Back

A_NS4A - Muscle

Download 
--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Nov 06 10:03:54 WET 2017
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS1/ZikaADOPSresults/NS4A/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1050.21         -1075.91
2      -1050.05         -1072.20
--------------------------------------
TOTAL    -1050.13         -1075.25
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.913767    0.026454    0.624029    1.226554    0.898020    940.90   1062.67    1.000
r(A<->C){all}   0.057728    0.000642    0.013258    0.106729    0.054569    529.66    678.22    1.003
r(A<->G){all}   0.207911    0.003861    0.102718    0.335829    0.199671    428.35    503.76    1.000
r(A<->T){all}   0.032969    0.000552    0.000435    0.078369    0.028455    713.64    807.09    1.000
r(C<->G){all}   0.011547    0.000074    0.000027    0.028464    0.009543   1049.23   1081.38    1.000
r(C<->T){all}   0.674395    0.005487    0.529492    0.809976    0.680316    407.14    448.06    1.001
r(G<->T){all}   0.015451    0.000132    0.000007    0.036776    0.012971    644.23    754.25    1.000
pi(A){all}      0.233651    0.000408    0.195184    0.273377    0.233196   1023.61   1052.37    1.000
pi(C){all}      0.244033    0.000392    0.204434    0.280834    0.244127   1315.36   1393.43    1.000
pi(G){all}      0.303099    0.000506    0.259430    0.346529    0.302280   1292.48   1319.86    1.000
pi(T){all}      0.219217    0.000371    0.181349    0.256908    0.218607   1218.61   1327.43    1.000
alpha{1,2}      0.120002    0.000877    0.071618    0.186986    0.117182    996.51   1177.06    1.000
alpha{3}        2.150370    0.632498    0.830984    3.726351    2.011461   1276.47   1299.67    1.000
pinvar{all}     0.344839    0.007672    0.175451    0.510316    0.349935    941.49   1131.98    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-995.469169
Model 2: PositiveSelection	-995.469169
Model 0: one-ratio	-997.108451
Model 3: discrete	-995.135008
Model 7: beta	-995.139976
Model 8: beta&w>1	-995.140004


Model 0 vs 1	3.2785639999999603

Model 2 vs 1	0.0

Model 8 vs 7	5.599999985861359E-5
Download 
>C1
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C2
GVALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C3
GAVFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C4
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFLLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C5
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKVAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C6
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C7
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGVFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C8
GAAFRVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C9
GAALGVMDALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C10
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAPLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C11
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C12
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFEMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C13
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C14
GAAFGVIEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C15
GATFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=15, Len=127 

C1              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C2              GVALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C3              GAVFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C4              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C5              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKVAAAQLPE
C6              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C7              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C8              GAAFRVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C9              GAALGVMDALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C10             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAPLPE
C11             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C12             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C13             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPE
C14             GAAFGVIEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C15             GATFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
                *..: *::**********************************.*** :**

C1              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C2              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C3              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C4              TLETIMLLGLLGTVSLGIFFLLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C5              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C6              TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
C7              TLETIMLLGLLGTVSLGVFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C8              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C9              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C10             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C11             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C12             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFEMVTLGASAWLMWLSEI
C13             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C14             TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
C15             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
                *****************:**:******:***** ****************

C1              EPARIACVLIVVFLLLVVLIPEPEKQR
C2              EPARIACVLIVVFLLLVVLIPEPEKQR
C3              EPARIACVLIVVFLLLVVLIPEPEKQR
C4              EPARIACVLIVVFLLLVVLIPEPEKQR
C5              EPARIACVLIVVFLLLVVLIPEPEKQR
C6              EPARIACVLIVVFLLLVVLIPEPEKQR
C7              EPARIACVLIVVFLLLVVLIPEPEKQR
C8              EPARIACVLIVVFLLLVVLIPEPEKQR
C9              EPARIACVLIVVFLLLVVLIPEPEKQR
C10             EPARIACVLIVVFLLLVVLIPEPEKQR
C11             EPARIACVLIVVFLLLVVLIPEPEKQR
C12             EPARIACVLIVVFLLLVVLIPEPEKQR
C13             EPARIACVLIVVFLLLVVLIPEPEKQR
C14             EPARIACVLIVVFLLLVVLIPEPEKQR
C15             EPARIACVLIVVFLLLVVLIPEPEKQR
                ***************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [26670]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [26670]--->[26670]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.767 Mb, Max= 31.492 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C2              GVALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C3              GAVFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C4              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C5              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKVAAAQLPE
C6              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C7              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C8              GAAFRVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C9              GAALGVMDALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C10             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAPLPE
C11             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C12             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C13             GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPE
C14             GAAFGVIEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
C15             GATFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
                *..: *::**********************************.*** :**

C1              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C2              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C3              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C4              TLETIMLLGLLGTVSLGIFFLLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C5              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C6              TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
C7              TLETIMLLGLLGTVSLGVFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C8              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C9              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C10             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C11             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C12             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFEMVTLGASAWLMWLSEI
C13             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
C14             TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
C15             TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
                *****************:**:******:***** ****************

C1              EPARIACVLIVVFLLLVVLIPEPEKQR
C2              EPARIACVLIVVFLLLVVLIPEPEKQR
C3              EPARIACVLIVVFLLLVVLIPEPEKQR
C4              EPARIACVLIVVFLLLVVLIPEPEKQR
C5              EPARIACVLIVVFLLLVVLIPEPEKQR
C6              EPARIACVLIVVFLLLVVLIPEPEKQR
C7              EPARIACVLIVVFLLLVVLIPEPEKQR
C8              EPARIACVLIVVFLLLVVLIPEPEKQR
C9              EPARIACVLIVVFLLLVVLIPEPEKQR
C10             EPARIACVLIVVFLLLVVLIPEPEKQR
C11             EPARIACVLIVVFLLLVVLIPEPEKQR
C12             EPARIACVLIVVFLLLVVLIPEPEKQR
C13             EPARIACVLIVVFLLLVVLIPEPEKQR
C14             EPARIACVLIVVFLLLVVLIPEPEKQR
C15             EPARIACVLIVVFLLLVVLIPEPEKQR
                ***************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# SEQ_INDEX C15 14
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.43  C1	  C2	 98.43
TOP	    1    0	 98.43  C2	  C1	 98.43
BOT	    0    2	 99.21  C1	  C3	 99.21
TOP	    2    0	 99.21  C3	  C1	 99.21
BOT	    0    3	 99.21  C1	  C4	 99.21
TOP	    3    0	 99.21  C4	  C1	 99.21
BOT	    0    4	 99.21  C1	  C5	 99.21
TOP	    4    0	 99.21  C5	  C1	 99.21
BOT	    0    5	 99.21  C1	  C6	 99.21
TOP	    5    0	 99.21  C6	  C1	 99.21
BOT	    0    6	 99.21  C1	  C7	 99.21
TOP	    6    0	 99.21  C7	  C1	 99.21
BOT	    0    7	 99.21  C1	  C8	 99.21
TOP	    7    0	 99.21  C8	  C1	 99.21
BOT	    0    8	 98.43  C1	  C9	 98.43
TOP	    8    0	 98.43  C9	  C1	 98.43
BOT	    0    9	 98.43  C1	 C10	 98.43
TOP	    9    0	 98.43 C10	  C1	 98.43
BOT	    0   10	 99.21  C1	 C11	 99.21
TOP	   10    0	 99.21 C11	  C1	 99.21
BOT	    0   11	 98.43  C1	 C12	 98.43
TOP	   11    0	 98.43 C12	  C1	 98.43
BOT	    0   12	 98.43  C1	 C13	 98.43
TOP	   12    0	 98.43 C13	  C1	 98.43
BOT	    0   13	 98.43  C1	 C14	 98.43
TOP	   13    0	 98.43 C14	  C1	 98.43
BOT	    0   14	 99.21  C1	 C15	 99.21
TOP	   14    0	 99.21 C15	  C1	 99.21
BOT	    1    2	 97.64  C2	  C3	 97.64
TOP	    2    1	 97.64  C3	  C2	 97.64
BOT	    1    3	 97.64  C2	  C4	 97.64
TOP	    3    1	 97.64  C4	  C2	 97.64
BOT	    1    4	 97.64  C2	  C5	 97.64
TOP	    4    1	 97.64  C5	  C2	 97.64
BOT	    1    5	 97.64  C2	  C6	 97.64
TOP	    5    1	 97.64  C6	  C2	 97.64
BOT	    1    6	 97.64  C2	  C7	 97.64
TOP	    6    1	 97.64  C7	  C2	 97.64
BOT	    1    7	 97.64  C2	  C8	 97.64
TOP	    7    1	 97.64  C8	  C2	 97.64
BOT	    1    8	 98.43  C2	  C9	 98.43
TOP	    8    1	 98.43  C9	  C2	 98.43
BOT	    1    9	 98.43  C2	 C10	 98.43
TOP	    9    1	 98.43 C10	  C2	 98.43
BOT	    1   10	 99.21  C2	 C11	 99.21
TOP	   10    1	 99.21 C11	  C2	 99.21
BOT	    1   11	 98.43  C2	 C12	 98.43
TOP	   11    1	 98.43 C12	  C2	 98.43
BOT	    1   12	 98.43  C2	 C13	 98.43
TOP	   12    1	 98.43 C13	  C2	 98.43
BOT	    1   13	 96.85  C2	 C14	 96.85
TOP	   13    1	 96.85 C14	  C2	 96.85
BOT	    1   14	 97.64  C2	 C15	 97.64
TOP	   14    1	 97.64 C15	  C2	 97.64
BOT	    2    3	 98.43  C3	  C4	 98.43
TOP	    3    2	 98.43  C4	  C3	 98.43
BOT	    2    4	 98.43  C3	  C5	 98.43
TOP	    4    2	 98.43  C5	  C3	 98.43
BOT	    2    5	 98.43  C3	  C6	 98.43
TOP	    5    2	 98.43  C6	  C3	 98.43
BOT	    2    6	 98.43  C3	  C7	 98.43
TOP	    6    2	 98.43  C7	  C3	 98.43
BOT	    2    7	 98.43  C3	  C8	 98.43
TOP	    7    2	 98.43  C8	  C3	 98.43
BOT	    2    8	 97.64  C3	  C9	 97.64
TOP	    8    2	 97.64  C9	  C3	 97.64
BOT	    2    9	 97.64  C3	 C10	 97.64
TOP	    9    2	 97.64 C10	  C3	 97.64
BOT	    2   10	 98.43  C3	 C11	 98.43
TOP	   10    2	 98.43 C11	  C3	 98.43
BOT	    2   11	 97.64  C3	 C12	 97.64
TOP	   11    2	 97.64 C12	  C3	 97.64
BOT	    2   12	 97.64  C3	 C13	 97.64
TOP	   12    2	 97.64 C13	  C3	 97.64
BOT	    2   13	 97.64  C3	 C14	 97.64
TOP	   13    2	 97.64 C14	  C3	 97.64
BOT	    2   14	 99.21  C3	 C15	 99.21
TOP	   14    2	 99.21 C15	  C3	 99.21
BOT	    3    4	 98.43  C4	  C5	 98.43
TOP	    4    3	 98.43  C5	  C4	 98.43
BOT	    3    5	 98.43  C4	  C6	 98.43
TOP	    5    3	 98.43  C6	  C4	 98.43
BOT	    3    6	 98.43  C4	  C7	 98.43
TOP	    6    3	 98.43  C7	  C4	 98.43
BOT	    3    7	 98.43  C4	  C8	 98.43
TOP	    7    3	 98.43  C8	  C4	 98.43
BOT	    3    8	 97.64  C4	  C9	 97.64
TOP	    8    3	 97.64  C9	  C4	 97.64
BOT	    3    9	 97.64  C4	 C10	 97.64
TOP	    9    3	 97.64 C10	  C4	 97.64
BOT	    3   10	 98.43  C4	 C11	 98.43
TOP	   10    3	 98.43 C11	  C4	 98.43
BOT	    3   11	 97.64  C4	 C12	 97.64
TOP	   11    3	 97.64 C12	  C4	 97.64
BOT	    3   12	 97.64  C4	 C13	 97.64
TOP	   12    3	 97.64 C13	  C4	 97.64
BOT	    3   13	 97.64  C4	 C14	 97.64
TOP	   13    3	 97.64 C14	  C4	 97.64
BOT	    3   14	 98.43  C4	 C15	 98.43
TOP	   14    3	 98.43 C15	  C4	 98.43
BOT	    4    5	 98.43  C5	  C6	 98.43
TOP	    5    4	 98.43  C6	  C5	 98.43
BOT	    4    6	 98.43  C5	  C7	 98.43
TOP	    6    4	 98.43  C7	  C5	 98.43
BOT	    4    7	 98.43  C5	  C8	 98.43
TOP	    7    4	 98.43  C8	  C5	 98.43
BOT	    4    8	 97.64  C5	  C9	 97.64
TOP	    8    4	 97.64  C9	  C5	 97.64
BOT	    4    9	 97.64  C5	 C10	 97.64
TOP	    9    4	 97.64 C10	  C5	 97.64
BOT	    4   10	 98.43  C5	 C11	 98.43
TOP	   10    4	 98.43 C11	  C5	 98.43
BOT	    4   11	 97.64  C5	 C12	 97.64
TOP	   11    4	 97.64 C12	  C5	 97.64
BOT	    4   12	 97.64  C5	 C13	 97.64
TOP	   12    4	 97.64 C13	  C5	 97.64
BOT	    4   13	 97.64  C5	 C14	 97.64
TOP	   13    4	 97.64 C14	  C5	 97.64
BOT	    4   14	 98.43  C5	 C15	 98.43
TOP	   14    4	 98.43 C15	  C5	 98.43
BOT	    5    6	 98.43  C6	  C7	 98.43
TOP	    6    5	 98.43  C7	  C6	 98.43
BOT	    5    7	 98.43  C6	  C8	 98.43
TOP	    7    5	 98.43  C8	  C6	 98.43
BOT	    5    8	 97.64  C6	  C9	 97.64
TOP	    8    5	 97.64  C9	  C6	 97.64
BOT	    5    9	 97.64  C6	 C10	 97.64
TOP	    9    5	 97.64 C10	  C6	 97.64
BOT	    5   10	 98.43  C6	 C11	 98.43
TOP	   10    5	 98.43 C11	  C6	 98.43
BOT	    5   11	 97.64  C6	 C12	 97.64
TOP	   11    5	 97.64 C12	  C6	 97.64
BOT	    5   12	 97.64  C6	 C13	 97.64
TOP	   12    5	 97.64 C13	  C6	 97.64
BOT	    5   13	 99.21  C6	 C14	 99.21
TOP	   13    5	 99.21 C14	  C6	 99.21
BOT	    5   14	 98.43  C6	 C15	 98.43
TOP	   14    5	 98.43 C15	  C6	 98.43
BOT	    6    7	 98.43  C7	  C8	 98.43
TOP	    7    6	 98.43  C8	  C7	 98.43
BOT	    6    8	 97.64  C7	  C9	 97.64
TOP	    8    6	 97.64  C9	  C7	 97.64
BOT	    6    9	 97.64  C7	 C10	 97.64
TOP	    9    6	 97.64 C10	  C7	 97.64
BOT	    6   10	 98.43  C7	 C11	 98.43
TOP	   10    6	 98.43 C11	  C7	 98.43
BOT	    6   11	 97.64  C7	 C12	 97.64
TOP	   11    6	 97.64 C12	  C7	 97.64
BOT	    6   12	 97.64  C7	 C13	 97.64
TOP	   12    6	 97.64 C13	  C7	 97.64
BOT	    6   13	 97.64  C7	 C14	 97.64
TOP	   13    6	 97.64 C14	  C7	 97.64
BOT	    6   14	 98.43  C7	 C15	 98.43
TOP	   14    6	 98.43 C15	  C7	 98.43
BOT	    7    8	 97.64  C8	  C9	 97.64
TOP	    8    7	 97.64  C9	  C8	 97.64
BOT	    7    9	 97.64  C8	 C10	 97.64
TOP	    9    7	 97.64 C10	  C8	 97.64
BOT	    7   10	 98.43  C8	 C11	 98.43
TOP	   10    7	 98.43 C11	  C8	 98.43
BOT	    7   11	 97.64  C8	 C12	 97.64
TOP	   11    7	 97.64 C12	  C8	 97.64
BOT	    7   12	 97.64  C8	 C13	 97.64
TOP	   12    7	 97.64 C13	  C8	 97.64
BOT	    7   13	 97.64  C8	 C14	 97.64
TOP	   13    7	 97.64 C14	  C8	 97.64
BOT	    7   14	 98.43  C8	 C15	 98.43
TOP	   14    7	 98.43 C15	  C8	 98.43
BOT	    8    9	 98.43  C9	 C10	 98.43
TOP	    9    8	 98.43 C10	  C9	 98.43
BOT	    8   10	 99.21  C9	 C11	 99.21
TOP	   10    8	 99.21 C11	  C9	 99.21
BOT	    8   11	 98.43  C9	 C12	 98.43
TOP	   11    8	 98.43 C12	  C9	 98.43
BOT	    8   12	 98.43  C9	 C13	 98.43
TOP	   12    8	 98.43 C13	  C9	 98.43
BOT	    8   13	 96.85  C9	 C14	 96.85
TOP	   13    8	 96.85 C14	  C9	 96.85
BOT	    8   14	 97.64  C9	 C15	 97.64
TOP	   14    8	 97.64 C15	  C9	 97.64
BOT	    9   10	 99.21 C10	 C11	 99.21
TOP	   10    9	 99.21 C11	 C10	 99.21
BOT	    9   11	 98.43 C10	 C12	 98.43
TOP	   11    9	 98.43 C12	 C10	 98.43
BOT	    9   12	 98.43 C10	 C13	 98.43
TOP	   12    9	 98.43 C13	 C10	 98.43
BOT	    9   13	 96.85 C10	 C14	 96.85
TOP	   13    9	 96.85 C14	 C10	 96.85
BOT	    9   14	 97.64 C10	 C15	 97.64
TOP	   14    9	 97.64 C15	 C10	 97.64
BOT	   10   11	 99.21 C11	 C12	 99.21
TOP	   11   10	 99.21 C12	 C11	 99.21
BOT	   10   12	 99.21 C11	 C13	 99.21
TOP	   12   10	 99.21 C13	 C11	 99.21
BOT	   10   13	 97.64 C11	 C14	 97.64
TOP	   13   10	 97.64 C14	 C11	 97.64
BOT	   10   14	 98.43 C11	 C15	 98.43
TOP	   14   10	 98.43 C15	 C11	 98.43
BOT	   11   12	 98.43 C12	 C13	 98.43
TOP	   12   11	 98.43 C13	 C12	 98.43
BOT	   11   13	 96.85 C12	 C14	 96.85
TOP	   13   11	 96.85 C14	 C12	 96.85
BOT	   11   14	 97.64 C12	 C15	 97.64
TOP	   14   11	 97.64 C15	 C12	 97.64
BOT	   12   13	 96.85 C13	 C14	 96.85
TOP	   13   12	 96.85 C14	 C13	 96.85
BOT	   12   14	 97.64 C13	 C15	 97.64
TOP	   14   12	 97.64 C15	 C13	 97.64
BOT	   13   14	 97.64 C14	 C15	 97.64
TOP	   14   13	 97.64 C15	 C14	 97.64
AVG	 0	  C1	   *	 98.88
AVG	 1	  C2	   *	 97.98
AVG	 2	  C3	   *	 98.20
AVG	 3	  C4	   *	 98.14
AVG	 4	  C5	   *	 98.14
AVG	 5	  C6	   *	 98.26
AVG	 6	  C7	   *	 98.14
AVG	 7	  C8	   *	 98.14
AVG	 8	  C9	   *	 97.98
AVG	 9	 C10	   *	 97.98
AVG	 10	 C11	   *	 98.71
AVG	 11	 C12	   *	 97.98
AVG	 12	 C13	   *	 97.98
AVG	 13	 C14	   *	 97.53
AVG	 14	 C15	   *	 98.20
TOT	 TOT	   *	 98.15
CLUSTAL W (1.83) multiple sequence alignment

