185 0.0519) 0.1956 (0.0138 0.0705) 0.5298 (0.0091 0.0172) 0.5359 (0.0092 0.0171)
gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr 0.1946 (0.0138 0.0708) 0.3212 (0.0230 0.0717) 0.0713 (0.0184 0.2587) 0.0841 (0.0092 0.1089) 0.1069 (0.0138 0.1288) 0.0864 (0.0046 0.0528) 0.1953 (0.0138 0.0706) 0.2600 (0.0184 0.0708) 0.2621 (0.0185 0.0704) 0.1535 (0.0138 0.0897) 0.2600 (0.0091 0.0351) 0.2631 (0.0091 0.0348) 0.5303 (0.0091 0.0172)
gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr 0.1964 (0.0138 0.0703) 0.3242 (0.0231 0.0712) 0.0720 (0.0185 0.2565) 0.0849 (0.0092 0.1081) 0.0357 (0.0046 0.1279) 0.0872 (0.0046 0.0524) 0.1971 (0.0138 0.0701) 0.2624 (0.0185 0.0703) 0.2645 (0.0185 0.0699) 0.1549 (0.0138 0.0890) 0.2624 (0.0091 0.0348) 0.2655 (0.0092 0.0345) 0.5351 (0.0092 0.0171)-1.0000 (0.0091 0.0000)
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr 0.1764 (0.0092 0.0520) 1.0735 (0.0184 0.0171) 0.0593 (0.0138 0.2330) 0.0515 (0.0046 0.0888) 0.1305 (0.0092 0.0703) 0.1298 (0.0092 0.0706) 0.1771 (0.0092 0.0519) 0.2652 (0.0138 0.0520) 0.2672 (0.0138 0.0517) 0.1305 (0.0092 0.0703) 0.2605 (0.0138 0.0528) 0.2636 (0.0138 0.0523) 0.1946 (0.0138 0.0708) 0.1527 (0.0138 0.0901) 0.1541 (0.0138 0.0894)
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr 0.0576 (0.0422 0.7327) 0.0693 (0.0518 0.7476) 0.0440 (0.0351 0.7973) 0.0452 (0.0374 0.8271) 0.0479 (0.0422 0.8813) 0.0606 (0.0422 0.6956) 0.0448 (0.0327 0.7291) 0.0642 (0.0471 0.7335) 0.0649 (0.0472 0.7263) 0.0472 (0.0326 0.6910) 0.0707 (0.0469 0.6637) 0.0719 (0.0470 0.6543) 0.0760 (0.0470 0.6180) 0.0707 (0.0469 0.6630) 0.0717 (0.0470 0.6556) 0.0537 (0.0422 0.7857)
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr 0.0403 (0.0327 0.8126) 0.0509 (0.0422 0.8300) 0.0289 (0.0280 0.9687) 0.0305 (0.0280 0.9173) 0.0335 (0.0327 0.9783) 0.0423 (0.0327 0.7722) 0.0288 (0.0233 0.8084) 0.0461 (0.0375 0.8135) 0.0467 (0.0376 0.8051) 0.0303 (0.0232 0.7669) 0.0507 (0.0374 0.7379) 0.0515 (0.0375 0.7270) 0.0544 (0.0374 0.6877) 0.0507 (0.0374 0.7372) 0.0514 (0.0375 0.7286) 0.0423 (0.0327 0.7722) 0.0152 (0.0069 0.4526)
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr 0.0492 (0.0375 0.7636) 0.0642 (0.0471 0.7335) 0.0361 (0.0328 0.9088) 0.0380 (0.0327 0.8611) 0.0435 (0.0375 0.8631) 0.0517 (0.0375 0.7255) 0.0369 (0.0280 0.7598) 0.0554 (0.0424 0.7644) 0.0561 (0.0424 0.7568) 0.0388 (0.0280 0.7207) 0.0609 (0.0422 0.6929) 0.0619 (0.0423 0.6830) 0.0655 (0.0423 0.6458) 0.0610 (0.0422 0.6922) 0.0618 (0.0423 0.6844) 0.0487 (0.0375 0.7705) 0.0339 (0.0115 0.3397) 0.0670 (0.0046 0.0686)
gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr 0.0528 (0.0376 0.7123) 0.0649 (0.0472 0.7263) 0.0437 (0.0328 0.7514) 0.0409 (0.0328 0.8024) 0.0496 (0.0376 0.7576) 0.0627 (0.0376 0.5993) 0.0396 (0.0280 0.7089) 0.0595 (0.0424 0.7130) 0.0602 (0.0425 0.7062) 0.0417 (0.0280 0.6723) 0.0655 (0.0423 0.6458) 0.0665 (0.0424 0.6370) 0.0703 (0.0423 0.6020) 0.0655 (0.0423 0.6452) 0.0664 (0.0424 0.6382) 0.0492 (0.0376 0.7627) 0.0342 (0.0115 0.3372) 0.0108 (0.0046 0.4279) 0.0249 (0.0092 0.3717)
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr 0.0522 (0.0375 0.7192) 0.0642 (0.0471 0.7335) 0.0432 (0.0328 0.7589) 0.0404 (0.0327 0.8108) 0.0490 (0.0375 0.7652) 0.0620 (0.0375 0.6047) 0.0391 (0.0280 0.7157) 0.0588 (0.0424 0.7200) 0.0595 (0.0424 0.7130) 0.0412 (0.0280 0.6787) 0.0647 (0.0422 0.6519) 0.0658 (0.0423 0.6428) 0.0696 (0.0423 0.6074) 0.0648 (0.0422 0.6512) 0.0657 (0.0423 0.6441) 0.0487 (0.0375 0.7705) 0.0339 (0.0115 0.3397) 0.0107 (0.0046 0.4312) 0.0247 (0.0092 0.3745)-1.0000 (0.0092 0.0000)
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr 0.0483 (0.0400 0.8286) 0.0551 (0.0496 0.8997) 0.0314 (0.0352 1.1208) 0.0425 (0.0352 0.8286) 0.0401 (0.0400 0.9972) 0.0450 (0.0399 0.8887) 0.0330 (0.0280 0.8493) 0.0541 (0.0448 0.8296) 0.0547 (0.0449 0.8209) 0.0388 (0.0304 0.7823) 0.0526 (0.0447 0.8501) 0.0535 (0.0448 0.8365) 0.0565 (0.0448 0.7917) 0.0594 (0.0447 0.7522) 0.0602 (0.0448 0.7434) 0.0397 (0.0399 1.0054) 0.0226 (0.0115 0.5116) 0.0282 (0.0046 0.1635) 0.0747 (0.0092 0.1238) 0.0234 (0.0093 0.3966) 0.0231 (0.0092 0.3996)