C1              GGGGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C2              GGAGTGGCTTTAGGAGTAATGGAGGCCCTGGGAACATTGCCAGGACACAT
C3              GGAGCGGTTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C4              GGAGCGGCTTTTGGAGTGATGGAAGCCTTGGGAACACTGCCAGGACACAT
C5              GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C6              GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C7              GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C8              GGAGCGGCTTTTAGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C9              GGAGCGGCTTTGGGAGTGATGGATGCCCTGGGAACATTGCCAGGACACAT
C10             GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTGCCAGGACACAT
C11             GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTACCAGGACACAT
C12             GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTACCAGGACACAT
C13             GGAGCGGCTCTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
C14             GGAGCGGCCTTTGGAGTGATAGAAGCCCTGGGAACACTGCCAGGACACAT
C15             GGAGCGACTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
                **.* *.   * .****.**.** *** ******** *.***********

C1              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C2              GACAGAGAGGTTTCAGGAGGCCATTGACAATCTCGCTGTGCTCATGCGAG
C3              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C4              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C5              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C6              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C7              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C8              GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C9              GACAGAGAGGTTTCAGGAAGCCATTGACAATCTCGCTGTGCTCATGCGAG
C10             GACAGAGAGGTTTCAGGAAGCCATTGACAATCTCGCTGTGCTTATGCGAG
C11             GACAGAGAGGTTTCAGGAAGCCATTGATAACCTCGCTGTGCTCATGCGAG
C12             GACAGAGAGGTTTCAGGAAGCCATTGATAACCTCGCTGTGCTCATGCGAG
C13             GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C14             GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
C15             GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
                *********.** *****.******** ** *********** *****.*

C1              CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C2              CAGAGACTGGAAGCAGGCCTTACAAGGCAGCGGCAGCCCAACTGCCGGAG
C3              CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C4              CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C5              CAGAGACTGGAAGCAGGCCTTACAAAGTCGCGGCGGCCCAATTGCCGGAG
C6              CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C7              CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C8              CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C9              CAGAGACTGGAAGTAGGCCCTACAAAGCAGCGGCAGCTCAACTGCCGGAG
C10             CAGAAACTGGAAGCAGGCCTTACAAGGCAGCGGCAGCCCCACTGCCGGAG
C11             CAGAGACTGGAAGCAGGCCCTACAAGGCAGCGGCAGCCCAATTGCCGGAG
C12             CAGAGACTGGAAGCAGGCCCTACAAGGCAGCGGCAGCCCAATTGCCGGAG
C13             CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAAATGCCGGAG
C14             CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
C15             CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
                ****.******** ***** *****.* .*****.** *.* ********

C1              ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C2              ACCCTAGAGACCATCATGCTCTTAGGCTTGTTGGGAACAGTTTCGTTGGG
C3              ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGTTGGG
C4              ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C5              ACCCTAGAGACCATCATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C6              ACCCTAGAGACTATCATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C7              ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C8              ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C9              ACCCTAGAGACCATCATGCTTTTGGGCTTATTGGGAACAGTTTCGCTAGG
C10             ACCCTAGAGACCATCATGCTCTTAGGTTTGCTGGGAACAGTTTCGTTGGG
C11             ACCCTAGAGACCATCATGCTTTTAGGCCTGCTGGGAACAGTATCGCTGGG
C12             ACCCTAGAGACCATCATGCTTTTAGGCCTGCTGGGAACAGTATCGCTGGG
C13             ACCCTAGAGACCATTATGCTTTTGGGGTTGCTAGGAACAGTCTCGCTGGG
C14             ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
C15             ACCTTAGAGACCATTATGCTTTTGGGATTGCTGGGAACAGTCTCGTTGGG
                *** ******* ** ***** **.**  *. *.******** *** *.**

C1              AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C2              GATCTTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGTTTTG
C3              AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C4              AATCTTTTTCCTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C5              AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C6              AATCTTTTTCGTCTTGATGAGGAACAAGGGCATGGGGAAGATGGGCTTTG
C7              AGTCTTCTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C8              AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C9              AATCTTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGCTTCG
C10             GATATTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGGTTTG
C11             GATCTTTTTTGTCTTGATGAGGAACAAGGGCATCGGGAAGATGGGCTTTG
C12             GATCTTTTTTGTCTTGATGAGGAACAAGGGCATCGGGAAGATGGGCTTTG
C13             AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
C14             AATCTTTTTCGTCTTGATGCGGAACAAGGGCATGGGGAAGATGGGCTTTG
C15             AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
                ..*.** **  ********.************* *********** ** *

C1              GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
C2              GAATGGTAACTCTTGGGGCCAGTGCATGGCTCATGTGGCTTTCGGAAATT
C3              GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
C4              GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
C5              GAATGGTGACTCTTGGGGCCAGCGCATGGCTTATGTGGCTCTCGGAAATT
C6              GAATGGTGACTCTTGGAGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
C7              GAATGGTGACCCTTGGGGCCAGTGCATGGCTCATGTGGCTCTCGGAAATT
C8              GAATGGTGACCCTTGGGGCCAGTGCATGGCTCATGTGGCTCTCGGAAATT
C9              GAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTTTCGGAAATT
C10             GAATGGTAACTCTTGGGGCCAGTGCATGGCTCATGTGGCTTTCGGAAATT
C11             GAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCAGAAATC
C12             AAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCAGAAATC
C13             GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
C14             GAATGGTGACTCTTGGGGCCAGCGCATGGCTTATGTGGCTCTCGGAAATT
C15             GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
                .******.** *****.***** ******** ******** **.***** 

C1              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C2              GAACCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCTTGTTACTGGT
C3              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C4              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C5              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C6              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C7              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C8              GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C9              GAACCAGCCAGAATCGCATGTGTCCTCATTGTCGTGTTTTTGTTACTGGT
C10             GAACCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTTTTGTTACTGGT
C11             GAACCAGCCAGAATTGCATGTGTCCTTATTGTTGTGTTTTTATTACTGGT
C12             GAACCAGCCAGAATTGCATGTGTCCTTATTGTTGTGTTTTTATTACTGGT
C13             GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
C14             GAGCCAGCCAGAATTGCATGTGTCCTCATTGTCGTGTTCCTATTGCTGGT
C15             GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
                **.*********** *********** ***** *****  *.**.*****

C1              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C2              GGTACTCATACCCGAGCCAGAGAAGCAAAGA
C3              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C4              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C5              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C6              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C7              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C8              GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C9              GGTGCTCATACCCGAGCCAGAGAAGCAAAGA
C10             GGTACTCATACCTGAGCCAGAGAAGCAAAGA
C11             GGTGCTAATACCAGAGCCAGAGAAGCAAAGA
C12             GGTGCTAATACCAGAGCCAGAGAAGCAAAGA
C13             GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C14             GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
C15             GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
                ***.**.***** ********.*********



>C1
GGGGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C2
GGAGTGGCTTTAGGAGTAATGGAGGCCCTGGGAACATTGCCAGGACACAT
GACAGAGAGGTTTCAGGAGGCCATTGACAATCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGCAGGCCTTACAAGGCAGCGGCAGCCCAACTGCCGGAG
ACCCTAGAGACCATCATGCTCTTAGGCTTGTTGGGAACAGTTTCGTTGGG
GATCTTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGTTTTG
GAATGGTAACTCTTGGGGCCAGTGCATGGCTCATGTGGCTTTCGGAAATT
GAACCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCTTGTTACTGGT
GGTACTCATACCCGAGCCAGAGAAGCAAAGA
>C3
GGAGCGGTTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGTTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C4
GGAGCGGCTTTTGGAGTGATGGAAGCCTTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCCTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C5
GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGTCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATCATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTTATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C6
GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACTATCATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATGGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGAGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C7
GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AGTCTTCTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACCCTTGGGGCCAGTGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C8
GGAGCGGCTTTTAGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACCCTTGGGGCCAGTGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C9
GGAGCGGCTTTGGGAGTGATGGATGCCCTGGGAACATTGCCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGACAATCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGTAGGCCCTACAAAGCAGCGGCAGCTCAACTGCCGGAG
ACCCTAGAGACCATCATGCTTTTGGGCTTATTGGGAACAGTTTCGCTAGG
AATCTTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGCTTCG
GAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTTTCGGAAATT
GAACCAGCCAGAATCGCATGTGTCCTCATTGTCGTGTTTTTGTTACTGGT
GGTGCTCATACCCGAGCCAGAGAAGCAAAGA
>C10
GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTGCCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGACAATCTCGCTGTGCTTATGCGAG
CAGAAACTGGAAGCAGGCCTTACAAGGCAGCGGCAGCCCCACTGCCGGAG
ACCCTAGAGACCATCATGCTCTTAGGTTTGCTGGGAACAGTTTCGTTGGG
GATATTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGGTTTG
GAATGGTAACTCTTGGGGCCAGTGCATGGCTCATGTGGCTTTCGGAAATT
GAACCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTTTTGTTACTGGT
GGTACTCATACCTGAGCCAGAGAAGCAAAGA
>C11
GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTACCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGATAACCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGCAGGCCCTACAAGGCAGCGGCAGCCCAATTGCCGGAG
ACCCTAGAGACCATCATGCTTTTAGGCCTGCTGGGAACAGTATCGCTGGG
GATCTTTTTTGTCTTGATGAGGAACAAGGGCATCGGGAAGATGGGCTTTG
GAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCAGAAATC
GAACCAGCCAGAATTGCATGTGTCCTTATTGTTGTGTTTTTATTACTGGT
GGTGCTAATACCAGAGCCAGAGAAGCAAAGA
>C12
GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTACCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGATAACCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGCAGGCCCTACAAGGCAGCGGCAGCCCAATTGCCGGAG
ACCCTAGAGACCATCATGCTTTTAGGCCTGCTGGGAACAGTATCGCTGGG
GATCTTTTTTGTCTTGATGAGGAACAAGGGCATCGGGAAGATGGGCTTTG
AAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCAGAAATC
GAACCAGCCAGAATTGCATGTGTCCTTATTGTTGTGTTTTTATTACTGGT
GGTGCTAATACCAGAGCCAGAGAAGCAAAGA
>C13
GGAGCGGCTCTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAAATGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTAGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C14
GGAGCGGCCTTTGGAGTGATAGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGCGGAACAAGGGCATGGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTTATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTCGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C15
GGAGCGACTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCTTAGAGACCATTATGCTTTTGGGATTGCTGGGAACAGTCTCGTTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>C1
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C2
GVALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C3
GAVFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C4
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFLLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C5
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKVAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C6
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C7
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGVFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C8
GAAFRVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C9
GAALGVMDALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C10
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAPLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C11
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C12
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFEMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C13
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C14
GAAFGVIEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>C15
GATFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 15 taxa and 381 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Taxon 13 -> C13
      Taxon 14 -> C14
      Taxon 15 -> C15
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1509961992
      Setting output file names to "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1501355825
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5648014110
      Seed = 569625822
      Swapseed = 1509961992
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 17 unique site patterns
      Division 2 has 9 unique site patterns
      Division 3 has 46 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2122.712440 -- -26.563281
         Chain 2 -- -2061.450002 -- -26.563281
         Chain 3 -- -2096.053084 -- -26.563281
         Chain 4 -- -2121.785919 -- -26.563281

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2063.070718 -- -26.563281
         Chain 2 -- -2117.218230 -- -26.563281
         Chain 3 -- -2115.880162 -- -26.563281
         Chain 4 -- -2018.704799 -- -26.563281


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2122.712] (-2061.450) (-2096.053) (-2121.786) * [-2063.071] (-2117.218) (-2115.880) (-2018.705) 
        500 -- (-1157.218) (-1146.766) [-1144.973] (-1150.203) * [-1146.055] (-1151.908) (-1165.783) (-1149.685) -- 0:00:00
       1000 -- [-1126.555] (-1115.340) (-1128.653) (-1119.764) * (-1118.870) (-1091.385) (-1138.310) [-1117.931] -- 0:00:00
       1500 -- (-1120.712) [-1090.222] (-1149.753) (-1121.279) * (-1110.002) [-1083.896] (-1133.033) (-1098.529) -- 0:00:00
       2000 -- [-1096.012] (-1083.753) (-1123.807) (-1111.781) * (-1088.036) [-1069.870] (-1145.181) (-1088.471) -- 0:00:00
       2500 -- (-1079.824) (-1073.945) (-1103.697) [-1090.260] * (-1082.260) [-1071.293] (-1125.242) (-1099.408) -- 0:06:39
       3000 -- (-1083.208) [-1063.621] (-1098.395) (-1071.145) * (-1091.324) [-1070.450] (-1120.889) (-1079.108) -- 0:05:32
       3500 -- (-1089.524) [-1068.100] (-1096.101) (-1069.084) * [-1070.071] (-1066.217) (-1101.414) (-1068.479) -- 0:04:44
       4000 -- (-1071.689) [-1063.602] (-1079.157) (-1074.677) * [-1059.633] (-1067.692) (-1093.934) (-1077.105) -- 0:04:09
       4500 -- (-1069.280) [-1067.115] (-1079.591) (-1062.088) * (-1066.542) [-1058.703] (-1088.006) (-1074.652) -- 0:03:41
       5000 -- [-1057.347] (-1062.831) (-1071.985) (-1068.033) * [-1062.357] (-1083.973) (-1075.967) (-1078.577) -- 0:03:19

      Average standard deviation of split frequencies: 0.082981

       5500 -- (-1059.273) [-1052.736] (-1065.103) (-1065.112) * [-1055.365] (-1071.562) (-1073.475) (-1053.089) -- 0:03:00
       6000 -- (-1069.154) [-1053.682] (-1059.354) (-1062.164) * [-1054.808] (-1074.999) (-1085.496) (-1065.724) -- 0:05:31
       6500 -- (-1065.002) (-1065.358) (-1065.280) [-1054.496] * (-1061.942) (-1068.897) (-1081.564) [-1058.263] -- 0:05:05
       7000 -- [-1063.264] (-1072.233) (-1076.396) (-1069.753) * [-1055.143] (-1080.417) (-1076.431) (-1080.932) -- 0:04:43
       7500 -- [-1055.875] (-1068.039) (-1068.955) (-1072.723) * (-1063.780) (-1070.887) [-1057.472] (-1060.020) -- 0:04:24
       8000 -- [-1057.562] (-1068.235) (-1069.663) (-1069.772) * (-1071.901) (-1048.524) [-1055.402] (-1074.415) -- 0:04:08
       8500 -- [-1056.540] (-1071.794) (-1070.528) (-1061.265) * (-1065.225) [-1053.121] (-1057.870) (-1066.805) -- 0:03:53
       9000 -- (-1073.210) (-1069.096) (-1058.514) [-1050.113] * (-1068.015) [-1052.949] (-1056.674) (-1072.780) -- 0:05:30
       9500 -- (-1054.471) (-1070.494) (-1079.180) [-1054.809] * (-1063.222) [-1058.036] (-1065.524) (-1063.045) -- 0:05:12
      10000 -- (-1064.504) (-1060.764) (-1064.244) [-1056.953] * (-1069.523) [-1058.369] (-1062.968) (-1081.864) -- 0:04:57

      Average standard deviation of split frequencies: 0.071202

      10500 -- (-1069.632) (-1071.640) (-1060.063) [-1052.093] * (-1076.279) (-1054.172) [-1050.507] (-1061.044) -- 0:04:42
      11000 -- (-1052.896) (-1064.273) (-1057.821) [-1058.098] * (-1067.566) [-1060.570] (-1062.860) (-1068.729) -- 0:04:29
      11500 -- [-1051.786] (-1063.457) (-1070.353) (-1058.785) * (-1074.022) (-1073.388) (-1053.931) [-1059.347] -- 0:04:17
      12000 -- [-1056.342] (-1070.563) (-1054.300) (-1060.244) * (-1057.780) (-1066.966) (-1059.276) [-1069.244] -- 0:05:29
      12500 -- [-1054.609] (-1073.912) (-1057.622) (-1075.286) * (-1063.426) [-1060.481] (-1065.074) (-1075.817) -- 0:05:16
      13000 -- [-1060.515] (-1069.728) (-1070.208) (-1061.948) * (-1052.532) [-1062.673] (-1067.455) (-1063.158) -- 0:05:03
      13500 -- (-1062.351) (-1062.445) (-1058.044) [-1056.197] * [-1054.999] (-1061.103) (-1080.858) (-1072.551) -- 0:04:52
      14000 -- (-1072.837) [-1059.966] (-1083.358) (-1061.541) * (-1061.384) (-1057.881) [-1060.989] (-1066.134) -- 0:04:41
      14500 -- (-1075.772) (-1061.738) (-1053.590) [-1055.801] * (-1082.673) [-1051.071] (-1054.543) (-1060.567) -- 0:04:31
      15000 -- (-1065.651) (-1059.992) [-1055.383] (-1052.331) * (-1073.339) (-1051.087) [-1056.000] (-1063.102) -- 0:05:28

      Average standard deviation of split frequencies: 0.065800

      15500 -- (-1067.781) [-1059.368] (-1075.918) (-1055.438) * (-1063.466) (-1061.357) [-1047.637] (-1063.948) -- 0:05:17
      16000 -- [-1058.010] (-1061.417) (-1067.007) (-1060.105) * (-1059.264) (-1070.479) [-1050.754] (-1064.767) -- 0:05:07
      16500 -- [-1060.942] (-1074.332) (-1058.231) (-1055.422) * (-1062.930) (-1070.657) [-1056.833] (-1061.797) -- 0:04:58
      17000 -- (-1061.325) [-1061.475] (-1052.244) (-1064.368) * (-1058.797) (-1062.038) (-1072.777) [-1050.730] -- 0:04:49
      17500 -- (-1055.185) (-1061.869) [-1058.758] (-1077.176) * (-1062.164) (-1066.815) [-1059.112] (-1062.987) -- 0:04:40
      18000 -- (-1057.015) [-1055.800] (-1069.610) (-1068.386) * (-1049.310) (-1080.791) [-1060.373] (-1067.564) -- 0:05:27
      18500 -- [-1058.460] (-1055.093) (-1074.606) (-1051.029) * [-1059.222] (-1079.796) (-1062.984) (-1086.023) -- 0:05:18
      19000 -- (-1059.857) (-1070.932) [-1063.109] (-1060.902) * [-1050.275] (-1072.876) (-1061.105) (-1066.281) -- 0:05:09
      19500 -- [-1056.358] (-1053.501) (-1060.884) (-1072.904) * (-1065.407) (-1071.045) (-1059.921) [-1061.196] -- 0:05:01
      20000 -- (-1057.845) (-1056.595) (-1065.970) [-1054.191] * (-1055.970) (-1058.833) (-1067.785) [-1059.538] -- 0:04:54

      Average standard deviation of split frequencies: 0.046657

      20500 -- [-1060.508] (-1065.098) (-1057.497) (-1071.407) * (-1068.088) (-1074.466) [-1063.841] (-1050.593) -- 0:04:46
      21000 -- [-1053.176] (-1063.110) (-1069.316) (-1070.339) * (-1069.415) [-1063.504] (-1072.740) (-1057.218) -- 0:05:26
      21500 -- [-1060.834] (-1065.336) (-1063.524) (-1067.272) * [-1065.181] (-1051.431) (-1063.510) (-1069.441) -- 0:05:18
      22000 -- (-1054.816) (-1061.951) (-1063.054) [-1055.242] * (-1061.658) (-1056.965) [-1053.579] (-1071.579) -- 0:05:11
      22500 -- (-1061.236) (-1060.856) (-1069.875) [-1048.828] * (-1061.016) (-1071.025) [-1054.525] (-1057.655) -- 0:05:04
      23000 -- (-1074.309) (-1056.966) [-1057.416] (-1061.513) * (-1058.050) (-1065.518) [-1063.114] (-1061.252) -- 0:04:57
      23500 -- (-1071.178) [-1062.251] (-1057.230) (-1069.977) * [-1057.290] (-1061.464) (-1056.919) (-1067.841) -- 0:04:50
      24000 -- [-1054.430] (-1066.594) (-1061.010) (-1069.309) * (-1064.938) (-1050.126) [-1052.588] (-1066.381) -- 0:04:44
      24500 -- [-1061.488] (-1074.071) (-1071.863) (-1054.603) * [-1056.703] (-1058.474) (-1059.396) (-1069.078) -- 0:05:18
      25000 -- (-1071.398) (-1063.462) [-1067.670] (-1065.771) * (-1051.399) (-1053.945) [-1051.805] (-1065.207) -- 0:05:12

      Average standard deviation of split frequencies: 0.044680

      25500 -- (-1061.573) (-1058.975) (-1060.000) [-1058.164] * [-1065.265] (-1059.916) (-1065.072) (-1069.259) -- 0:05:05
      26000 -- (-1066.497) (-1055.821) (-1061.595) [-1061.497] * [-1055.057] (-1065.447) (-1059.905) (-1077.571) -- 0:04:59
      26500 -- (-1065.950) (-1065.055) [-1054.342] (-1059.391) * (-1056.232) [-1056.419] (-1058.980) (-1059.410) -- 0:04:53
      27000 -- [-1056.648] (-1063.389) (-1063.580) (-1052.277) * (-1067.553) [-1053.818] (-1075.506) (-1062.466) -- 0:04:48
      27500 -- (-1057.321) (-1069.622) (-1069.171) [-1062.998] * (-1067.317) [-1051.802] (-1076.318) (-1058.460) -- 0:05:18
      28000 -- (-1061.971) [-1059.463] (-1070.812) (-1061.496) * (-1054.624) (-1069.797) (-1065.571) [-1050.113] -- 0:05:12
      28500 -- (-1073.885) (-1064.592) (-1073.559) [-1054.890] * (-1065.402) (-1074.606) [-1058.006] (-1074.647) -- 0:05:06
      29000 -- (-1063.600) [-1052.197] (-1060.063) (-1066.320) * (-1067.798) [-1058.623] (-1066.462) (-1060.218) -- 0:05:01
      29500 -- (-1081.065) (-1064.137) [-1068.240] (-1056.180) * (-1056.638) (-1053.850) [-1062.321] (-1066.192) -- 0:04:56
      30000 -- [-1061.552] (-1078.570) (-1063.233) (-1057.355) * (-1066.990) (-1055.963) (-1072.774) [-1062.215] -- 0:04:51

      Average standard deviation of split frequencies: 0.039432

      30500 -- (-1063.322) (-1064.735) (-1063.053) [-1059.768] * (-1061.725) [-1050.303] (-1066.754) (-1068.053) -- 0:05:17
      31000 -- (-1060.448) (-1069.235) [-1052.646] (-1062.417) * (-1057.529) (-1078.611) (-1058.098) [-1065.995] -- 0:05:12
      31500 -- [-1056.236] (-1070.188) (-1049.021) (-1067.032) * (-1061.954) (-1068.941) [-1063.736] (-1063.786) -- 0:05:07
      32000 -- (-1058.581) (-1066.754) [-1057.734] (-1074.466) * [-1060.644] (-1055.267) (-1066.489) (-1062.099) -- 0:05:02
      32500 -- (-1063.885) (-1062.199) [-1063.403] (-1062.548) * [-1057.843] (-1063.445) (-1074.144) (-1055.943) -- 0:04:57
      33000 -- [-1055.583] (-1064.049) (-1061.414) (-1075.094) * (-1057.758) (-1062.854) (-1061.682) [-1060.587] -- 0:04:53
      33500 -- [-1052.525] (-1064.892) (-1071.647) (-1071.972) * (-1061.729) (-1066.319) [-1055.456] (-1066.027) -- 0:05:17
      34000 -- (-1054.300) (-1075.146) (-1077.513) [-1057.246] * (-1068.662) (-1066.947) (-1061.665) [-1066.574] -- 0:05:12
      34500 -- (-1060.011) (-1070.383) [-1060.760] (-1057.423) * (-1074.512) (-1075.076) [-1056.935] (-1070.950) -- 0:05:07
      35000 -- [-1055.679] (-1071.059) (-1067.167) (-1060.372) * (-1074.399) (-1054.814) (-1061.081) [-1061.920] -- 0:05:03

      Average standard deviation of split frequencies: 0.032392

      35500 -- (-1061.962) (-1073.996) [-1058.411] (-1066.072) * (-1059.651) (-1062.923) [-1054.051] (-1066.084) -- 0:04:58
      36000 -- [-1053.658] (-1065.955) (-1052.390) (-1059.277) * (-1066.389) (-1057.375) [-1063.601] (-1064.819) -- 0:04:54
      36500 -- (-1066.170) (-1056.164) (-1057.620) [-1051.576] * (-1069.086) [-1062.711] (-1060.687) (-1057.363) -- 0:05:16
      37000 -- (-1070.006) (-1067.066) [-1072.054] (-1060.782) * [-1055.213] (-1057.762) (-1070.537) (-1062.019) -- 0:05:12
      37500 -- (-1055.962) (-1063.797) (-1065.003) [-1072.660] * [-1062.195] (-1077.666) (-1068.427) (-1054.972) -- 0:05:08
      38000 -- [-1057.590] (-1062.060) (-1064.116) (-1080.347) * [-1062.919] (-1063.666) (-1062.965) (-1067.791) -- 0:05:03
      38500 -- (-1070.461) (-1069.037) [-1067.805] (-1064.297) * (-1066.824) (-1070.664) (-1057.101) [-1056.421] -- 0:04:59
      39000 -- [-1065.733] (-1076.478) (-1048.799) (-1065.502) * (-1082.139) (-1076.321) (-1072.577) [-1057.608] -- 0:04:55
      39500 -- (-1071.112) [-1062.248] (-1059.146) (-1062.390) * (-1058.919) [-1059.358] (-1066.263) (-1060.808) -- 0:04:51
      40000 -- (-1067.863) (-1059.290) (-1056.546) [-1059.699] * [-1051.114] (-1065.173) (-1070.165) (-1069.936) -- 0:05:12

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-1057.155) [-1061.440] (-1054.424) (-1070.315) * [-1068.218] (-1068.273) (-1053.793) (-1066.444) -- 0:05:07
      41000 -- [-1063.725] (-1057.282) (-1061.829) (-1062.762) * (-1057.225) (-1069.354) (-1057.426) [-1056.715] -- 0:05:04
      41500 -- (-1071.783) (-1051.429) (-1071.113) [-1062.074] * (-1058.199) (-1068.918) [-1047.539] (-1070.533) -- 0:05:00
      42000 -- (-1063.199) (-1057.152) (-1070.543) [-1059.399] * (-1065.519) (-1077.742) (-1053.540) [-1051.493] -- 0:04:56
      42500 -- (-1057.819) (-1052.539) (-1062.048) [-1058.382] * (-1078.809) (-1068.783) (-1069.545) [-1056.189] -- 0:04:52
      43000 -- [-1058.323] (-1070.131) (-1054.965) (-1069.547) * (-1094.109) (-1061.874) (-1069.760) [-1054.416] -- 0:05:11
      43500 -- (-1059.075) (-1073.533) (-1055.793) [-1063.046] * (-1057.905) (-1065.698) (-1060.707) [-1061.077] -- 0:05:07
      44000 -- (-1060.056) (-1063.590) (-1056.969) [-1051.499] * (-1063.801) (-1069.314) (-1071.965) [-1054.955] -- 0:05:04
      44500 -- (-1076.095) (-1059.008) [-1064.088] (-1070.202) * (-1060.087) (-1052.594) [-1048.939] (-1060.560) -- 0:05:00
      45000 -- (-1066.702) (-1058.829) (-1065.121) [-1058.408] * [-1050.682] (-1068.026) (-1069.106) (-1073.431) -- 0:04:57

      Average standard deviation of split frequencies: 0.024888

      45500 -- (-1090.552) (-1062.867) (-1068.485) [-1048.197] * [-1060.408] (-1057.017) (-1055.368) (-1069.029) -- 0:05:14
      46000 -- [-1062.780] (-1061.613) (-1070.340) (-1065.451) * (-1053.498) (-1075.202) [-1057.327] (-1059.391) -- 0:05:11
      46500 -- (-1055.483) [-1058.193] (-1075.664) (-1057.918) * [-1057.507] (-1073.699) (-1064.520) (-1051.281) -- 0:05:07
      47000 -- (-1065.192) (-1061.070) [-1064.401] (-1054.352) * [-1069.990] (-1058.003) (-1060.644) (-1056.740) -- 0:05:04
      47500 -- (-1058.135) (-1075.273) (-1066.657) [-1055.681] * (-1052.749) (-1073.833) (-1056.307) [-1048.284] -- 0:05:00
      48000 -- (-1053.921) (-1080.414) (-1058.201) [-1060.818] * [-1061.234] (-1064.115) (-1071.054) (-1063.708) -- 0:04:57
      48500 -- (-1071.287) (-1053.395) (-1066.349) [-1059.228] * [-1071.844] (-1073.645) (-1053.221) (-1056.155) -- 0:05:13
      49000 -- [-1062.508] (-1074.120) (-1065.481) (-1070.810) * (-1069.826) (-1059.753) (-1068.807) [-1063.711] -- 0:05:10
      49500 -- (-1060.418) [-1057.120] (-1067.724) (-1051.640) * (-1064.640) (-1066.111) (-1076.534) [-1068.282] -- 0:05:07
      50000 -- (-1075.136) (-1062.472) (-1055.877) [-1066.146] * (-1073.450) (-1055.506) (-1058.681) [-1054.714] -- 0:05:04

      Average standard deviation of split frequencies: 0.027469

      50500 -- (-1059.478) [-1052.943] (-1055.359) (-1061.791) * (-1068.115) [-1063.718] (-1055.114) (-1061.085) -- 0:05:00
      51000 -- (-1076.666) (-1055.796) [-1063.582] (-1058.281) * (-1068.343) [-1061.121] (-1053.575) (-1068.127) -- 0:04:57
      51500 -- (-1056.195) (-1062.362) [-1048.581] (-1059.190) * (-1066.962) (-1061.904) [-1048.832] (-1061.843) -- 0:04:54
      52000 -- (-1066.006) (-1052.322) [-1053.232] (-1059.177) * (-1067.087) [-1064.816] (-1059.106) (-1073.979) -- 0:05:09
      52500 -- (-1069.245) (-1059.771) (-1063.307) [-1058.422] * (-1064.651) (-1069.630) [-1054.859] (-1073.378) -- 0:05:06
      53000 -- (-1061.318) (-1059.547) (-1071.367) [-1059.010] * (-1071.226) [-1051.106] (-1057.416) (-1071.436) -- 0:05:03
      53500 -- (-1067.894) [-1058.004] (-1072.845) (-1067.002) * (-1069.456) [-1060.808] (-1063.702) (-1063.554) -- 0:05:00
      54000 -- [-1054.021] (-1062.852) (-1071.062) (-1063.268) * (-1058.591) (-1068.708) [-1057.497] (-1065.509) -- 0:04:57
      54500 -- (-1064.599) (-1060.704) (-1063.067) [-1053.064] * (-1060.957) (-1070.290) (-1051.430) [-1069.375] -- 0:04:54
      55000 -- (-1065.965) (-1056.868) [-1082.856] (-1066.813) * [-1065.264] (-1055.833) (-1053.939) (-1056.147) -- 0:05:09

      Average standard deviation of split frequencies: 0.032736

      55500 -- [-1050.129] (-1061.886) (-1069.727) (-1057.928) * (-1062.283) [-1062.276] (-1056.955) (-1060.002) -- 0:05:06
      56000 -- [-1060.345] (-1080.032) (-1058.139) (-1063.892) * (-1058.591) (-1071.992) [-1053.336] (-1064.751) -- 0:05:03
      56500 -- (-1064.839) (-1070.493) (-1056.777) [-1058.902] * [-1059.746] (-1055.488) (-1059.428) (-1080.930) -- 0:05:00
      57000 -- (-1074.122) [-1078.468] (-1048.534) (-1076.161) * (-1063.932) (-1063.693) (-1081.537) [-1068.004] -- 0:04:57
      57500 -- (-1053.718) [-1057.485] (-1062.962) (-1066.111) * (-1060.194) (-1058.243) (-1073.656) [-1059.735] -- 0:04:55
      58000 -- [-1074.132] (-1079.569) (-1064.860) (-1065.220) * [-1053.235] (-1067.159) (-1066.261) (-1062.767) -- 0:05:08
      58500 -- (-1062.231) (-1072.403) (-1065.215) [-1059.307] * [-1061.697] (-1075.504) (-1067.013) (-1064.259) -- 0:05:05
      59000 -- (-1063.921) (-1061.507) (-1057.733) [-1049.186] * (-1072.077) (-1062.108) (-1071.812) [-1048.622] -- 0:05:03
      59500 -- (-1070.096) (-1061.874) (-1061.884) [-1064.300] * (-1071.236) [-1062.602] (-1070.110) (-1055.939) -- 0:05:00
      60000 -- [-1053.088] (-1067.209) (-1067.448) (-1063.975) * [-1066.229] (-1070.172) (-1056.223) (-1059.370) -- 0:04:57

      Average standard deviation of split frequencies: 0.031945

      60500 -- [-1057.951] (-1067.891) (-1051.545) (-1051.277) * [-1060.695] (-1070.094) (-1071.742) (-1062.149) -- 0:04:55
      61000 -- [-1062.393] (-1047.832) (-1079.928) (-1068.061) * [-1073.645] (-1062.841) (-1063.499) (-1061.365) -- 0:05:07
      61500 -- (-1060.235) (-1063.096) (-1059.974) [-1073.466] * (-1060.719) (-1073.692) [-1063.019] (-1049.931) -- 0:05:05
      62000 -- (-1064.376) [-1053.382] (-1081.135) (-1064.797) * (-1051.083) [-1064.169] (-1079.103) (-1058.006) -- 0:05:02
      62500 -- (-1064.593) (-1064.994) [-1064.864] (-1060.051) * (-1065.218) [-1060.074] (-1072.355) (-1063.692) -- 0:05:00
      63000 -- (-1068.414) (-1075.580) (-1064.963) [-1059.646] * [-1060.139] (-1053.202) (-1058.736) (-1058.688) -- 0:04:57
      63500 -- (-1057.756) (-1075.898) (-1046.423) [-1051.819] * (-1064.647) (-1055.853) [-1054.546] (-1068.892) -- 0:04:54
      64000 -- (-1065.827) (-1080.911) [-1057.089] (-1059.679) * (-1051.534) (-1069.648) [-1055.305] (-1081.911) -- 0:04:52
      64500 -- (-1069.239) (-1060.607) (-1070.956) [-1062.007] * [-1061.151] (-1063.502) (-1064.861) (-1065.186) -- 0:05:04
      65000 -- (-1065.331) [-1058.115] (-1054.223) (-1082.128) * (-1063.163) (-1052.392) (-1065.584) [-1063.569] -- 0:05:02

      Average standard deviation of split frequencies: 0.026529

      65500 -- (-1062.748) [-1061.962] (-1057.858) (-1062.436) * (-1065.003) [-1049.178] (-1059.791) (-1065.204) -- 0:04:59
      66000 -- (-1061.138) [-1063.627] (-1065.516) (-1063.703) * (-1062.972) (-1061.533) (-1061.029) [-1060.959] -- 0:04:57
      66500 -- (-1058.450) (-1066.158) (-1063.688) [-1061.795] * (-1075.644) [-1057.030] (-1053.302) (-1062.192) -- 0:04:54
      67000 -- (-1065.943) (-1062.723) [-1064.166] (-1065.454) * (-1071.443) (-1053.209) [-1056.041] (-1061.088) -- 0:04:52
      67500 -- (-1060.974) (-1068.316) (-1075.195) [-1054.036] * (-1076.724) [-1050.757] (-1073.510) (-1068.264) -- 0:05:03
      68000 -- (-1067.971) [-1054.287] (-1068.058) (-1050.482) * (-1071.237) [-1055.923] (-1055.183) (-1061.310) -- 0:05:01
      68500 -- (-1055.473) (-1070.963) (-1066.902) [-1058.611] * (-1060.634) [-1054.631] (-1065.676) (-1065.685) -- 0:04:59
      69000 -- (-1062.230) (-1060.129) [-1059.164] (-1064.752) * (-1055.010) (-1071.357) [-1063.471] (-1067.883) -- 0:04:56
      69500 -- (-1066.219) (-1065.620) [-1058.678] (-1061.952) * (-1047.941) (-1076.040) (-1061.728) [-1060.223] -- 0:04:54
      70000 -- (-1064.506) (-1069.227) (-1060.715) [-1061.403] * (-1061.867) (-1079.346) (-1053.033) [-1068.128] -- 0:04:52