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
lnL(ntime: 30 np: 32): -915.624986 +0.000000
23..1 23..2 23..3 23..4 23..5 23..7 23..10 23..16 23..24 24..17 24..25 25..26 26..18 26..19 25..22 24..27 27..20 27..21 23..28 28..6 28..11 28..12 28..29 29..13 29..30 30..14 30..15 23..31 31..8 31..9
0.011335 0.046495 0.134312 0.022833 0.046301 0.011290 0.022849 0.046307 0.399921 0.142173 0.104155 0.011404 0.034237 0.022494 0.071611 0.099381 0.011313 0.011246 0.034457 0.011334 0.011374 0.011329 0.011318 0.011469 0.011333 0.011402 0.011396 0.011327 0.011379 0.011341 8.949661 0.134229
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.40912
(1: 0.011335, 2: 0.046495, 3: 0.134312, 4: 0.022833, 5: 0.046301, 7: 0.011290, 10: 0.022849, 16: 0.046307, (17: 0.142173, ((18: 0.034237, 19: 0.022494): 0.011404, 22: 0.071611): 0.104155, (20: 0.011313, 21: 0.011246): 0.099381): 0.399921, (6: 0.011334, 11: 0.011374, 12: 0.011329, (13: 0.011469, (14: 0.011402, 15: 0.011396): 0.011333): 0.011318): 0.034457, (8: 0.011379, 9: 0.011341): 0.011327);
(gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011335, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr: 0.046495, gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr: 0.134312, gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr: 0.022833, gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.046301, gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011290, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.022849, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr: 0.046307, (gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr: 0.142173, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr: 0.034237, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr: 0.022494): 0.011404, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr: 0.071611): 0.104155, (gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011313, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011246): 0.099381): 0.399921, (gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011334, gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011374, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011329, (gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011469, (gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011402, gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011396): 0.011333): 0.011318): 0.034457, (gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011379, gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011341): 0.011327);
Detailed output identifying parameters
kappa (ts/tv) = 8.94966
omega (dN/dS) = 0.13423
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
23..1 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
23..2 0.046 194.3 84.7 0.1342 0.0052 0.0390 1.0 3.3
23..3 0.134 194.3 84.7 0.1342 0.0151 0.1127 2.9 9.6
23..4 0.023 194.3 84.7 0.1342 0.0026 0.0192 0.5 1.6
23..5 0.046 194.3 84.7 0.1342 0.0052 0.0389 1.0 3.3
23..7 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
23..10 0.023 194.3 84.7 0.1342 0.0026 0.0192 0.5 1.6
23..16 0.046 194.3 84.7 0.1342 0.0052 0.0389 1.0 3.3
23..24 0.400 194.3 84.7 0.1342 0.0451 0.3356 8.8 28.4
24..17 0.142 194.3 84.7 0.1342 0.0160 0.1193 3.1 10.1
24..25 0.104 194.3 84.7 0.1342 0.0117 0.0874 2.3 7.4
25..26 0.011 194.3 84.7 0.1342 0.0013 0.0096 0.2 0.8
26..18 0.034 194.3 84.7 0.1342 0.0039 0.0287 0.7 2.4
26..19 0.022 194.3 84.7 0.1342 0.0025 0.0189 0.5 1.6
25..22 0.072 194.3 84.7 0.1342 0.0081 0.0601 1.6 5.1
24..27 0.099 194.3 84.7 0.1342 0.0112 0.0834 2.2 7.1
27..20 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
27..21 0.011 194.3 84.7 0.1342 0.0013 0.0094 0.2 0.8
23..28 0.034 194.3 84.7 0.1342 0.0039 0.0289 0.8 2.5
28..6 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
28..11 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
28..12 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
28..29 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
29..13 0.011 194.3 84.7 0.1342 0.0013 0.0096 0.3 0.8
29..30 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
30..14 0.011 194.3 84.7 0.1342 0.0013 0.0096 0.2 0.8