      Average standard deviation of split frequencies: 0.021013

      70500 -- (-1068.232) (-1060.024) (-1064.413) [-1058.284] * [-1061.126] (-1059.251) (-1074.067) (-1072.515) -- 0:05:03
      71000 -- [-1071.224] (-1053.685) (-1067.237) (-1071.766) * (-1061.499) (-1056.316) [-1050.494] (-1064.669) -- 0:05:00
      71500 -- (-1058.271) (-1066.914) [-1061.576] (-1059.147) * (-1065.979) (-1067.996) [-1051.890] (-1067.171) -- 0:04:58
      72000 -- (-1071.310) (-1073.204) (-1080.685) [-1053.057] * (-1050.040) (-1071.554) [-1058.004] (-1051.617) -- 0:04:56
      72500 -- [-1052.789] (-1057.381) (-1086.514) (-1055.669) * (-1053.425) (-1064.266) (-1069.929) [-1053.447] -- 0:04:54
      73000 -- [-1052.883] (-1051.529) (-1069.717) (-1065.038) * (-1054.074) [-1055.324] (-1064.163) (-1063.391) -- 0:04:52
      73500 -- (-1070.483) (-1060.442) [-1060.397] (-1070.280) * [-1054.393] (-1063.051) (-1064.861) (-1058.625) -- 0:05:02
      74000 -- (-1077.254) (-1058.840) [-1074.519] (-1081.120) * [-1055.002] (-1073.959) (-1070.105) (-1067.334) -- 0:05:00
      74500 -- [-1056.498] (-1066.310) (-1051.365) (-1070.559) * (-1065.986) (-1073.491) (-1063.406) [-1056.576] -- 0:04:58
      75000 -- (-1060.557) (-1067.624) (-1076.941) [-1056.105] * (-1071.981) (-1055.190) [-1058.748] (-1056.534) -- 0:04:56

      Average standard deviation of split frequencies: 0.022622

      75500 -- [-1060.030] (-1060.161) (-1064.311) (-1061.060) * (-1060.052) (-1066.039) [-1063.446] (-1058.516) -- 0:04:53
      76000 -- (-1053.363) (-1064.067) (-1062.322) [-1051.715] * (-1077.819) (-1066.625) (-1061.854) [-1052.985] -- 0:04:51
      76500 -- (-1057.921) (-1082.062) (-1063.171) [-1050.015] * [-1057.105] (-1073.583) (-1058.375) (-1057.676) -- 0:05:01
      77000 -- (-1059.513) (-1063.142) [-1052.560] (-1086.733) * (-1057.982) (-1082.943) [-1064.149] (-1072.179) -- 0:04:59
      77500 -- (-1071.839) [-1053.579] (-1047.895) (-1060.581) * (-1053.562) (-1067.346) [-1059.717] (-1057.643) -- 0:04:57
      78000 -- (-1060.234) [-1057.650] (-1064.925) (-1072.996) * (-1075.564) (-1056.610) [-1057.742] (-1052.082) -- 0:04:55
      78500 -- (-1070.864) [-1054.653] (-1065.469) (-1079.977) * (-1069.311) [-1053.271] (-1069.000) (-1061.714) -- 0:04:53
      79000 -- (-1068.505) [-1062.522] (-1064.902) (-1069.007) * (-1067.051) [-1056.161] (-1073.749) (-1074.521) -- 0:04:51
      79500 -- (-1067.430) (-1060.126) [-1067.226] (-1061.777) * (-1079.559) [-1064.968] (-1085.036) (-1068.385) -- 0:05:01
      80000 -- (-1071.992) (-1068.678) (-1061.816) [-1060.189] * (-1058.264) [-1049.474] (-1076.539) (-1069.528) -- 0:04:59

      Average standard deviation of split frequencies: 0.021817

      80500 -- (-1053.603) (-1057.573) [-1058.982] (-1080.820) * [-1054.520] (-1054.687) (-1061.799) (-1063.717) -- 0:04:56
      81000 -- [-1066.833] (-1062.476) (-1055.348) (-1068.538) * [-1057.630] (-1066.655) (-1059.993) (-1072.656) -- 0:04:54
      81500 -- (-1062.868) (-1061.179) [-1056.903] (-1052.423) * [-1062.276] (-1059.010) (-1073.353) (-1061.499) -- 0:04:53
      82000 -- (-1059.827) (-1056.157) [-1057.105] (-1071.974) * (-1057.478) [-1060.352] (-1059.006) (-1054.872) -- 0:04:51
      82500 -- (-1072.936) (-1060.574) (-1063.124) [-1062.891] * (-1053.489) (-1076.136) (-1066.590) [-1061.102] -- 0:05:00
      83000 -- (-1067.840) (-1060.672) [-1065.903] (-1064.945) * [-1065.412] (-1071.467) (-1056.590) (-1056.807) -- 0:04:58
      83500 -- (-1066.454) (-1056.735) [-1053.315] (-1052.115) * (-1070.412) (-1062.145) (-1063.220) [-1061.230] -- 0:04:56
      84000 -- [-1061.705] (-1058.736) (-1061.196) (-1057.009) * (-1070.407) (-1054.998) [-1049.621] (-1047.947) -- 0:04:54
      84500 -- [-1057.502] (-1064.751) (-1074.272) (-1058.749) * (-1057.095) (-1056.395) (-1061.390) [-1069.067] -- 0:04:52
      85000 -- (-1072.101) [-1053.448] (-1065.575) (-1053.185) * (-1063.425) (-1057.332) [-1056.607] (-1058.058) -- 0:04:50

      Average standard deviation of split frequencies: 0.016749

      85500 -- [-1059.259] (-1061.137) (-1061.556) (-1058.256) * (-1055.572) (-1061.000) (-1063.262) [-1054.283] -- 0:04:59
      86000 -- (-1070.079) (-1050.810) (-1061.958) [-1064.556] * (-1072.985) (-1063.658) (-1057.584) [-1058.914] -- 0:04:57
      86500 -- (-1072.471) (-1050.144) [-1057.162] (-1053.448) * (-1068.794) (-1066.207) (-1064.976) [-1057.126] -- 0:04:55
      87000 -- (-1074.537) (-1060.203) [-1059.402] (-1069.641) * [-1053.187] (-1055.130) (-1076.462) (-1080.862) -- 0:04:53
      87500 -- (-1070.934) (-1065.697) [-1063.089] (-1057.466) * [-1059.061] (-1052.742) (-1062.551) (-1067.984) -- 0:04:52
      88000 -- (-1066.184) [-1063.542] (-1076.584) (-1053.991) * (-1062.360) (-1054.936) [-1065.420] (-1070.291) -- 0:04:50
      88500 -- (-1069.777) (-1070.605) (-1081.930) [-1059.154] * (-1064.174) (-1066.724) [-1060.811] (-1063.968) -- 0:04:58
      89000 -- (-1061.342) [-1061.089] (-1066.205) (-1063.301) * (-1067.791) [-1065.075] (-1064.666) (-1059.651) -- 0:04:56
      89500 -- (-1070.776) (-1055.846) [-1061.636] (-1079.922) * [-1052.195] (-1072.320) (-1064.221) (-1054.517) -- 0:04:55
      90000 -- (-1058.022) (-1073.120) [-1056.012] (-1062.469) * (-1063.604) (-1064.348) [-1052.733] (-1060.666) -- 0:04:53

      Average standard deviation of split frequencies: 0.016248

      90500 -- (-1063.985) (-1071.825) [-1055.802] (-1059.795) * (-1075.188) (-1057.895) [-1054.006] (-1065.368) -- 0:04:51
      91000 -- (-1057.090) (-1080.175) (-1066.704) [-1052.962] * (-1069.626) [-1060.906] (-1053.482) (-1070.950) -- 0:04:49
      91500 -- (-1060.040) (-1054.511) (-1081.557) [-1064.528] * (-1074.797) [-1069.770] (-1063.578) (-1050.744) -- 0:04:57
      92000 -- (-1064.492) (-1069.252) (-1064.182) [-1060.208] * (-1076.186) [-1063.203] (-1065.375) (-1061.008) -- 0:04:56
      92500 -- (-1078.377) (-1070.557) (-1071.027) [-1059.992] * (-1056.057) [-1057.848] (-1055.502) (-1068.738) -- 0:04:54
      93000 -- (-1061.619) [-1061.460] (-1064.999) (-1072.240) * (-1061.740) (-1067.605) [-1052.777] (-1059.346) -- 0:04:52
      93500 -- (-1055.331) [-1052.657] (-1082.868) (-1054.531) * (-1059.632) (-1062.595) [-1056.929] (-1084.556) -- 0:04:50
      94000 -- (-1053.669) (-1074.609) (-1065.349) [-1053.810] * (-1053.017) (-1072.176) [-1060.885] (-1067.563) -- 0:04:49
      94500 -- [-1057.917] (-1065.361) (-1061.718) (-1053.447) * (-1056.414) (-1066.178) [-1051.711] (-1063.959) -- 0:04:57
      95000 -- (-1062.247) [-1057.841] (-1065.475) (-1059.545) * (-1072.517) (-1069.578) [-1058.297] (-1059.060) -- 0:04:55

      Average standard deviation of split frequencies: 0.018332

      95500 -- [-1056.670] (-1069.153) (-1063.378) (-1062.834) * (-1067.017) (-1075.521) (-1061.027) [-1057.995] -- 0:04:53
      96000 -- (-1060.426) (-1068.105) [-1058.515] (-1061.748) * (-1071.058) (-1065.140) (-1059.599) [-1053.906] -- 0:04:51
      96500 -- (-1059.891) (-1070.097) [-1060.656] (-1064.212) * (-1064.104) [-1058.232] (-1065.056) (-1067.753) -- 0:04:50
      97000 -- [-1064.918] (-1056.580) (-1068.371) (-1062.953) * (-1064.717) [-1056.179] (-1062.826) (-1059.093) -- 0:04:48
      97500 -- (-1070.734) (-1065.644) [-1066.648] (-1058.915) * (-1066.082) [-1065.273] (-1065.275) (-1057.109) -- 0:04:56
      98000 -- [-1063.832] (-1065.150) (-1061.351) (-1080.885) * [-1054.367] (-1077.162) (-1093.963) (-1062.685) -- 0:04:54
      98500 -- (-1067.347) [-1057.457] (-1056.079) (-1061.981) * (-1062.576) [-1061.835] (-1068.283) (-1054.360) -- 0:04:52
      99000 -- (-1066.761) (-1055.768) [-1061.794] (-1067.790) * (-1056.188) (-1064.334) (-1062.443) [-1050.838] -- 0:04:51
      99500 -- [-1057.797] (-1070.208) (-1070.261) (-1066.677) * (-1068.836) (-1054.493) [-1057.188] (-1070.853) -- 0:04:49
      100000 -- (-1051.114) (-1061.379) (-1062.968) [-1056.406] * (-1066.989) [-1058.360] (-1054.820) (-1068.932) -- 0:04:48

      Average standard deviation of split frequencies: 0.016210

      100500 -- (-1056.987) (-1075.757) [-1052.821] (-1056.940) * (-1064.524) [-1060.479] (-1062.137) (-1067.490) -- 0:04:46
      101000 -- (-1063.737) [-1062.539] (-1065.687) (-1070.791) * (-1057.972) [-1051.848] (-1070.521) (-1076.554) -- 0:04:53
      101500 -- (-1065.209) (-1071.490) [-1068.726] (-1066.274) * (-1061.804) (-1056.892) (-1067.760) [-1059.641] -- 0:04:52
      102000 -- (-1068.298) (-1063.160) [-1061.380] (-1061.850) * [-1066.881] (-1061.603) (-1059.893) (-1070.823) -- 0:04:50
      102500 -- (-1062.464) (-1085.106) (-1063.100) [-1056.961] * [-1057.873] (-1059.304) (-1059.754) (-1054.673) -- 0:04:48
      103000 -- [-1049.493] (-1077.431) (-1062.774) (-1072.366) * (-1060.440) (-1076.789) (-1055.731) [-1055.535] -- 0:04:47
      103500 -- (-1056.929) (-1062.319) (-1066.415) [-1058.681] * [-1058.066] (-1048.422) (-1062.738) (-1052.898) -- 0:04:45
      104000 -- [-1061.597] (-1056.222) (-1058.492) (-1086.057) * (-1066.186) (-1075.141) [-1057.225] (-1054.786) -- 0:04:52
      104500 -- [-1065.401] (-1061.279) (-1059.644) (-1064.711) * (-1068.959) (-1057.579) (-1062.935) [-1060.141] -- 0:04:51
      105000 -- (-1062.788) (-1067.210) (-1059.290) [-1058.026] * (-1060.606) (-1066.356) [-1057.961] (-1060.634) -- 0:04:49

      Average standard deviation of split frequencies: 0.015736

      105500 -- (-1070.198) (-1058.597) (-1072.101) [-1065.317] * [-1059.841] (-1070.469) (-1066.710) (-1053.214) -- 0:04:48
      106000 -- (-1067.551) [-1053.579] (-1069.574) (-1055.021) * (-1045.685) (-1068.183) (-1074.599) [-1059.494] -- 0:04:46
      106500 -- (-1053.989) (-1057.855) (-1063.603) [-1060.415] * (-1063.369) (-1059.232) (-1078.865) [-1058.577] -- 0:04:45
      107000 -- (-1051.384) (-1075.499) [-1054.974] (-1064.711) * (-1057.972) (-1058.639) (-1078.178) [-1060.148] -- 0:04:52
      107500 -- [-1061.305] (-1058.825) (-1062.425) (-1074.777) * (-1063.550) [-1058.419] (-1073.074) (-1073.517) -- 0:04:50
      108000 -- (-1070.413) [-1052.172] (-1056.585) (-1065.393) * (-1054.737) [-1059.014] (-1062.666) (-1071.511) -- 0:04:49
      108500 -- [-1055.200] (-1057.829) (-1074.670) (-1059.840) * (-1068.127) (-1056.697) (-1055.342) [-1067.366] -- 0:04:47
      109000 -- (-1064.266) (-1062.495) [-1061.645] (-1057.421) * [-1059.240] (-1067.448) (-1064.019) (-1067.446) -- 0:04:46
      109500 -- (-1059.772) (-1063.723) (-1065.622) [-1061.574] * (-1076.235) (-1051.252) [-1064.789] (-1060.926) -- 0:04:44
      110000 -- [-1058.657] (-1067.442) (-1064.184) (-1067.258) * [-1057.860] (-1062.569) (-1075.649) (-1062.853) -- 0:04:51

      Average standard deviation of split frequencies: 0.013388

      110500 -- [-1063.753] (-1059.362) (-1054.245) (-1059.821) * [-1051.618] (-1067.211) (-1061.899) (-1056.664) -- 0:04:49
      111000 -- (-1072.475) (-1066.100) (-1062.896) [-1064.629] * (-1059.023) (-1059.578) (-1069.102) [-1062.098] -- 0:04:48
      111500 -- [-1062.829] (-1068.741) (-1064.045) (-1058.209) * (-1063.734) (-1063.673) [-1059.955] (-1077.604) -- 0:04:46
      112000 -- [-1065.103] (-1070.769) (-1062.077) (-1063.335) * (-1066.559) (-1062.381) (-1056.499) [-1068.031] -- 0:04:45
      112500 -- (-1059.058) (-1074.717) (-1062.596) [-1068.096] * [-1063.894] (-1055.042) (-1058.905) (-1072.838) -- 0:04:44
      113000 -- (-1079.304) (-1061.331) (-1060.836) [-1054.952] * (-1061.654) (-1055.165) (-1057.943) [-1066.765] -- 0:04:50
      113500 -- (-1066.641) (-1054.596) (-1062.049) [-1057.077] * (-1063.056) [-1049.555] (-1069.245) (-1058.529) -- 0:04:48
      114000 -- (-1064.052) [-1052.193] (-1059.097) (-1059.528) * [-1060.021] (-1054.963) (-1081.811) (-1069.326) -- 0:04:47
      114500 -- [-1067.706] (-1066.125) (-1060.044) (-1064.150) * (-1074.280) [-1058.424] (-1056.623) (-1060.633) -- 0:04:46
      115000 -- (-1071.044) (-1067.656) (-1056.589) [-1057.701] * (-1063.996) (-1064.506) (-1061.036) [-1066.280] -- 0:04:44

      Average standard deviation of split frequencies: 0.019811

      115500 -- (-1070.487) (-1061.903) (-1073.758) [-1067.411] * [-1065.267] (-1068.402) (-1065.655) (-1079.906) -- 0:04:43
      116000 -- (-1075.170) (-1071.462) [-1067.439] (-1057.190) * (-1061.811) (-1063.613) (-1069.346) [-1071.158] -- 0:04:49
      116500 -- (-1059.918) (-1064.301) (-1062.893) [-1057.346] * [-1060.545] (-1059.673) (-1064.222) (-1068.439) -- 0:04:48
      117000 -- [-1061.515] (-1076.233) (-1060.273) (-1059.430) * (-1062.607) (-1056.799) [-1061.967] (-1068.569) -- 0:04:46
      117500 -- (-1062.361) (-1083.818) (-1056.286) [-1049.703] * (-1077.107) (-1052.788) (-1070.406) [-1060.092] -- 0:04:45
      118000 -- [-1055.532] (-1066.847) (-1057.109) (-1064.112) * (-1054.271) (-1053.739) (-1064.468) [-1066.976] -- 0:04:44
      118500 -- (-1069.095) (-1058.968) (-1058.403) [-1056.932] * [-1053.811] (-1065.144) (-1065.967) (-1060.090) -- 0:04:42
      119000 -- (-1065.168) (-1065.284) [-1051.966] (-1059.541) * [-1055.796] (-1061.290) (-1070.193) (-1060.466) -- 0:04:48
      119500 -- (-1057.267) (-1058.574) [-1055.843] (-1068.424) * (-1054.001) (-1057.046) (-1078.496) [-1059.393] -- 0:04:47
      120000 -- [-1052.975] (-1081.622) (-1054.626) (-1066.263) * [-1055.812] (-1072.737) (-1080.771) (-1063.432) -- 0:04:46