30..15 0.011 194.3 84.7 0.1342 0.0013 0.0096 0.2 0.8
23..31 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
31..8 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
31..9 0.011 194.3 84.7 0.1342 0.0013 0.0095 0.2 0.8
tree length for dN: 0.1587
tree length for dS: 1.1826
Time used: 0:26
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
lnL(ntime: 30 np: 33): -913.421485 +0.000000
23..1 23..2 23..3 23..4 23..5 23..7 23..10 23..16 23..24 24..17 24..25 25..26 26..18 26..19 25..22 24..27 27..20 27..21 23..28 28..6 28..11 28..12 28..29 29..13 29..30 30..14 30..15 23..31 31..8 31..9
0.011561 0.047342 0.137614 0.023285 0.047250 0.011542 0.023300 0.047243 0.416952 0.146040 0.106394 0.011966 0.035036 0.023035 0.072975 0.101726 0.011617 0.011476 0.035147 0.011551 0.011585 0.011545 0.011547 0.011676 0.011634 0.011674 0.011564 0.011504 0.011685 0.011616 9.447009 0.889895 0.074727
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.44908
(1: 0.011561, 2: 0.047342, 3: 0.137614, 4: 0.023285, 5: 0.047250, 7: 0.011542, 10: 0.023300, 16: 0.047243, (17: 0.146040, ((18: 0.035036, 19: 0.023035): 0.011966, 22: 0.072975): 0.106394, (20: 0.011617, 21: 0.011476): 0.101726): 0.416952, (6: 0.011551, 11: 0.011585, 12: 0.011545, (13: 0.011676, (14: 0.011674, 15: 0.011564): 0.011634): 0.011547): 0.035147, (8: 0.011685, 9: 0.011616): 0.011504);
(gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011561, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047342, gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr: 0.137614, gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023285, gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047250, gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011542, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023300, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047243, (gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr: 0.146040, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr: 0.035036, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023035): 0.011966, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr: 0.072975): 0.106394, (gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011617, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011476): 0.101726): 0.416952, (gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011551, gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011585, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011545, (gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011676, (gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011674, gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011564): 0.011634): 0.011547): 0.035147, (gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011685, gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011616): 0.011504);
Detailed output identifying parameters
kappa (ts/tv) = 9.44701
dN/dS (w) for site classes (K=2)
p: 0.88989 0.11011
w: 0.07473 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
23..1 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
23..2 0.047 193.9 85.1 0.1766 0.0065 0.0369 1.3 3.1
23..3 0.138 193.9 85.1 0.1766 0.0189 0.1073 3.7 9.1
23..4 0.023 193.9 85.1 0.1766 0.0032 0.0181 0.6 1.5
23..5 0.047 193.9 85.1 0.1766 0.0065 0.0368 1.3 3.1
23..7 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
23..10 0.023 193.9 85.1 0.1766 0.0032 0.0182 0.6 1.5
23..16 0.047 193.9 85.1 0.1766 0.0065 0.0368 1.3 3.1
23..24 0.417 193.9 85.1 0.1766 0.0574 0.3250 11.1 27.6
24..17 0.146 193.9 85.1 0.1766 0.0201 0.1138 3.9 9.7
24..25 0.106 193.9 85.1 0.1766 0.0146 0.0829 2.8 7.1
25..26 0.012 193.9 85.1 0.1766 0.0016 0.0093 0.3 0.8
26..18 0.035 193.9 85.1 0.1766 0.0048 0.0273 0.9 2.3
26..19 0.023 193.9 85.1 0.1766 0.0032 0.0180 0.6 1.5
25..22 0.073 193.9 85.1 0.1766 0.0100 0.0569 1.9 4.8
24..27 0.102 193.9 85.1 0.1766 0.0140 0.0793 2.7 6.7
27..20 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
27..21 0.011 193.9 85.1 0.1766 0.0016 0.0089 0.3 0.8
23..28 0.035 193.9 85.1 0.1766 0.0048 0.0274 0.9 2.3
28..6 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
28..11 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
28..12 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
28..29 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
29..13 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
29..30 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
30..14 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
30..15 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
23..31 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
31..8 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
31..9 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
Time used: 1:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
check convergence..
lnL(ntime: 30 np: 35): -913.421485 +0.000000
23..1 23..2 23..3 23..4 23..5 23..7 23..10 23..16 23..24 24..17 24..25 25..26 26..18 26..19 25..22 24..27 27..20 27..21 23..28 28..6 28..11 28..12 28..29 29..13 29..30 30..14 30..15 23..31 31..8 31..9
0.011561 0.047342 0.137614 0.023285 0.047250 0.011542 0.023300 0.047243 0.416952 0.146040 0.106394 0.011967 0.035036 0.023035 0.072975 0.101726 0.011617 0.011476 0.035147 0.011551 0.011585 0.011545 0.011547 0.011676 0.011634 0.011674 0.011564 0.011504 0.011685 0.011616 9.447008 0.889894 0.074422 0.074727 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.44908
(1: 0.011561, 2: 0.047342, 3: 0.137614, 4: 0.023285, 5: 0.047250, 7: 0.011542, 10: 0.023300, 16: 0.047243, (17: 0.146040, ((18: 0.035036, 19: 0.023035): 0.011967, 22: 0.072975): 0.106394, (20: 0.011617, 21: 0.011476): 0.101726): 0.416952, (6: 0.011551, 11: 0.011585, 12: 0.011545, (13: 0.011676, (14: 0.011674, 15: 0.011564): 0.011634): 0.011547): 0.035147, (8: 0.011685, 9: 0.011616): 0.011504);
(gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011561, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047342, gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr: 0.137614, gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023285, gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047250, gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011542, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023300, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047243, (gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr: 0.146040, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr: 0.035036, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023035): 0.011967, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr: 0.072975): 0.106394, (gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011617, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011476): 0.101726): 0.416952, (gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011551, gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011585, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011545, (gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011676, (gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011674, gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011564): 0.011634): 0.011547): 0.035147, (gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011685, gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011616): 0.011504);
Detailed output identifying parameters
kappa (ts/tv) = 9.44701
dN/dS (w) for site classes (K=3)
p: 0.88989 0.07442 0.03568
w: 0.07473 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
23..1 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
23..2 0.047 193.9 85.1 0.1766 0.0065 0.0369 1.3 3.1
23..3 0.138 193.9 85.1 0.1766 0.0189 0.1073 3.7 9.1
23..4 0.023 193.9 85.1 0.1766 0.0032 0.0182 0.6 1.5
23..5 0.047 193.9 85.1 0.1766 0.0065 0.0368 1.3 3.1
23..7 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
23..10 0.023 193.9 85.1 0.1766 0.0032 0.0182 0.6 1.5
23..16 0.047 193.9 85.1 0.1766 0.0065 0.0368 1.3 3.1
23..24 0.417 193.9 85.1 0.1766 0.0574 0.3250 11.1 27.6
24..17 0.146 193.9 85.1 0.1766 0.0201 0.1138 3.9 9.7
24..25 0.106 193.9 85.1 0.1766 0.0146 0.0829 2.8 7.1
25..26 0.012 193.9 85.1 0.1766 0.0016 0.0093 0.3 0.8
26..18 0.035 193.9 85.1 0.1766 0.0048 0.0273 0.9 2.3
26..19 0.023 193.9 85.1 0.1766 0.0032 0.0180 0.6 1.5
25..22 0.073 193.9 85.1 0.1766 0.0100 0.0569 1.9 4.8