      Average standard deviation of split frequencies: 0.020510

      120500 -- [-1057.507] (-1074.037) (-1064.140) (-1061.297) * (-1059.141) [-1056.507] (-1066.957) (-1068.499) -- 0:04:44
      121000 -- (-1056.711) (-1057.586) (-1057.335) [-1056.261] * (-1061.127) [-1061.158] (-1074.696) (-1054.829) -- 0:04:43
      121500 -- [-1058.961] (-1060.971) (-1054.894) (-1080.409) * [-1062.657] (-1058.600) (-1073.842) (-1056.968) -- 0:04:41
      122000 -- (-1059.828) (-1067.441) [-1062.100] (-1060.714) * (-1055.762) [-1063.823] (-1063.769) (-1063.609) -- 0:04:47
      122500 -- [-1058.991] (-1060.081) (-1068.436) (-1070.558) * (-1053.351) (-1054.552) (-1066.560) [-1064.659] -- 0:04:46
      123000 -- (-1065.800) (-1060.644) [-1065.332] (-1059.317) * (-1058.705) [-1047.850] (-1072.193) (-1057.258) -- 0:04:45
      123500 -- (-1053.917) [-1050.276] (-1066.974) (-1058.927) * [-1049.144] (-1056.026) (-1058.568) (-1081.710) -- 0:04:43
      124000 -- (-1072.941) [-1058.443] (-1067.721) (-1074.671) * (-1064.440) [-1061.684] (-1060.415) (-1068.685) -- 0:04:42
      124500 -- (-1065.794) (-1059.776) (-1062.102) [-1051.966] * (-1056.262) (-1052.892) [-1061.311] (-1064.952) -- 0:04:41
      125000 -- (-1058.525) (-1068.901) [-1067.166] (-1068.207) * [-1053.654] (-1065.896) (-1059.645) (-1054.933) -- 0:04:47

      Average standard deviation of split frequencies: 0.021980

      125500 -- [-1049.660] (-1071.363) (-1064.804) (-1054.239) * (-1055.777) (-1072.475) [-1070.503] (-1063.994) -- 0:04:45
      126000 -- (-1062.022) (-1064.844) (-1060.560) [-1053.444] * (-1053.911) (-1079.397) [-1058.230] (-1065.277) -- 0:04:44
      126500 -- [-1056.998] (-1049.344) (-1069.724) (-1062.146) * (-1057.729) (-1063.585) (-1070.678) [-1053.915] -- 0:04:43
      127000 -- (-1054.883) (-1053.841) [-1065.663] (-1056.874) * [-1060.116] (-1080.341) (-1067.715) (-1063.966) -- 0:04:41
      127500 -- (-1059.475) (-1063.288) (-1064.208) [-1061.566] * (-1068.999) (-1060.089) [-1058.292] (-1062.627) -- 0:04:40
      128000 -- [-1049.915] (-1065.148) (-1056.393) (-1070.041) * (-1065.111) [-1062.157] (-1057.748) (-1060.207) -- 0:04:46
      128500 -- (-1069.200) [-1062.760] (-1059.755) (-1062.994) * [-1062.489] (-1059.523) (-1062.215) (-1066.265) -- 0:04:44
      129000 -- [-1058.943] (-1061.274) (-1052.666) (-1071.923) * (-1056.278) (-1067.885) (-1051.043) [-1061.591] -- 0:04:43
      129500 -- (-1067.963) [-1058.931] (-1065.295) (-1058.142) * [-1058.924] (-1069.291) (-1055.468) (-1067.172) -- 0:04:42
      130000 -- (-1068.626) (-1065.825) [-1063.995] (-1068.753) * (-1054.996) [-1061.210] (-1053.805) (-1057.230) -- 0:04:41

      Average standard deviation of split frequencies: 0.020615

      130500 -- [-1056.954] (-1052.493) (-1068.671) (-1065.211) * [-1054.863] (-1067.462) (-1063.333) (-1062.356) -- 0:04:39
      131000 -- (-1061.513) [-1054.670] (-1055.853) (-1078.654) * [-1058.967] (-1056.592) (-1058.569) (-1060.816) -- 0:04:45
      131500 -- (-1063.291) (-1065.848) (-1059.511) [-1056.706] * (-1060.858) [-1068.708] (-1059.455) (-1066.579) -- 0:04:43
      132000 -- (-1063.780) [-1048.904] (-1060.757) (-1064.288) * (-1063.818) (-1055.283) [-1058.416] (-1075.705) -- 0:04:42
      132500 -- (-1073.529) [-1061.093] (-1065.197) (-1067.199) * (-1082.922) [-1060.914] (-1055.835) (-1062.104) -- 0:04:41
      133000 -- (-1056.023) (-1074.412) [-1061.355] (-1049.963) * (-1075.823) [-1057.723] (-1060.040) (-1065.096) -- 0:04:40
      133500 -- [-1057.051] (-1061.263) (-1058.025) (-1077.772) * (-1067.452) (-1060.148) (-1074.765) [-1061.697] -- 0:04:39
      134000 -- [-1051.683] (-1058.871) (-1073.417) (-1062.470) * (-1065.001) (-1063.366) (-1067.135) [-1053.160] -- 0:04:44
      134500 -- (-1070.446) (-1071.275) [-1066.631] (-1061.906) * (-1065.227) (-1059.168) (-1069.084) [-1058.149] -- 0:04:43
      135000 -- (-1065.561) (-1068.160) (-1078.643) [-1058.462] * (-1062.738) (-1057.171) (-1071.252) [-1052.159] -- 0:04:41

      Average standard deviation of split frequencies: 0.018664

      135500 -- (-1062.133) (-1051.061) (-1062.549) [-1057.782] * [-1055.227] (-1062.699) (-1065.950) (-1070.007) -- 0:04:40
      136000 -- (-1066.896) [-1059.162] (-1063.741) (-1058.389) * (-1065.004) (-1072.263) (-1054.806) [-1068.817] -- 0:04:39
      136500 -- [-1055.908] (-1063.714) (-1060.996) (-1067.496) * (-1065.460) (-1063.469) (-1062.406) [-1056.172] -- 0:04:38
      137000 -- [-1055.196] (-1062.247) (-1049.745) (-1067.804) * (-1068.316) [-1054.251] (-1066.735) (-1062.843) -- 0:04:43
      137500 -- (-1056.822) (-1060.871) (-1064.371) [-1055.543] * (-1066.622) [-1056.085] (-1074.900) (-1066.143) -- 0:04:42
      138000 -- [-1053.063] (-1064.769) (-1078.805) (-1057.797) * [-1077.769] (-1057.525) (-1066.565) (-1064.459) -- 0:04:41
      138500 -- (-1066.668) (-1064.257) (-1069.885) [-1051.778] * (-1082.074) [-1047.624] (-1067.583) (-1050.286) -- 0:04:39
      139000 -- [-1056.476] (-1065.424) (-1064.355) (-1063.963) * (-1062.063) [-1059.899] (-1064.948) (-1065.416) -- 0:04:38
      139500 -- [-1054.936] (-1065.973) (-1064.888) (-1067.571) * [-1050.197] (-1062.982) (-1057.567) (-1069.981) -- 0:04:37
      140000 -- (-1056.765) (-1073.223) (-1077.192) [-1055.543] * [-1060.386] (-1063.885) (-1064.283) (-1062.796) -- 0:04:42

      Average standard deviation of split frequencies: 0.015467

      140500 -- (-1063.533) [-1052.349] (-1053.812) (-1080.885) * (-1054.836) (-1063.257) (-1069.497) [-1053.063] -- 0:04:41
      141000 -- (-1058.751) (-1062.411) [-1062.352] (-1052.579) * (-1060.553) (-1060.408) [-1070.436] (-1065.013) -- 0:04:40
      141500 -- (-1058.582) (-1069.711) [-1055.214] (-1053.423) * (-1080.267) (-1054.982) [-1058.147] (-1056.765) -- 0:04:39
      142000 -- (-1062.162) [-1056.978] (-1059.236) (-1061.981) * (-1067.937) [-1069.436] (-1065.707) (-1061.119) -- 0:04:37
      142500 -- (-1050.115) (-1052.957) [-1067.887] (-1057.784) * (-1068.804) [-1050.921] (-1068.255) (-1066.480) -- 0:04:36
      143000 -- (-1061.742) (-1055.778) (-1062.782) [-1050.683] * (-1060.033) [-1044.926] (-1066.112) (-1072.200) -- 0:04:41
      143500 -- (-1068.383) (-1056.933) (-1052.283) [-1052.983] * [-1062.641] (-1050.943) (-1064.811) (-1061.311) -- 0:04:40
      144000 -- (-1055.122) (-1066.464) (-1066.326) [-1054.732] * (-1067.143) [-1052.791] (-1062.478) (-1055.288) -- 0:04:39
      144500 -- (-1058.203) (-1065.709) (-1067.153) [-1052.741] * (-1062.934) [-1052.538] (-1065.613) (-1051.548) -- 0:04:38
      145000 -- [-1056.281] (-1055.570) (-1063.064) (-1059.719) * (-1060.563) [-1058.863] (-1057.170) (-1066.372) -- 0:04:37

      Average standard deviation of split frequencies: 0.013346

      145500 -- (-1067.515) [-1068.535] (-1066.341) (-1090.731) * (-1067.787) [-1054.237] (-1058.496) (-1069.636) -- 0:04:36
      146000 -- (-1062.742) (-1051.839) [-1061.396] (-1063.991) * (-1073.958) (-1070.520) [-1063.149] (-1061.520) -- 0:04:40
      146500 -- (-1067.566) [-1054.017] (-1058.356) (-1065.149) * (-1062.249) (-1062.681) (-1065.964) [-1065.613] -- 0:04:39
      147000 -- (-1056.524) (-1064.683) [-1065.269] (-1063.389) * (-1064.058) (-1078.440) (-1061.775) [-1064.255] -- 0:04:38
      147500 -- (-1062.358) [-1053.897] (-1062.700) (-1057.920) * (-1057.995) [-1063.868] (-1056.156) (-1058.736) -- 0:04:37
      148000 -- (-1055.813) (-1066.445) (-1071.510) [-1050.960] * (-1060.705) (-1063.255) [-1061.765] (-1059.422) -- 0:04:36
      148500 -- (-1058.432) [-1061.877] (-1066.953) (-1061.075) * (-1077.910) (-1066.611) [-1066.445] (-1058.968) -- 0:04:35
      149000 -- (-1055.417) (-1093.324) [-1055.731] (-1061.516) * [-1059.981] (-1066.520) (-1064.634) (-1055.859) -- 0:04:34
      149500 -- (-1066.289) (-1071.441) (-1066.187) [-1062.024] * (-1075.933) (-1065.978) [-1051.931] (-1060.205) -- 0:04:38
      150000 -- (-1076.177) (-1065.513) [-1063.931] (-1078.133) * (-1060.414) (-1066.481) (-1051.959) [-1062.183] -- 0:04:37

      Average standard deviation of split frequencies: 0.012034

      150500 -- (-1081.108) (-1060.975) (-1058.693) [-1060.368] * [-1053.670] (-1064.912) (-1054.497) (-1060.032) -- 0:04:36
      151000 -- (-1059.599) [-1054.698] (-1057.347) (-1056.617) * [-1063.341] (-1066.190) (-1059.951) (-1073.907) -- 0:04:35
      151500 -- (-1057.918) (-1067.453) [-1050.552] (-1069.164) * (-1071.658) [-1051.894] (-1066.366) (-1066.536) -- 0:04:34
      152000 -- (-1063.673) [-1059.988] (-1059.855) (-1055.986) * (-1059.861) (-1064.095) [-1051.709] (-1073.986) -- 0:04:38
      152500 -- [-1059.986] (-1063.643) (-1070.662) (-1059.573) * (-1063.010) [-1049.265] (-1051.990) (-1058.859) -- 0:04:37
      153000 -- (-1062.823) (-1056.655) [-1063.545] (-1071.207) * (-1074.945) (-1065.162) [-1051.986] (-1068.981) -- 0:04:36
      153500 -- (-1064.867) [-1049.833] (-1065.861) (-1066.043) * (-1077.827) [-1059.217] (-1065.487) (-1063.223) -- 0:04:35
      154000 -- (-1065.601) [-1057.794] (-1075.382) (-1071.310) * [-1068.394] (-1072.892) (-1064.773) (-1059.349) -- 0:04:34
      154500 -- (-1063.147) (-1060.305) [-1056.659] (-1062.236) * (-1081.721) [-1061.083] (-1064.916) (-1073.852) -- 0:04:33
      155000 -- [-1054.858] (-1063.463) (-1067.437) (-1069.716) * (-1081.963) [-1065.342] (-1077.264) (-1062.023) -- 0:04:38

      Average standard deviation of split frequencies: 0.011855

      155500 -- [-1052.326] (-1073.554) (-1062.699) (-1073.167) * (-1068.710) (-1075.939) (-1067.788) [-1055.329] -- 0:04:36
      156000 -- (-1055.323) (-1054.967) [-1069.032] (-1075.671) * (-1060.194) [-1059.554] (-1065.783) (-1055.877) -- 0:04:35
      156500 -- (-1061.320) [-1052.185] (-1064.173) (-1069.276) * (-1063.637) (-1075.350) (-1071.176) [-1051.410] -- 0:04:34
      157000 -- [-1056.513] (-1056.590) (-1065.324) (-1065.083) * (-1069.609) (-1060.686) [-1054.436] (-1051.820) -- 0:04:33
      157500 -- (-1054.205) (-1062.823) (-1068.623) [-1061.696] * [-1066.636] (-1057.047) (-1062.733) (-1060.663) -- 0:04:32
      158000 -- (-1066.589) [-1058.572] (-1073.258) (-1060.638) * (-1059.836) [-1058.399] (-1066.361) (-1064.393) -- 0:04:31
      158500 -- (-1082.320) (-1056.280) (-1066.644) [-1054.045] * (-1073.813) (-1059.752) [-1061.158] (-1057.731) -- 0:04:36
      159000 -- (-1072.018) (-1053.876) (-1062.285) [-1060.163] * (-1053.930) (-1060.899) (-1064.437) [-1059.239] -- 0:04:35
      159500 -- [-1059.388] (-1061.025) (-1063.686) (-1081.287) * (-1071.707) (-1071.348) [-1067.998] (-1062.442) -- 0:04:34
      160000 -- (-1072.947) (-1047.346) (-1063.597) [-1069.817] * (-1066.600) [-1053.618] (-1072.452) (-1059.994) -- 0:04:33

      Average standard deviation of split frequencies: 0.012155

      160500 -- (-1069.723) (-1056.758) [-1058.115] (-1064.042) * (-1058.365) (-1066.589) (-1080.708) [-1060.838] -- 0:04:31
      161000 -- (-1071.606) [-1065.774] (-1058.352) (-1057.533) * (-1064.569) [-1057.901] (-1062.640) (-1068.731) -- 0:04:30
      161500 -- (-1070.250) [-1057.280] (-1061.766) (-1066.421) * [-1066.061] (-1061.502) (-1064.155) (-1061.187) -- 0:04:35
      162000 -- [-1073.652] (-1048.006) (-1066.589) (-1066.701) * (-1061.225) (-1059.374) (-1074.408) [-1061.275] -- 0:04:34
      162500 -- [-1057.919] (-1062.553) (-1083.664) (-1076.269) * (-1056.224) (-1061.299) (-1063.447) [-1072.870] -- 0:04:33
      163000 -- (-1068.617) (-1065.729) (-1066.040) [-1066.649] * (-1066.664) (-1056.078) [-1059.057] (-1069.144) -- 0:04:32
      163500 -- (-1069.741) [-1060.212] (-1068.246) (-1061.417) * [-1056.611] (-1078.489) (-1057.316) (-1069.612) -- 0:04:31
      164000 -- (-1067.357) [-1055.700] (-1061.086) (-1074.620) * [-1053.888] (-1062.845) (-1071.548) (-1059.922) -- 0:04:30
      164500 -- (-1065.942) [-1058.700] (-1063.221) (-1058.992) * (-1054.888) (-1065.645) (-1057.706) [-1052.991] -- 0:04:34
      165000 -- (-1064.990) [-1054.114] (-1060.754) (-1064.681) * (-1062.242) [-1057.275] (-1064.223) (-1064.677) -- 0:04:33

      Average standard deviation of split frequencies: 0.012171

      165500 -- (-1061.352) (-1056.601) (-1062.577) [-1063.754] * (-1052.136) [-1053.947] (-1074.143) (-1072.987) -- 0:04:32
      166000 -- (-1054.166) [-1055.375] (-1056.059) (-1061.308) * (-1055.457) (-1065.039) (-1067.297) [-1051.506] -- 0:04:31
      166500 -- (-1077.216) (-1066.972) (-1064.354) [-1075.290] * (-1064.147) [-1066.877] (-1064.956) (-1057.461) -- 0:04:30
      167000 -- (-1054.664) [-1063.688] (-1055.618) (-1065.718) * (-1066.051) (-1069.645) (-1050.535) [-1068.836] -- 0:04:29
      167500 -- (-1072.966) (-1058.467) (-1064.639) [-1059.297] * (-1062.757) [-1052.917] (-1065.550) (-1075.652) -- 0:04:33
      168000 -- (-1070.072) (-1068.160) [-1052.331] (-1056.848) * (-1067.986) (-1051.539) (-1068.721) [-1057.948] -- 0:04:32
      168500 -- (-1060.343) (-1061.144) (-1053.939) [-1056.163] * (-1059.792) [-1043.981] (-1063.461) (-1062.486) -- 0:04:31
      169000 -- [-1059.496] (-1068.791) (-1061.724) (-1052.967) * [-1056.227] (-1071.830) (-1054.908) (-1066.376) -- 0:04:30
      169500 -- (-1077.709) (-1068.244) (-1067.125) [-1066.290] * (-1063.514) (-1064.780) [-1058.637] (-1060.288) -- 0:04:29
      170000 -- [-1063.867] (-1062.626) (-1070.858) (-1060.776) * [-1059.494] (-1059.401) (-1056.875) (-1061.161) -- 0:04:28

      Average standard deviation of split frequencies: 0.015586

      170500 -- (-1060.739) [-1062.898] (-1061.483) (-1067.130) * [-1055.305] (-1063.786) (-1057.174) (-1071.399) -- 0:04:32
      171000 -- (-1062.698) [-1051.296] (-1068.426) (-1066.419) * (-1069.135) [-1056.948] (-1071.272) (-1066.069) -- 0:04:31
      171500 -- (-1065.874) (-1062.682) (-1074.368) [-1054.643] * [-1050.009] (-1061.419) (-1071.251) (-1077.866) -- 0:04:30
      172000 -- (-1066.674) [-1059.627] (-1071.969) (-1074.676) * [-1055.221] (-1065.680) (-1079.265) (-1082.110) -- 0:04:29
      172500 -- (-1065.754) (-1052.858) (-1073.451) [-1067.611] * (-1057.326) (-1063.696) (-1065.826) [-1062.441] -- 0:04:28
      173000 -- (-1065.176) (-1076.402) (-1071.965) [-1071.367] * [-1057.830] (-1058.112) (-1057.905) (-1054.255) -- 0:04:27
      173500 -- [-1055.031] (-1058.825) (-1071.644) (-1068.039) * [-1066.729] (-1066.956) (-1062.668) (-1055.548) -- 0:04:26
      174000 -- (-1065.204) (-1075.849) (-1055.386) [-1059.426] * (-1059.294) [-1064.328] (-1065.444) (-1057.576) -- 0:04:30
      174500 -- (-1076.860) (-1068.927) (-1064.029) [-1069.869] * (-1057.093) (-1072.256) [-1048.434] (-1065.962) -- 0:04:29
      175000 -- (-1069.558) (-1076.364) (-1067.027) [-1062.410] * [-1056.935] (-1075.458) (-1064.539) (-1062.872) -- 0:04:28

      Average standard deviation of split frequencies: 0.014731

      175500 -- [-1065.212] (-1067.275) (-1073.225) (-1055.640) * (-1063.930) (-1068.668) (-1058.229) [-1070.329] -- 0:04:27
      176000 -- [-1063.915] (-1063.388) (-1070.667) (-1063.045) * (-1064.805) (-1062.033) (-1072.086) [-1059.063] -- 0:04:26
      176500 -- (-1065.571) (-1067.957) [-1061.247] (-1060.185) * (-1062.950) (-1060.263) [-1061.846] (-1085.520) -- 0:04:25
      177000 -- (-1065.589) (-1054.760) (-1071.315) [-1055.254] * (-1074.774) (-1074.131) [-1061.790] (-1062.547) -- 0:04:29
      177500 -- (-1067.569) [-1052.739] (-1070.602) (-1053.895) * (-1061.872) [-1055.453] (-1068.089) (-1083.080) -- 0:04:28
      178000 -- (-1055.963) (-1069.667) (-1069.079) [-1066.827] * (-1066.377) (-1063.047) (-1056.736) [-1066.191] -- 0:04:27
      178500 -- (-1053.490) (-1063.205) (-1065.196) [-1051.945] * (-1067.939) (-1061.232) (-1062.107) [-1066.836] -- 0:04:26
      179000 -- (-1069.066) (-1053.268) [-1052.497] (-1056.073) * (-1069.121) (-1074.469) (-1068.357) [-1053.632] -- 0:04:26
      179500 -- (-1057.552) (-1056.982) [-1050.959] (-1053.366) * [-1053.842] (-1061.234) (-1074.357) (-1062.587) -- 0:04:25
      180000 -- (-1052.856) (-1061.957) [-1059.967] (-1057.533) * [-1056.488] (-1066.125) (-1056.164) (-1060.947) -- 0:04:28

      Average standard deviation of split frequencies: 0.018451

      180500 -- (-1071.070) (-1067.125) (-1070.541) [-1055.537] * (-1078.126) (-1068.844) [-1061.803] (-1064.271) -- 0:04:27
      181000 -- (-1070.425) (-1054.477) [-1061.327] (-1066.821) * (-1064.889) (-1069.845) (-1060.036) [-1066.843] -- 0:04:26
      181500 -- (-1054.157) (-1061.372) (-1062.964) [-1064.060] * (-1064.956) (-1057.262) [-1059.460] (-1069.913) -- 0:04:26
      182000 -- (-1054.717) [-1066.388] (-1065.559) (-1057.912) * [-1064.721] (-1069.214) (-1059.885) (-1084.823) -- 0:04:25
      182500 -- (-1073.180) (-1061.681) [-1066.874] (-1080.407) * (-1069.255) [-1061.281] (-1061.152) (-1060.709) -- 0:04:24
      183000 -- [-1072.643] (-1068.645) (-1087.760) (-1065.601) * [-1057.717] (-1061.973) (-1067.522) (-1061.880) -- 0:04:27
      183500 -- [-1060.338] (-1066.050) (-1076.903) (-1073.790) * (-1060.456) (-1067.269) [-1052.614] (-1059.637) -- 0:04:26
      184000 -- (-1061.558) (-1074.539) (-1077.454) [-1061.973] * (-1060.064) [-1061.337] (-1072.346) (-1063.364) -- 0:04:26
      184500 -- (-1061.735) (-1064.949) [-1056.099] (-1055.171) * (-1057.716) (-1059.964) (-1078.993) [-1059.402] -- 0:04:25
      185000 -- (-1071.308) (-1074.449) [-1059.806] (-1072.978) * (-1057.470) (-1062.069) [-1065.906] (-1048.319) -- 0:04:24

      Average standard deviation of split frequencies: 0.018646

      185500 -- (-1073.140) (-1057.148) (-1062.489) [-1059.379] * (-1060.019) (-1064.056) (-1065.901) [-1051.651] -- 0:04:23
      186000 -- (-1068.651) (-1065.311) [-1059.028] (-1063.404) * (-1062.798) (-1074.689) (-1059.203) [-1058.823] -- 0:04:26
      186500 -- [-1049.097] (-1072.759) (-1065.511) (-1063.611) * [-1053.778] (-1059.059) (-1069.718) (-1065.069) -- 0:04:26
      187000 -- (-1054.499) (-1071.446) (-1069.384) [-1056.742] * (-1054.722) [-1061.462] (-1068.752) (-1078.247) -- 0:04:25
      187500 -- (-1059.733) (-1062.462) (-1068.882) [-1064.736] * (-1068.064) (-1054.719) (-1071.245) [-1058.236] -- 0:04:24
      188000 -- (-1065.174) (-1062.762) [-1058.262] (-1052.150) * (-1066.146) [-1052.571] (-1070.124) (-1049.374) -- 0:04:23
      188500 -- (-1075.742) (-1070.300) [-1056.919] (-1057.738) * (-1069.632) [-1054.642] (-1066.001) (-1064.341) -- 0:04:22
      189000 -- (-1059.973) [-1055.156] (-1057.684) (-1055.243) * (-1069.726) (-1066.539) (-1058.064) [-1055.809] -- 0:04:26
      189500 -- (-1056.921) (-1062.693) (-1064.291) [-1058.732] * (-1054.202) (-1081.428) [-1049.194] (-1064.812) -- 0:04:25
      190000 -- [-1056.987] (-1069.920) (-1066.532) (-1072.460) * (-1069.957) (-1057.669) [-1063.340] (-1067.491) -- 0:04:24

      Average standard deviation of split frequencies: 0.018013

      190500 -- [-1059.559] (-1057.914) (-1071.581) (-1058.558) * (-1055.629) (-1064.135) [-1052.570] (-1061.443) -- 0:04:23
      191000 -- [-1051.552] (-1058.521) (-1068.694) (-1053.322) * (-1051.418) (-1072.840) [-1048.990] (-1063.279) -- 0:04:22
      191500 -- (-1059.541) (-1062.801) (-1082.271) [-1072.368] * [-1056.553] (-1063.584) (-1064.886) (-1066.675) -- 0:04:21
      192000 -- (-1076.914) (-1076.685) (-1068.912) [-1059.109] * (-1072.137) (-1069.006) (-1067.002) [-1061.218] -- 0:04:25
      192500 -- (-1062.714) (-1070.448) [-1054.608] (-1058.897) * (-1057.720) (-1062.207) [-1050.844] (-1066.860) -- 0:04:24
      193000 -- (-1064.398) (-1076.209) [-1061.293] (-1071.789) * [-1056.005] (-1061.747) (-1066.288) (-1073.246) -- 0:04:23
      193500 -- (-1059.804) [-1054.893] (-1073.724) (-1065.396) * (-1054.932) [-1061.383] (-1057.084) (-1063.355) -- 0:04:22
      194000 -- (-1060.519) [-1057.762] (-1068.878) (-1073.424) * [-1057.019] (-1067.676) (-1082.008) (-1055.132) -- 0:04:21
      194500 -- (-1057.883) [-1064.452] (-1065.878) (-1066.466) * [-1072.513] (-1075.373) (-1073.149) (-1065.386) -- 0:04:20
      195000 -- (-1059.684) (-1069.841) (-1077.157) [-1054.503] * (-1067.095) [-1067.503] (-1059.936) (-1057.640) -- 0:04:24

      Average standard deviation of split frequencies: 0.019585

      195500 -- [-1053.787] (-1067.393) (-1068.208) (-1058.330) * [-1055.385] (-1068.834) (-1074.371) (-1062.678) -- 0:04:23
      196000 -- (-1064.498) [-1061.161] (-1066.220) (-1054.490) * [-1061.126] (-1079.175) (-1056.060) (-1055.150) -- 0:04:22
      196500 -- (-1063.744) (-1076.068) [-1059.634] (-1064.186) * (-1059.183) (-1069.241) [-1060.275] (-1071.667) -- 0:04:21
      197000 -- (-1073.877) (-1061.877) [-1073.545] (-1061.446) * (-1068.059) (-1086.198) [-1057.574] (-1064.788) -- 0:04:20
      197500 -- [-1051.442] (-1071.084) (-1066.958) (-1076.635) * [-1060.006] (-1061.146) (-1051.405) (-1063.760) -- 0:04:20
      198000 -- (-1073.691) (-1063.480) [-1054.251] (-1062.730) * (-1065.121) (-1066.881) [-1060.333] (-1068.865) -- 0:04:23
      198500 -- (-1061.519) (-1062.488) [-1065.653] (-1053.320) * (-1071.884) (-1067.738) [-1059.220] (-1063.339) -- 0:04:22
      199000 -- (-1061.418) (-1061.376) [-1050.406] (-1073.217) * [-1051.027] (-1056.641) (-1068.564) (-1068.516) -- 0:04:21
      199500 -- (-1076.704) (-1058.887) (-1054.363) [-1057.709] * (-1062.632) (-1053.151) (-1058.909) [-1055.311] -- 0:04:20
      200000 -- (-1066.985) (-1066.973) [-1057.487] (-1061.263) * (-1062.882) (-1061.102) [-1056.649] (-1055.131) -- 0:04:20

      Average standard deviation of split frequencies: 0.018290

      200500 -- (-1061.223) (-1057.420) [-1048.822] (-1056.613) * (-1069.767) (-1061.230) [-1061.426] (-1063.255) -- 0:04:19
      201000 -- (-1074.310) [-1056.815] (-1068.358) (-1057.208) * [-1051.137] (-1058.412) (-1066.313) (-1065.786) -- 0:04:22
      201500 -- (-1067.846) [-1060.884] (-1060.304) (-1058.544) * (-1070.360) [-1058.141] (-1065.153) (-1072.666) -- 0:04:21
      202000 -- (-1061.681) (-1056.146) [-1062.556] (-1064.061) * (-1068.843) [-1055.547] (-1060.466) (-1072.294) -- 0:04:20
      202500 -- (-1057.887) (-1068.213) [-1053.888] (-1065.122) * (-1063.410) (-1075.583) [-1055.703] (-1064.540) -- 0:04:19
      203000 -- (-1069.698) (-1060.074) [-1065.452] (-1064.381) * [-1070.444] (-1060.576) (-1063.833) (-1060.325) -- 0:04:19
      203500 -- (-1060.054) (-1064.316) [-1055.345] (-1074.563) * [-1058.706] (-1058.242) (-1068.782) (-1060.114) -- 0:04:18
      204000 -- (-1058.870) [-1052.371] (-1057.064) (-1074.010) * (-1064.788) (-1069.323) (-1058.913) [-1048.376] -- 0:04:21
      204500 -- (-1061.174) (-1068.165) [-1064.619] (-1061.233) * [-1068.621] (-1069.963) (-1082.145) (-1058.131) -- 0:04:20
      205000 -- (-1056.964) (-1070.218) [-1062.885] (-1064.734) * [-1056.274] (-1069.838) (-1070.853) (-1057.838) -- 0:04:19

      Average standard deviation of split frequencies: 0.018307

      205500 -- (-1053.977) (-1066.472) [-1054.017] (-1056.638) * (-1055.854) (-1070.357) (-1054.553) [-1048.007] -- 0:04:19
      206000 -- (-1059.165) (-1058.170) [-1049.386] (-1060.956) * (-1062.809) [-1062.033] (-1062.492) (-1065.421) -- 0:04:18
      206500 -- (-1058.440) (-1060.517) (-1065.389) [-1049.090] * (-1062.950) [-1055.399] (-1056.593) (-1060.677) -- 0:04:17
      207000 -- (-1068.899) [-1061.274] (-1059.592) (-1066.321) * [-1053.313] (-1054.716) (-1060.009) (-1067.120) -- 0:04:20
      207500 -- (-1063.316) [-1058.838] (-1058.098) (-1058.106) * (-1056.823) [-1068.270] (-1058.424) (-1082.210) -- 0:04:19
      208000 -- (-1063.999) (-1059.946) (-1061.378) [-1054.659] * [-1053.402] (-1084.697) (-1056.753) (-1056.170) -- 0:04:18
      208500 -- [-1051.179] (-1068.394) (-1054.659) (-1061.731) * (-1057.702) (-1057.596) [-1056.259] (-1069.114) -- 0:04:18
      209000 -- (-1064.904) (-1062.757) (-1058.074) [-1055.189] * (-1059.458) (-1066.340) (-1058.046) [-1054.365] -- 0:04:17
      209500 -- (-1058.343) (-1064.038) [-1046.973] (-1055.762) * (-1065.654) [-1073.247] (-1070.300) (-1063.705) -- 0:04:16
      210000 -- (-1066.598) [-1058.270] (-1065.326) (-1048.492) * (-1072.402) [-1053.971] (-1060.761) (-1066.357) -- 0:04:19

      Average standard deviation of split frequencies: 0.019841

      210500 -- (-1072.769) (-1072.144) (-1068.861) [-1071.252] * [-1058.181] (-1058.041) (-1056.661) (-1068.277) -- 0:04:18
      211000 -- [-1060.360] (-1066.912) (-1069.956) (-1066.226) * (-1064.857) (-1058.817) [-1052.823] (-1075.096) -- 0:04:18
      211500 -- [-1054.153] (-1062.773) (-1065.832) (-1056.755) * (-1074.975) [-1060.303] (-1061.817) (-1065.380) -- 0:04:17
      212000 -- (-1077.468) (-1073.648) (-1061.805) [-1060.501] * [-1057.628] (-1062.031) (-1067.077) (-1069.245) -- 0:04:16
      212500 -- (-1063.858) (-1066.538) [-1059.457] (-1062.692) * [-1060.563] (-1054.785) (-1059.580) (-1071.200) -- 0:04:15
      213000 -- [-1057.991] (-1058.497) (-1057.316) (-1073.135) * (-1071.089) [-1066.180] (-1058.450) (-1061.503) -- 0:04:18
      213500 -- (-1055.060) [-1052.810] (-1068.251) (-1054.291) * [-1052.348] (-1074.172) (-1058.930) (-1062.977) -- 0:04:17
      214000 -- (-1057.561) (-1063.577) [-1056.326] (-1068.423) * (-1055.418) (-1058.453) [-1066.028] (-1066.391) -- 0:04:17
      214500 -- [-1063.223] (-1057.881) (-1056.285) (-1058.945) * (-1058.245) [-1055.987] (-1062.267) (-1067.524) -- 0:04:16
      215000 -- [-1063.508] (-1086.930) (-1056.502) (-1067.826) * (-1074.550) (-1072.620) (-1078.289) [-1057.660] -- 0:04:15

      Average standard deviation of split frequencies: 0.020733

      215500 -- (-1058.867) [-1053.317] (-1070.646) (-1071.524) * (-1066.664) [-1055.506] (-1071.059) (-1073.453) -- 0:04:14
      216000 -- (-1058.068) [-1053.679] (-1058.652) (-1070.607) * (-1076.852) (-1052.502) (-1067.949) [-1061.136] -- 0:04:17
      216500 -- [-1060.036] (-1077.219) (-1073.158) (-1059.531) * (-1063.284) [-1056.546] (-1057.468) (-1070.262) -- 0:04:16
      217000 -- (-1064.758) [-1053.933] (-1073.350) (-1061.464) * (-1070.401) (-1064.867) [-1056.103] (-1058.239) -- 0:04:16
      217500 -- (-1075.446) [-1049.315] (-1070.703) (-1066.156) * (-1079.302) (-1063.313) [-1065.876] (-1053.589) -- 0:04:15
      218000 -- (-1076.718) (-1056.920) (-1060.092) [-1055.253] * (-1072.745) (-1055.590) (-1076.609) [-1053.924] -- 0:04:14
      218500 -- [-1052.125] (-1070.484) (-1062.760) (-1069.220) * [-1057.979] (-1070.408) (-1064.857) (-1061.844) -- 0:04:13
      219000 -- [-1059.409] (-1063.145) (-1065.665) (-1072.258) * (-1076.539) (-1059.545) (-1068.959) [-1053.280] -- 0:04:16
      219500 -- (-1067.450) (-1058.720) (-1067.644) [-1060.223] * [-1056.697] (-1056.932) (-1069.914) (-1067.941) -- 0:04:16
      220000 -- [-1059.213] (-1057.452) (-1061.577) (-1068.569) * (-1061.568) (-1073.367) (-1059.061) [-1060.816] -- 0:04:15

      Average standard deviation of split frequencies: 0.021058

      220500 -- (-1057.082) (-1069.912) (-1071.342) [-1063.714] * (-1073.906) (-1073.521) [-1061.651] (-1050.811) -- 0:04:14
      221000 -- (-1062.824) [-1053.285] (-1062.641) (-1065.155) * [-1058.132] (-1076.950) (-1081.251) (-1052.852) -- 0:04:13
      221500 -- [-1059.728] (-1067.502) (-1076.784) (-1061.542) * [-1056.450] (-1064.392) (-1069.784) (-1071.503) -- 0:04:13
      222000 -- (-1070.139) [-1068.343] (-1065.545) (-1072.082) * (-1063.919) [-1070.720] (-1058.758) (-1064.827) -- 0:04:15
      222500 -- (-1065.720) [-1067.780] (-1080.836) (-1066.450) * (-1059.228) (-1067.736) [-1056.994] (-1065.246) -- 0:04:15
      223000 -- (-1068.035) (-1068.922) [-1067.255] (-1068.813) * (-1064.006) (-1070.161) [-1055.933] (-1059.742) -- 0:04:14
      223500 -- (-1066.894) [-1054.442] (-1059.363) (-1058.443) * (-1062.612) [-1057.181] (-1064.026) (-1059.027) -- 0:04:13
      224000 -- (-1065.621) (-1058.690) [-1054.520] (-1060.205) * (-1072.363) [-1059.866] (-1063.506) (-1059.131) -- 0:04:12
      224500 -- (-1063.128) [-1057.337] (-1062.192) (-1062.319) * [-1051.916] (-1056.136) (-1069.694) (-1051.565) -- 0:04:12
      225000 -- (-1063.099) (-1063.048) (-1075.411) [-1049.086] * (-1065.816) (-1057.298) (-1056.669) [-1058.553] -- 0:04:14