24..27 0.102 193.9 85.1 0.1766 0.0140 0.0793 2.7 6.7
27..20 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
27..21 0.011 193.9 85.1 0.1766 0.0016 0.0089 0.3 0.8
23..28 0.035 193.9 85.1 0.1766 0.0048 0.0274 0.9 2.3
28..6 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
28..11 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
28..12 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
28..29 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
29..13 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
29..30 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
30..14 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
30..15 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
23..31 0.012 193.9 85.1 0.1766 0.0016 0.0090 0.3 0.8
31..8 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
31..9 0.012 193.9 85.1 0.1766 0.0016 0.0091 0.3 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.854 0.146 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.557 0.125 0.062 0.045 0.039 0.036 0.035 0.034 0.034 0.034
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.075
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.048 0.518
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.027 0.137 0.184
sum of density on p0-p1 = 1.000000
Time used: 1:56
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
lnL(ntime: 30 np: 36): -911.681233 +0.000000
23..1 23..2 23..3 23..4 23..5 23..7 23..10 23..16 23..24 24..17 24..25 25..26 26..18 26..19 25..22 24..27 27..20 27..21 23..28 28..6 28..11 28..12 28..29 29..13 29..30 30..14 30..15 23..31 31..8 31..9
0.011521 0.047223 0.137169 0.023202 0.047106 0.011485 0.023227 0.047097 0.414183 0.145308 0.106234 0.011734 0.034895 0.022934 0.072933 0.101489 0.011579 0.011380 0.035032 0.011513 0.011542 0.011507 0.011518 0.011628 0.011565 0.011597 0.011566 0.011508 0.011630 0.011537 9.103305 0.593442 0.061205 0.000001 0.365136 0.365137
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.44284
(1: 0.011521, 2: 0.047223, 3: 0.137169, 4: 0.023202, 5: 0.047106, 7: 0.011485, 10: 0.023227, 16: 0.047097, (17: 0.145308, ((18: 0.034895, 19: 0.022934): 0.011734, 22: 0.072933): 0.106234, (20: 0.011579, 21: 0.011380): 0.101489): 0.414183, (6: 0.011513, 11: 0.011542, 12: 0.011507, (13: 0.011628, (14: 0.011597, 15: 0.011566): 0.011565): 0.011518): 0.035032, (8: 0.011630, 9: 0.011537): 0.011508);
(gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011521, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047223, gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr: 0.137169, gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023202, gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047106, gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011485, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023227, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047097, (gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr: 0.145308, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr: 0.034895, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr: 0.022934): 0.011734, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr: 0.072933): 0.106234, (gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011579, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011380): 0.101489): 0.414183, (gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011513, gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011542, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011507, (gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011628, (gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011597, gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011566): 0.011565): 0.011518): 0.035032, (gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011630, gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011537): 0.011508);
Detailed output identifying parameters
kappa (ts/tv) = 9.10330
dN/dS (w) for site classes (K=3)
p: 0.59344 0.06120 0.34535
w: 0.00000 0.36514 0.36514
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
23..1 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
23..2 0.047 194.2 84.8 0.1484 0.0057 0.0386 1.1 3.3
23..3 0.137 194.2 84.8 0.1484 0.0167 0.1122 3.2 9.5
23..4 0.023 194.2 84.8 0.1484 0.0028 0.0190 0.5 1.6
23..5 0.047 194.2 84.8 0.1484 0.0057 0.0385 1.1 3.3
23..7 0.011 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
23..10 0.023 194.2 84.8 0.1484 0.0028 0.0190 0.5 1.6
23..16 0.047 194.2 84.8 0.1484 0.0057 0.0385 1.1 3.3
23..24 0.414 194.2 84.8 0.1484 0.0503 0.3389 9.8 28.8
24..17 0.145 194.2 84.8 0.1484 0.0176 0.1189 3.4 10.1
24..25 0.106 194.2 84.8 0.1484 0.0129 0.0869 2.5 7.4
25..26 0.012 194.2 84.8 0.1484 0.0014 0.0096 0.3 0.8
26..18 0.035 194.2 84.8 0.1484 0.0042 0.0286 0.8 2.4
26..19 0.023 194.2 84.8 0.1484 0.0028 0.0188 0.5 1.6
25..22 0.073 194.2 84.8 0.1484 0.0089 0.0597 1.7 5.1
24..27 0.101 194.2 84.8 0.1484 0.0123 0.0830 2.4 7.0
27..20 0.012 194.2 84.8 0.1484 0.0014 0.0095 0.3 0.8
27..21 0.011 194.2 84.8 0.1484 0.0014 0.0093 0.3 0.8
23..28 0.035 194.2 84.8 0.1484 0.0043 0.0287 0.8 2.4
28..6 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
28..11 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
28..12 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
28..29 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
29..13 0.012 194.2 84.8 0.1484 0.0014 0.0095 0.3 0.8
29..30 0.012 194.2 84.8 0.1484 0.0014 0.0095 0.3 0.8
30..14 0.012 194.2 84.8 0.1484 0.0014 0.0095 0.3 0.8
30..15 0.012 194.2 84.8 0.1484 0.0014 0.0095 0.3 0.8
23..31 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
31..8 0.012 194.2 84.8 0.1484 0.0014 0.0095 0.3 0.8
31..9 0.012 194.2 84.8 0.1484 0.0014 0.0094 0.3 0.8
Naive Empirical Bayes (NEB) analysis
Time used: 3:14
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
lnL(ntime: 30 np: 33): -912.031149 +0.000000
23..1 23..2 23..3 23..4 23..5 23..7 23..10 23..16 23..24 24..17 24..25 25..26 26..18 26..19 25..22 24..27 27..20 27..21 23..28 28..6 28..11 28..12 28..29 29..13 29..30 30..14 30..15 23..31 31..8 31..9
0.011510 0.047181 0.137080 0.023183 0.047061 0.011477 0.023204 0.047054 0.414577 0.145299 0.106163 0.011770 0.034862 0.022909 0.072814 0.101328 0.011559 0.011390 0.035001 0.011503 0.011535 0.011496 0.011502 0.011623 0.011557 0.011596 0.011547 0.011486 0.011617 0.011536 9.128344 0.303491 1.686488
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.44242
(1: 0.011510, 2: 0.047181, 3: 0.137080, 4: 0.023183, 5: 0.047061, 7: 0.011477, 10: 0.023204, 16: 0.047054, (17: 0.145299, ((18: 0.034862, 19: 0.022909): 0.011770, 22: 0.072814): 0.106163, (20: 0.011559, 21: 0.011390): 0.101328): 0.414577, (6: 0.011503, 11: 0.011535, 12: 0.011496, (13: 0.011623, (14: 0.011596, 15: 0.011547): 0.011557): 0.011502): 0.035001, (8: 0.011617, 9: 0.011536): 0.011486);
(gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011510, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047181, gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr: 0.137080, gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023183, gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047061, gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011477, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023204, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047054, (gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr: 0.145299, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr: 0.034862, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr: 0.022909): 0.011770, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr: 0.072814): 0.106163, (gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011559, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011390): 0.101328): 0.414577, (gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011503, gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011535, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011496, (gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011623, (gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011596, gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011547): 0.011557): 0.011502): 0.035001, (gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011617, gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011536): 0.011486);