      Average standard deviation of split frequencies: 0.020561

      225500 -- (-1076.942) (-1059.338) (-1058.112) [-1059.301] * [-1060.237] (-1054.974) (-1070.036) (-1058.955) -- 0:04:14
      226000 -- (-1061.047) (-1053.132) [-1070.970] (-1067.930) * (-1072.151) (-1069.561) (-1068.279) [-1049.573] -- 0:04:13
      226500 -- [-1049.894] (-1051.847) (-1068.204) (-1086.808) * (-1064.272) (-1073.343) [-1067.162] (-1057.978) -- 0:04:12
      227000 -- (-1059.649) (-1063.056) (-1059.973) [-1061.947] * (-1061.067) (-1056.228) (-1074.606) [-1061.845] -- 0:04:11
      227500 -- (-1052.896) (-1087.384) [-1065.592] (-1062.560) * [-1051.969] (-1051.408) (-1071.791) (-1065.941) -- 0:04:11
      228000 -- (-1064.727) (-1066.814) (-1051.039) [-1053.958] * [-1058.720] (-1070.357) (-1071.966) (-1065.622) -- 0:04:13
      228500 -- (-1054.303) (-1062.876) [-1064.586] (-1058.076) * (-1056.615) (-1055.974) (-1064.802) [-1048.749] -- 0:04:13
      229000 -- (-1052.119) (-1083.497) [-1060.064] (-1058.165) * [-1065.606] (-1066.547) (-1063.965) (-1066.491) -- 0:04:12
      229500 -- (-1056.180) (-1053.299) (-1067.245) [-1065.304] * (-1063.442) (-1075.765) [-1054.071] (-1062.223) -- 0:04:11
      230000 -- (-1067.546) (-1075.280) [-1063.420] (-1060.213) * (-1059.145) [-1061.304] (-1061.221) (-1068.209) -- 0:04:11

      Average standard deviation of split frequencies: 0.019415

      230500 -- (-1087.819) (-1072.236) [-1060.064] (-1057.359) * (-1062.672) (-1068.311) [-1051.683] (-1063.330) -- 0:04:10
      231000 -- (-1061.255) (-1069.029) (-1060.698) [-1060.313] * (-1070.777) [-1057.398] (-1062.295) (-1058.551) -- 0:04:13
      231500 -- (-1067.909) (-1069.466) [-1048.512] (-1067.012) * (-1058.246) (-1057.592) [-1058.381] (-1068.587) -- 0:04:12
      232000 -- (-1080.824) (-1054.163) (-1059.079) [-1052.020] * (-1058.629) (-1058.000) (-1055.951) [-1051.205] -- 0:04:11
      232500 -- (-1077.609) (-1071.133) [-1058.675] (-1058.652) * [-1051.399] (-1070.032) (-1068.076) (-1056.412) -- 0:04:10
      233000 -- [-1052.617] (-1064.160) (-1061.348) (-1066.756) * (-1073.526) [-1054.977] (-1059.996) (-1066.553) -- 0:04:10
      233500 -- (-1066.481) (-1081.527) (-1064.120) [-1058.507] * [-1054.007] (-1074.827) (-1065.701) (-1061.802) -- 0:04:09
      234000 -- (-1059.554) (-1065.770) [-1060.631] (-1057.320) * (-1067.602) [-1078.290] (-1075.378) (-1061.759) -- 0:04:12
      234500 -- (-1059.900) [-1061.191] (-1063.126) (-1061.975) * [-1069.715] (-1075.158) (-1077.533) (-1048.960) -- 0:04:11
      235000 -- (-1071.786) (-1065.674) (-1071.948) [-1052.988] * [-1060.101] (-1062.611) (-1068.733) (-1065.534) -- 0:04:10

      Average standard deviation of split frequencies: 0.019689

      235500 -- (-1058.166) (-1068.178) (-1060.496) [-1048.247] * (-1068.196) (-1060.920) [-1060.683] (-1066.640) -- 0:04:09
      236000 -- (-1073.967) [-1048.774] (-1053.065) (-1052.472) * [-1054.777] (-1064.357) (-1061.433) (-1054.126) -- 0:04:09
      236500 -- (-1054.903) (-1060.986) [-1057.217] (-1049.044) * (-1059.980) [-1057.074] (-1055.911) (-1059.215) -- 0:04:08
      237000 -- [-1053.250] (-1073.452) (-1058.681) (-1054.641) * (-1061.802) [-1056.173] (-1054.073) (-1069.066) -- 0:04:07
      237500 -- (-1061.632) (-1064.570) [-1061.247] (-1063.543) * [-1048.724] (-1055.663) (-1073.454) (-1075.172) -- 0:04:10
      238000 -- [-1059.135] (-1054.365) (-1058.810) (-1069.012) * (-1074.832) (-1064.413) (-1058.211) [-1055.729] -- 0:04:09
      238500 -- (-1067.867) [-1049.522] (-1064.838) (-1080.578) * (-1067.458) (-1066.745) (-1056.345) [-1047.909] -- 0:04:09
      239000 -- (-1060.140) [-1063.665] (-1081.637) (-1085.802) * (-1062.332) (-1075.148) (-1055.988) [-1054.702] -- 0:04:08
      239500 -- (-1076.904) [-1053.684] (-1061.244) (-1063.873) * [-1065.312] (-1059.970) (-1061.741) (-1050.650) -- 0:04:07
      240000 -- (-1079.924) [-1051.165] (-1055.056) (-1064.497) * (-1071.731) (-1065.617) (-1048.757) [-1060.550] -- 0:04:07

      Average standard deviation of split frequencies: 0.019308

      240500 -- (-1057.737) (-1077.507) [-1056.073] (-1065.601) * (-1069.571) [-1051.398] (-1056.144) (-1075.380) -- 0:04:09
      241000 -- (-1055.760) [-1064.060] (-1057.229) (-1068.250) * (-1057.493) (-1066.514) (-1061.561) [-1069.405] -- 0:04:08
      241500 -- [-1061.805] (-1055.432) (-1056.102) (-1061.933) * (-1054.785) [-1056.005] (-1068.129) (-1058.126) -- 0:04:08
      242000 -- (-1060.457) (-1066.723) [-1052.300] (-1063.934) * (-1056.306) [-1053.177] (-1063.385) (-1056.981) -- 0:04:07
      242500 -- (-1055.928) (-1064.027) [-1065.841] (-1076.772) * (-1065.368) [-1058.015] (-1075.250) (-1078.369) -- 0:04:06
      243000 -- [-1066.446] (-1055.618) (-1069.579) (-1057.424) * (-1052.382) (-1065.492) [-1053.326] (-1071.132) -- 0:04:06
      243500 -- (-1054.484) [-1064.855] (-1064.558) (-1072.195) * (-1078.386) (-1066.192) (-1049.848) [-1048.763] -- 0:04:08
      244000 -- (-1065.847) (-1086.129) [-1048.302] (-1067.600) * (-1072.720) (-1067.542) [-1049.603] (-1062.984) -- 0:04:07
      244500 -- [-1054.583] (-1073.016) (-1061.094) (-1060.875) * (-1063.160) (-1058.481) [-1056.922] (-1060.428) -- 0:04:07
      245000 -- (-1063.629) (-1057.406) (-1064.807) [-1058.911] * (-1058.085) (-1059.535) [-1058.649] (-1059.813) -- 0:04:06

      Average standard deviation of split frequencies: 0.017520

      245500 -- [-1043.596] (-1066.575) (-1058.108) (-1058.792) * (-1062.184) [-1051.769] (-1065.467) (-1083.333) -- 0:04:05
      246000 -- (-1051.578) (-1066.850) [-1054.729] (-1069.592) * (-1057.425) [-1052.809] (-1054.409) (-1070.507) -- 0:04:05
      246500 -- [-1052.070] (-1065.386) (-1053.201) (-1075.528) * [-1057.430] (-1069.098) (-1049.789) (-1055.597) -- 0:04:07
      247000 -- (-1052.170) [-1056.469] (-1062.045) (-1064.331) * [-1061.150] (-1061.215) (-1063.279) (-1074.434) -- 0:04:06
      247500 -- [-1049.187] (-1057.463) (-1074.419) (-1070.404) * (-1055.095) (-1070.022) [-1060.799] (-1071.444) -- 0:04:06
      248000 -- (-1056.030) [-1051.494] (-1068.524) (-1061.039) * [-1070.683] (-1074.397) (-1065.129) (-1068.221) -- 0:04:05
      248500 -- [-1052.154] (-1048.141) (-1078.019) (-1071.322) * [-1060.829] (-1065.467) (-1063.240) (-1065.791) -- 0:04:04
      249000 -- [-1056.899] (-1061.318) (-1059.165) (-1054.948) * (-1061.810) (-1064.845) [-1062.443] (-1060.074) -- 0:04:04
      249500 -- (-1060.205) [-1054.254] (-1074.600) (-1067.437) * [-1065.912] (-1066.042) (-1063.717) (-1061.419) -- 0:04:06
      250000 -- (-1057.873) [-1046.689] (-1068.958) (-1064.892) * (-1075.054) (-1055.839) [-1058.453] (-1073.283) -- 0:04:06

      Average standard deviation of split frequencies: 0.017866

      250500 -- (-1070.551) (-1046.287) [-1055.167] (-1077.298) * (-1076.783) [-1063.491] (-1064.601) (-1065.888) -- 0:04:05
      251000 -- (-1050.331) [-1057.521] (-1064.849) (-1072.566) * (-1065.890) (-1063.107) [-1060.698] (-1065.145) -- 0:04:04
      251500 -- (-1052.305) [-1061.080] (-1078.140) (-1074.280) * (-1073.383) (-1059.365) [-1056.923] (-1070.482) -- 0:04:04
      252000 -- (-1062.861) (-1054.889) (-1063.385) [-1057.253] * [-1054.518] (-1075.459) (-1054.810) (-1053.168) -- 0:04:03
      252500 -- (-1062.461) (-1054.821) [-1055.510] (-1061.106) * (-1057.052) (-1068.412) (-1071.215) [-1054.289] -- 0:04:05
      253000 -- (-1052.978) [-1060.975] (-1066.979) (-1073.545) * [-1052.910] (-1065.337) (-1073.701) (-1065.819) -- 0:04:05
      253500 -- (-1058.358) (-1063.664) [-1055.623] (-1066.033) * [-1058.883] (-1064.937) (-1074.911) (-1067.292) -- 0:04:04
      254000 -- (-1058.915) (-1061.826) [-1051.402] (-1065.410) * [-1053.997] (-1072.899) (-1062.001) (-1066.380) -- 0:04:03
      254500 -- (-1061.766) (-1057.845) (-1069.946) [-1058.001] * (-1055.185) [-1064.240] (-1056.944) (-1066.975) -- 0:04:03
      255000 -- (-1072.715) (-1048.649) (-1074.208) [-1057.647] * (-1073.210) (-1068.095) [-1062.577] (-1070.291) -- 0:04:05

      Average standard deviation of split frequencies: 0.016310

      255500 -- (-1073.941) [-1067.772] (-1061.909) (-1066.877) * [-1063.194] (-1070.473) (-1070.506) (-1058.301) -- 0:04:04
      256000 -- [-1064.176] (-1057.988) (-1063.394) (-1057.575) * [-1060.182] (-1064.302) (-1064.920) (-1069.348) -- 0:04:04
      256500 -- (-1063.750) (-1063.145) [-1055.862] (-1062.848) * [-1057.444] (-1073.448) (-1061.758) (-1054.616) -- 0:04:03
      257000 -- (-1070.895) [-1053.954] (-1061.301) (-1064.891) * (-1065.118) (-1072.352) [-1054.970] (-1057.720) -- 0:04:02
      257500 -- (-1074.785) (-1063.723) [-1060.602] (-1062.333) * (-1063.980) [-1061.124] (-1060.968) (-1057.084) -- 0:04:02
      258000 -- (-1056.681) (-1075.740) (-1057.493) [-1055.665] * (-1057.862) (-1058.359) [-1065.852] (-1067.510) -- 0:04:04
      258500 -- [-1071.364] (-1065.069) (-1069.265) (-1069.165) * (-1054.517) (-1063.731) [-1052.110] (-1062.912) -- 0:04:03
      259000 -- (-1076.154) (-1063.203) (-1069.355) [-1055.882] * (-1078.267) (-1072.807) [-1051.242] (-1054.436) -- 0:04:03
      259500 -- (-1071.501) [-1065.776] (-1066.003) (-1079.262) * (-1053.575) (-1064.457) [-1056.112] (-1057.896) -- 0:04:02
      260000 -- (-1069.241) (-1072.924) [-1056.722] (-1081.249) * (-1070.071) (-1052.368) [-1051.779] (-1061.640) -- 0:04:01

      Average standard deviation of split frequencies: 0.016793

      260500 -- (-1069.544) (-1056.703) [-1053.061] (-1059.227) * (-1056.889) (-1058.879) [-1055.170] (-1065.303) -- 0:04:01
      261000 -- (-1058.280) (-1059.096) [-1056.550] (-1070.982) * (-1068.123) (-1053.161) [-1057.185] (-1073.784) -- 0:04:03
      261500 -- (-1063.067) [-1067.829] (-1058.188) (-1071.211) * (-1066.685) (-1054.854) (-1058.576) [-1058.108] -- 0:04:02
      262000 -- (-1063.542) [-1057.333] (-1055.529) (-1076.879) * [-1062.866] (-1056.427) (-1059.607) (-1068.755) -- 0:04:02
      262500 -- (-1063.265) (-1077.705) (-1053.347) [-1056.944] * (-1068.789) (-1067.520) [-1062.563] (-1058.149) -- 0:04:01
      263000 -- [-1060.215] (-1066.017) (-1057.945) (-1060.578) * (-1078.176) (-1057.978) (-1074.596) [-1053.201] -- 0:04:00
      263500 -- (-1060.738) (-1071.951) [-1067.413] (-1060.377) * (-1076.070) (-1058.352) [-1057.804] (-1062.467) -- 0:04:00
      264000 -- (-1060.888) (-1055.808) (-1083.900) [-1061.723] * [-1054.573] (-1066.951) (-1059.664) (-1059.869) -- 0:04:02
      264500 -- (-1073.044) (-1067.833) (-1071.295) [-1057.432] * (-1079.261) (-1064.373) (-1066.250) [-1059.961] -- 0:04:01
      265000 -- (-1066.301) (-1071.695) (-1074.917) [-1064.603] * [-1070.023] (-1068.833) (-1064.325) (-1063.671) -- 0:04:01

      Average standard deviation of split frequencies: 0.017595

      265500 -- (-1064.197) (-1060.635) (-1059.721) [-1058.331] * (-1065.830) (-1065.219) [-1058.083] (-1065.007) -- 0:04:00
      266000 -- (-1067.922) [-1059.340] (-1056.351) (-1061.229) * (-1067.285) [-1055.148] (-1062.540) (-1057.709) -- 0:04:00
      266500 -- [-1058.406] (-1062.249) (-1056.031) (-1076.190) * [-1064.810] (-1054.254) (-1064.664) (-1061.016) -- 0:03:59
      267000 -- [-1055.775] (-1056.145) (-1081.304) (-1064.839) * (-1069.737) (-1066.038) [-1055.292] (-1061.205) -- 0:04:01
      267500 -- (-1052.597) (-1051.493) (-1071.320) [-1056.892] * (-1065.713) (-1059.177) (-1057.853) [-1063.904] -- 0:04:00
      268000 -- (-1055.776) [-1060.777] (-1065.302) (-1078.282) * (-1063.446) (-1061.078) (-1066.612) [-1059.813] -- 0:04:00
      268500 -- (-1068.471) (-1063.763) [-1061.618] (-1068.477) * (-1063.307) (-1058.328) (-1072.978) [-1062.612] -- 0:03:59
      269000 -- (-1063.264) [-1072.248] (-1064.043) (-1062.903) * (-1064.888) [-1054.324] (-1071.019) (-1052.235) -- 0:03:59
      269500 -- (-1065.714) (-1060.182) (-1061.395) [-1060.284] * [-1054.028] (-1069.190) (-1057.596) (-1061.940) -- 0:03:58
      270000 -- (-1065.252) [-1053.172] (-1069.067) (-1075.508) * (-1062.691) (-1075.925) (-1055.176) [-1066.911] -- 0:04:00

      Average standard deviation of split frequencies: 0.018660

      270500 -- [-1064.150] (-1067.325) (-1071.760) (-1064.574) * [-1050.469] (-1060.683) (-1071.506) (-1067.494) -- 0:04:00
      271000 -- [-1057.179] (-1053.686) (-1057.157) (-1072.418) * (-1057.189) (-1058.592) (-1064.469) [-1053.133] -- 0:03:59
      271500 -- (-1062.022) (-1064.519) [-1059.299] (-1061.685) * (-1064.497) (-1075.701) [-1053.400] (-1056.860) -- 0:03:58
      272000 -- (-1070.194) (-1064.259) [-1059.862] (-1070.127) * (-1081.498) (-1065.866) [-1049.886] (-1050.658) -- 0:03:58
      272500 -- (-1064.547) (-1069.350) [-1063.059] (-1073.149) * (-1062.441) (-1059.235) (-1062.639) [-1065.296] -- 0:03:57
      273000 -- [-1057.768] (-1084.702) (-1073.632) (-1061.578) * (-1065.729) (-1059.358) [-1058.024] (-1064.893) -- 0:03:59
      273500 -- (-1073.161) (-1072.427) (-1061.041) [-1060.117] * (-1076.416) (-1089.614) [-1058.962] (-1065.026) -- 0:03:59
      274000 -- [-1053.603] (-1085.050) (-1060.123) (-1066.766) * (-1072.015) (-1066.185) (-1060.783) [-1058.729] -- 0:03:58
      274500 -- (-1058.966) (-1062.349) [-1072.181] (-1072.923) * (-1061.833) (-1070.418) (-1078.120) [-1062.612] -- 0:03:57
      275000 -- (-1065.057) (-1072.633) [-1071.817] (-1054.671) * (-1064.188) (-1052.653) [-1061.039] (-1056.483) -- 0:03:57