Detailed output identifying parameters
kappa (ts/tv) = 9.12834
Parameters in M7 (beta):
p = 0.30349 q = 1.68649
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00003 0.00099 0.00533 0.01625 0.03761 0.07431 0.13306 0.22444 0.36910 0.62991
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
23..1 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
23..2 0.047 194.1 84.9 0.1491 0.0057 0.0386 1.1 3.3
23..3 0.137 194.1 84.9 0.1491 0.0167 0.1120 3.2 9.5
23..4 0.023 194.1 84.9 0.1491 0.0028 0.0189 0.5 1.6
23..5 0.047 194.1 84.9 0.1491 0.0057 0.0385 1.1 3.3
23..7 0.011 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
23..10 0.023 194.1 84.9 0.1491 0.0028 0.0190 0.5 1.6
23..16 0.047 194.1 84.9 0.1491 0.0057 0.0385 1.1 3.3
23..24 0.415 194.1 84.9 0.1491 0.0505 0.3388 9.8 28.7
24..17 0.145 194.1 84.9 0.1491 0.0177 0.1187 3.4 10.1
24..25 0.106 194.1 84.9 0.1491 0.0129 0.0868 2.5 7.4
25..26 0.012 194.1 84.9 0.1491 0.0014 0.0096 0.3 0.8
26..18 0.035 194.1 84.9 0.1491 0.0042 0.0285 0.8 2.4
26..19 0.023 194.1 84.9 0.1491 0.0028 0.0187 0.5 1.6
25..22 0.073 194.1 84.9 0.1491 0.0089 0.0595 1.7 5.0
24..27 0.101 194.1 84.9 0.1491 0.0123 0.0828 2.4 7.0
27..20 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
27..21 0.011 194.1 84.9 0.1491 0.0014 0.0093 0.3 0.8
23..28 0.035 194.1 84.9 0.1491 0.0043 0.0286 0.8 2.4
28..6 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
28..11 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
28..12 0.011 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
28..29 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
29..13 0.012 194.1 84.9 0.1491 0.0014 0.0095 0.3 0.8
29..30 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
30..14 0.012 194.1 84.9 0.1491 0.0014 0.0095 0.3 0.8
30..15 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
23..31 0.011 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
31..8 0.012 194.1 84.9 0.1491 0.0014 0.0095 0.3 0.8
31..9 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
Time used: 6:47
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 7, 10, 16, (17, ((18, 19), 22), (20, 21)), (6, 11, 12, (13, (14, 15))), (8, 9)); MP score: 112
lnL(ntime: 30 np: 35): -912.031209 +0.000000
23..1 23..2 23..3 23..4 23..5 23..7 23..10 23..16 23..24 24..17 24..25 25..26 26..18 26..19 25..22 24..27 27..20 27..21 23..28 28..6 28..11 28..12 28..29 29..13 29..30 30..14 30..15 23..31 31..8 31..9
0.011510 0.047181 0.137080 0.023183 0.047061 0.011477 0.023204 0.047054 0.414578 0.145299 0.106163 0.011770 0.034862 0.022909 0.072814 0.101328 0.011559 0.011390 0.035001 0.011503 0.011535 0.011496 0.011502 0.011623 0.011557 0.011596 0.011547 0.011486 0.011617 0.011536 9.128373 0.999990 0.303496 1.686585 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.44242
(1: 0.011510, 2: 0.047181, 3: 0.137080, 4: 0.023183, 5: 0.047061, 7: 0.011477, 10: 0.023204, 16: 0.047054, (17: 0.145299, ((18: 0.034862, 19: 0.022909): 0.011770, 22: 0.072814): 0.106163, (20: 0.011559, 21: 0.011390): 0.101328): 0.414578, (6: 0.011503, 11: 0.011535, 12: 0.011496, (13: 0.011623, (14: 0.011596, 15: 0.011547): 0.011557): 0.011502): 0.035001, (8: 0.011617, 9: 0.011536): 0.011486);
(gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011510, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047181, gb:KX601167|Organism:Zika_virus|Strain_Name:ZIKV/Aedes_sp./MYS/P6-740/1966|Protein_Name:protein_pr|Gene_Symbol:pr: 0.137080, gb:KY241691|Organism:Zika_virus|Strain_Name:ZIKV-SG-021|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023183, gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047061, gb:KY241727|Organism:Zika_virus|Strain_Name:ZIKV-SG-057|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011477, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.023204, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:protein_pr|Gene_Symbol:pr: 0.047054, (gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:protein_pr|Gene_Symbol:pr: 0.145299, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:protein_pr|Gene_Symbol:pr: 0.034862, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:protein_pr|Gene_Symbol:pr: 0.022909): 0.011770, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:protein_pr|Gene_Symbol:pr: 0.072814): 0.106163, (gb:KX377335|Organism:Zika_virus|Strain_Name:MR-766|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011559, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011390): 0.101328): 0.414578, (gb:KY785451|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/MTQ/2016/FL-001-SAL|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011503, gb:LC191864|Organism:Zika_virus|Strain_Name:ZIKV/Hu/Chiba/S36/2016|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011535, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011496, (gb:KY785413|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/DOM/2016/MA-WGS16-040-SER|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011623, (gb:KY075935|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL022U|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011596, gb:KY785468|Organism:Zika_virus|Strain_Name:Zika_virus/A.aegypti-wt/USA/2016/FL-08-MOS|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011547): 0.011557): 0.011502): 0.035001, (gb:KY241688|Organism:Zika_virus|Strain_Name:ZIKV-SG-018|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011617, gb:KY241751|Organism:Zika_virus|Strain_Name:ZIKV-SG-081|Protein_Name:protein_pr|Gene_Symbol:pr: 0.011536): 0.011486);
Detailed output identifying parameters
kappa (ts/tv) = 9.12837
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.30350 q = 1.68659
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00003 0.00099 0.00533 0.01625 0.03761 0.07431 0.13306 0.22443 0.36909 0.62989 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
23..1 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
23..2 0.047 194.1 84.9 0.1491 0.0057 0.0386 1.1 3.3
23..3 0.137 194.1 84.9 0.1491 0.0167 0.1120 3.2 9.5
23..4 0.023 194.1 84.9 0.1491 0.0028 0.0189 0.5 1.6
23..5 0.047 194.1 84.9 0.1491 0.0057 0.0385 1.1 3.3
23..7 0.011 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
23..10 0.023 194.1 84.9 0.1491 0.0028 0.0190 0.5 1.6
23..16 0.047 194.1 84.9 0.1491 0.0057 0.0385 1.1 3.3
23..24 0.415 194.1 84.9 0.1491 0.0505 0.3388 9.8 28.7
24..17 0.145 194.1 84.9 0.1491 0.0177 0.1187 3.4 10.1
24..25 0.106 194.1 84.9 0.1491 0.0129 0.0868 2.5 7.4
25..26 0.012 194.1 84.9 0.1491 0.0014 0.0096 0.3 0.8
26..18 0.035 194.1 84.9 0.1491 0.0042 0.0285 0.8 2.4
26..19 0.023 194.1 84.9 0.1491 0.0028 0.0187 0.5 1.6
25..22 0.073 194.1 84.9 0.1491 0.0089 0.0595 1.7 5.0
24..27 0.101 194.1 84.9 0.1491 0.0123 0.0828 2.4 7.0
27..20 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
27..21 0.011 194.1 84.9 0.1491 0.0014 0.0093 0.3 0.8
23..28 0.035 194.1 84.9 0.1491 0.0043 0.0286 0.8 2.4
28..6 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
28..11 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
28..12 0.011 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
28..29 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
29..13 0.012 194.1 84.9 0.1491 0.0014 0.0095 0.3 0.8
29..30 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
30..14 0.012 194.1 84.9 0.1491 0.0014 0.0095 0.3 0.8
30..15 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
23..31 0.011 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
31..8 0.012 194.1 84.9 0.1491 0.0014 0.0095 0.3 0.8
31..9 0.012 194.1 84.9 0.1491 0.0014 0.0094 0.3 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:protein_pr|Gene_Symbol:pr)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.019 0.981
p : 0.717 0.271 0.011 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.003 0.049 0.109 0.129 0.127 0.126 0.135 0.151 0.171
ws: 0.701 0.116 0.043 0.027 0.021 0.019 0.019 0.018 0.018 0.018
Time used: 11:07
Model 1: NearlyNeutral -913.421485 Model 2: PositiveSelection -913.421485 Model 0: one-ratio -915.624986 Model 3: discrete -911.681233 Model 7: beta -912.031149 Model 8: beta&w>1 -912.031209 Model 0 vs 1 4.407002000000148 Model 2 vs 1 0.0 Model 8 vs 7 1.199999999244028E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