      Average standard deviation of split frequencies: 0.020618

      275500 -- (-1055.299) (-1076.071) [-1064.772] (-1068.885) * [-1068.188] (-1065.089) (-1053.459) (-1053.345) -- 0:03:56
      276000 -- (-1074.665) (-1066.870) (-1067.799) [-1058.610] * (-1067.619) (-1069.582) (-1066.277) [-1066.294] -- 0:03:58
      276500 -- (-1072.670) (-1070.296) [-1051.163] (-1068.429) * (-1067.642) (-1064.973) [-1056.792] (-1076.030) -- 0:03:58
      277000 -- (-1062.459) (-1060.105) [-1061.852] (-1059.453) * (-1072.177) (-1060.995) [-1049.601] (-1059.355) -- 0:03:57
      277500 -- (-1059.873) (-1066.265) (-1051.579) [-1052.266] * (-1082.840) [-1076.438] (-1055.139) (-1054.750) -- 0:03:56
      278000 -- (-1055.154) (-1075.042) (-1040.628) [-1051.404] * [-1054.460] (-1062.893) (-1063.026) (-1072.562) -- 0:03:56
      278500 -- (-1050.804) [-1053.584] (-1076.547) (-1068.716) * [-1054.880] (-1072.408) (-1068.322) (-1061.370) -- 0:03:55
      279000 -- [-1057.890] (-1072.850) (-1050.786) (-1074.817) * (-1053.623) [-1062.755] (-1074.550) (-1058.821) -- 0:03:57
      279500 -- (-1062.352) (-1073.079) (-1060.621) [-1061.600] * [-1062.787] (-1066.293) (-1077.265) (-1061.258) -- 0:03:57
      280000 -- (-1070.446) [-1057.253] (-1060.606) (-1074.663) * (-1073.417) [-1068.184] (-1071.962) (-1077.527) -- 0:03:56

      Average standard deviation of split frequencies: 0.019675

      280500 -- (-1059.305) (-1060.555) [-1063.428] (-1062.382) * (-1069.341) (-1072.628) (-1050.035) [-1060.841] -- 0:03:55
      281000 -- [-1063.589] (-1064.800) (-1069.544) (-1062.249) * (-1066.963) (-1051.252) [-1066.050] (-1073.553) -- 0:03:55
      281500 -- [-1053.959] (-1056.918) (-1070.066) (-1069.058) * (-1062.126) [-1058.641] (-1060.691) (-1067.068) -- 0:03:54
      282000 -- (-1055.265) (-1073.780) [-1062.734] (-1068.051) * (-1059.808) [-1055.721] (-1068.698) (-1072.110) -- 0:03:54
      282500 -- (-1060.738) (-1061.680) (-1059.512) [-1063.706] * (-1061.947) (-1058.749) [-1061.722] (-1071.844) -- 0:03:56
      283000 -- (-1058.725) (-1068.326) [-1056.141] (-1061.145) * [-1066.272] (-1050.972) (-1069.115) (-1072.352) -- 0:03:55
      283500 -- (-1048.013) (-1061.432) [-1054.788] (-1063.338) * (-1064.369) [-1050.573] (-1077.817) (-1073.931) -- 0:03:55
      284000 -- (-1070.326) (-1062.336) (-1064.443) [-1061.673] * (-1068.103) [-1064.942] (-1068.701) (-1072.322) -- 0:03:54
      284500 -- (-1086.095) (-1083.539) (-1061.141) [-1062.295] * (-1067.177) [-1056.524] (-1071.330) (-1052.020) -- 0:03:53
      285000 -- (-1069.354) (-1067.802) [-1054.868] (-1069.810) * (-1070.472) [-1061.058] (-1079.759) (-1060.272) -- 0:03:53

      Average standard deviation of split frequencies: 0.018484

      285500 -- (-1081.928) (-1064.394) [-1066.136] (-1058.024) * (-1058.823) (-1073.191) [-1060.137] (-1058.282) -- 0:03:55
      286000 -- (-1081.651) (-1066.580) [-1058.322] (-1057.192) * [-1060.761] (-1065.938) (-1079.787) (-1062.376) -- 0:03:54
      286500 -- (-1080.574) [-1059.940] (-1068.249) (-1065.194) * [-1049.671] (-1064.375) (-1058.096) (-1062.732) -- 0:03:54
      287000 -- (-1068.170) (-1066.866) [-1066.919] (-1069.443) * (-1056.720) (-1076.894) (-1065.248) [-1066.304] -- 0:03:53
      287500 -- (-1065.096) [-1066.293] (-1064.433) (-1060.706) * [-1054.795] (-1074.132) (-1069.788) (-1060.245) -- 0:03:52
      288000 -- [-1069.145] (-1063.831) (-1072.230) (-1070.197) * [-1055.468] (-1078.738) (-1065.955) (-1060.000) -- 0:03:52
      288500 -- (-1064.098) [-1049.337] (-1065.283) (-1059.457) * (-1064.697) (-1059.558) (-1075.741) [-1053.554] -- 0:03:54
      289000 -- (-1056.995) [-1056.135] (-1054.227) (-1053.446) * [-1057.734] (-1070.535) (-1069.560) (-1064.841) -- 0:03:53
      289500 -- (-1077.634) (-1060.254) [-1065.454] (-1065.679) * (-1053.105) (-1068.897) (-1068.216) [-1045.459] -- 0:03:53
      290000 -- (-1067.895) (-1077.661) (-1053.129) [-1052.406] * (-1062.952) [-1054.818] (-1069.813) (-1075.617) -- 0:03:52

      Average standard deviation of split frequencies: 0.020157

      290500 -- (-1063.352) (-1064.579) (-1054.472) [-1051.064] * (-1065.124) (-1079.343) (-1068.558) [-1058.342] -- 0:03:52
      291000 -- (-1071.471) [-1055.220] (-1058.918) (-1064.145) * (-1069.707) (-1062.972) [-1051.749] (-1052.004) -- 0:03:51
      291500 -- (-1074.571) [-1057.398] (-1072.644) (-1084.345) * (-1072.165) (-1074.457) [-1063.027] (-1056.114) -- 0:03:53
      292000 -- (-1055.133) (-1072.884) (-1076.152) [-1060.189] * (-1057.781) [-1060.236] (-1060.652) (-1078.972) -- 0:03:52
      292500 -- (-1061.393) (-1058.374) (-1076.294) [-1064.048] * (-1059.521) (-1058.515) [-1058.539] (-1057.303) -- 0:03:52
      293000 -- (-1058.955) (-1061.583) (-1069.436) [-1060.672] * [-1056.779] (-1056.956) (-1073.873) (-1069.773) -- 0:03:51
      293500 -- (-1067.392) [-1065.228] (-1062.619) (-1067.029) * (-1061.224) (-1073.137) (-1072.710) [-1055.927] -- 0:03:51
      294000 -- (-1061.045) (-1058.702) [-1058.597] (-1062.381) * (-1057.654) (-1072.287) (-1056.381) [-1058.578] -- 0:03:50
      294500 -- (-1052.208) (-1056.557) (-1061.781) [-1057.163] * (-1071.237) [-1060.557] (-1068.315) (-1074.211) -- 0:03:52
      295000 -- (-1055.123) (-1057.179) (-1069.501) [-1050.035] * (-1074.059) (-1077.614) [-1062.984] (-1068.884) -- 0:03:51

      Average standard deviation of split frequencies: 0.018656

      295500 -- (-1057.362) (-1054.719) (-1063.311) [-1051.075] * (-1067.131) (-1069.810) [-1053.637] (-1058.480) -- 0:03:51
      296000 -- (-1061.112) (-1067.764) (-1053.277) [-1062.237] * [-1059.750] (-1062.774) (-1060.667) (-1061.071) -- 0:03:50
      296500 -- (-1062.262) [-1062.908] (-1072.184) (-1052.303) * [-1059.267] (-1072.694) (-1052.398) (-1058.882) -- 0:03:50
      297000 -- [-1051.860] (-1064.008) (-1055.932) (-1056.471) * (-1054.539) (-1057.033) (-1066.569) [-1053.466] -- 0:03:49
      297500 -- (-1070.430) (-1067.456) [-1056.232] (-1057.689) * [-1056.646] (-1081.838) (-1072.092) (-1064.662) -- 0:03:51
      298000 -- (-1069.489) (-1071.339) (-1063.659) [-1060.484] * (-1050.104) (-1077.017) (-1075.838) [-1051.500] -- 0:03:50
      298500 -- [-1058.212] (-1057.554) (-1063.945) (-1063.858) * (-1066.887) (-1069.309) (-1066.634) [-1055.010] -- 0:03:50
      299000 -- (-1067.112) (-1057.093) (-1073.713) [-1051.642] * (-1066.296) (-1057.108) (-1075.951) [-1051.825] -- 0:03:49
      299500 -- (-1065.906) [-1059.151] (-1059.719) (-1069.934) * (-1061.295) (-1072.706) [-1056.985] (-1056.642) -- 0:03:49
      300000 -- (-1063.258) [-1060.185] (-1054.594) (-1062.225) * (-1063.884) (-1058.076) [-1060.065] (-1059.389) -- 0:03:48

      Average standard deviation of split frequencies: 0.019150

      300500 -- (-1061.363) [-1057.576] (-1070.442) (-1069.431) * [-1058.070] (-1059.349) (-1067.617) (-1058.341) -- 0:03:50
      301000 -- [-1065.155] (-1064.319) (-1065.743) (-1067.777) * (-1066.238) (-1063.263) [-1059.929] (-1062.005) -- 0:03:49
      301500 -- (-1072.870) (-1059.890) (-1066.872) [-1054.959] * (-1058.307) (-1066.632) (-1057.074) [-1054.390] -- 0:03:49
      302000 -- (-1080.370) [-1059.682] (-1060.361) (-1056.740) * (-1059.934) (-1062.306) (-1065.128) [-1055.971] -- 0:03:48
      302500 -- (-1062.224) (-1072.911) (-1054.615) [-1060.682] * (-1063.850) [-1058.611] (-1059.319) (-1075.548) -- 0:03:48
      303000 -- (-1057.679) (-1073.694) (-1065.707) [-1063.358] * (-1070.427) [-1054.947] (-1065.028) (-1067.815) -- 0:03:47
      303500 -- [-1057.541] (-1064.844) (-1058.379) (-1075.479) * (-1070.827) (-1058.834) (-1065.573) [-1063.715] -- 0:03:49
      304000 -- [-1054.048] (-1062.580) (-1063.568) (-1055.275) * (-1062.764) (-1059.295) [-1053.975] (-1065.601) -- 0:03:48
      304500 -- [-1052.454] (-1077.669) (-1050.182) (-1070.964) * (-1076.453) (-1060.875) [-1068.331] (-1065.704) -- 0:03:48
      305000 -- [-1057.666] (-1062.615) (-1061.117) (-1073.576) * (-1079.301) (-1068.408) (-1054.348) [-1050.449] -- 0:03:47

      Average standard deviation of split frequencies: 0.020501

      305500 -- (-1058.273) [-1055.116] (-1058.125) (-1055.854) * (-1065.012) (-1072.933) [-1061.538] (-1053.715) -- 0:03:47
      306000 -- (-1055.083) (-1072.557) [-1057.549] (-1058.877) * (-1072.862) [-1062.985] (-1056.628) (-1064.068) -- 0:03:46
      306500 -- (-1076.067) (-1061.641) [-1050.868] (-1051.100) * (-1061.872) (-1067.645) (-1059.365) [-1059.963] -- 0:03:46
      307000 -- (-1064.311) (-1057.576) (-1055.872) [-1050.637] * [-1053.726] (-1062.236) (-1053.888) (-1074.715) -- 0:03:47
      307500 -- (-1074.376) (-1067.263) [-1057.124] (-1056.857) * [-1062.473] (-1055.872) (-1055.580) (-1065.629) -- 0:03:47
      308000 -- (-1074.652) (-1060.770) (-1064.550) [-1059.866] * (-1052.421) (-1059.933) (-1055.898) [-1062.506] -- 0:03:46
      308500 -- (-1065.138) (-1069.091) (-1054.768) [-1050.424] * (-1055.511) [-1063.548] (-1069.416) (-1059.052) -- 0:03:46
      309000 -- [-1059.030] (-1063.130) (-1062.199) (-1053.899) * (-1059.705) (-1059.649) [-1050.489] (-1060.486) -- 0:03:45
      309500 -- [-1057.910] (-1064.339) (-1065.202) (-1053.777) * (-1061.447) (-1057.972) [-1071.642] (-1071.025) -- 0:03:45
      310000 -- (-1053.254) (-1062.922) [-1064.061] (-1063.906) * [-1054.527] (-1075.992) (-1074.690) (-1057.698) -- 0:03:47

      Average standard deviation of split frequencies: 0.021477

      310500 -- (-1067.070) (-1077.461) (-1067.758) [-1063.963] * [-1051.419] (-1063.383) (-1064.427) (-1067.913) -- 0:03:46
      311000 -- (-1077.574) (-1069.182) (-1063.872) [-1062.421] * (-1054.987) (-1055.830) [-1049.675] (-1060.470) -- 0:03:45
      311500 -- (-1078.183) [-1053.843] (-1074.754) (-1052.669) * [-1062.948] (-1060.040) (-1061.372) (-1067.782) -- 0:03:45
      312000 -- [-1055.273] (-1062.841) (-1064.842) (-1056.851) * (-1058.922) (-1060.329) [-1062.805] (-1071.697) -- 0:03:44
      312500 -- [-1059.692] (-1053.508) (-1062.410) (-1061.060) * (-1082.829) (-1068.673) (-1058.748) [-1054.502] -- 0:03:44
      313000 -- (-1067.013) (-1072.698) [-1066.556] (-1071.012) * [-1060.926] (-1067.007) (-1063.607) (-1064.172) -- 0:03:46
      313500 -- (-1063.660) (-1057.399) (-1064.504) [-1056.604] * (-1079.958) [-1052.122] (-1074.142) (-1052.963) -- 0:03:45
      314000 -- (-1062.639) (-1071.453) (-1066.838) [-1060.466] * (-1064.538) [-1056.919] (-1059.592) (-1069.124) -- 0:03:45
      314500 -- (-1061.915) [-1062.878] (-1066.793) (-1053.474) * (-1066.991) [-1060.665] (-1058.939) (-1074.760) -- 0:03:44
      315000 -- (-1056.331) [-1056.071] (-1065.092) (-1072.433) * (-1065.225) [-1063.600] (-1070.981) (-1068.546) -- 0:03:43

      Average standard deviation of split frequencies: 0.021803

      315500 -- (-1059.966) (-1063.677) [-1052.299] (-1056.344) * (-1073.935) [-1056.759] (-1068.681) (-1058.680) -- 0:03:43
      316000 -- (-1064.769) (-1062.073) (-1059.228) [-1056.577] * (-1068.844) [-1051.920] (-1063.100) (-1068.270) -- 0:03:45
      316500 -- [-1064.184] (-1059.187) (-1069.102) (-1059.514) * [-1055.958] (-1066.733) (-1064.264) (-1063.085) -- 0:03:44
      317000 -- (-1058.747) [-1056.263] (-1060.846) (-1060.761) * (-1050.911) [-1058.870] (-1078.744) (-1057.251) -- 0:03:44
      317500 -- (-1069.513) [-1055.857] (-1077.462) (-1060.812) * (-1065.701) [-1056.557] (-1066.285) (-1068.431) -- 0:03:43
      318000 -- (-1058.782) (-1065.349) [-1057.489] (-1063.316) * (-1063.017) (-1063.582) (-1069.229) [-1063.831] -- 0:03:43
      318500 -- (-1050.439) [-1053.646] (-1070.686) (-1060.976) * (-1062.346) (-1064.637) (-1066.066) [-1056.106] -- 0:03:42
      319000 -- (-1070.464) (-1056.865) (-1069.913) [-1052.752] * (-1061.046) (-1056.285) [-1055.674] (-1062.652) -- 0:03:44
      319500 -- (-1071.115) [-1063.511] (-1056.906) (-1060.545) * (-1055.703) (-1064.158) (-1065.204) [-1066.647] -- 0:03:43
      320000 -- (-1058.871) (-1068.810) [-1057.402] (-1065.727) * (-1059.930) [-1061.294] (-1059.119) (-1069.293) -- 0:03:43

      Average standard deviation of split frequencies: 0.021373

      320500 -- (-1069.290) (-1072.914) [-1051.563] (-1067.770) * (-1056.916) [-1060.402] (-1076.329) (-1063.572) -- 0:03:42
      321000 -- (-1069.760) (-1079.744) [-1059.528] (-1073.442) * (-1071.873) (-1067.733) (-1074.348) [-1065.501] -- 0:03:42
      321500 -- (-1054.477) [-1059.492] (-1063.834) (-1068.695) * (-1065.969) (-1063.448) [-1069.434] (-1069.493) -- 0:03:41
      322000 -- (-1066.774) [-1061.247] (-1062.230) (-1061.451) * (-1056.547) [-1067.832] (-1061.862) (-1057.833) -- 0:03:43
      322500 -- [-1063.791] (-1070.990) (-1062.624) (-1051.888) * (-1076.835) (-1072.212) [-1056.685] (-1056.071) -- 0:03:42
      323000 -- (-1069.080) (-1056.917) [-1057.556] (-1062.204) * (-1065.598) (-1067.036) (-1067.976) [-1063.944] -- 0:03:42
      323500 -- (-1067.248) (-1070.576) [-1058.998] (-1062.706) * (-1071.177) (-1051.978) [-1059.248] (-1054.154) -- 0:03:41
      324000 -- (-1071.519) (-1059.858) [-1056.134] (-1072.614) * (-1063.639) (-1064.966) [-1059.000] (-1062.251) -- 0:03:41
      324500 -- (-1070.042) (-1073.763) (-1079.765) [-1050.972] * (-1052.618) (-1060.979) [-1060.593] (-1065.272) -- 0:03:40
      325000 -- (-1060.520) (-1069.577) (-1066.119) [-1056.345] * (-1080.454) (-1068.567) (-1052.135) [-1052.300] -- 0:03:42

      Average standard deviation of split frequencies: 0.021357

      325500 -- [-1058.683] (-1056.174) (-1060.603) (-1064.453) * (-1081.559) (-1053.652) [-1056.260] (-1058.157) -- 0:03:41
      326000 -- (-1056.485) (-1057.898) (-1073.759) [-1057.066] * [-1054.879] (-1064.935) (-1067.730) (-1054.797) -- 0:03:41
      326500 -- (-1072.695) [-1051.883] (-1069.228) (-1054.949) * (-1070.239) (-1055.580) [-1057.899] (-1065.163) -- 0:03:40
      327000 -- (-1059.383) [-1058.919] (-1083.978) (-1058.100) * (-1071.759) (-1061.743) (-1073.209) [-1062.113] -- 0:03:40
      327500 -- [-1063.544] (-1057.983) (-1068.645) (-1068.290) * [-1054.038] (-1063.153) (-1063.277) (-1071.550) -- 0:03:39
      328000 -- (-1066.641) [-1066.501] (-1060.364) (-1062.899) * [-1060.926] (-1063.534) (-1064.214) (-1065.753) -- 0:03:39
      328500 -- (-1060.123) (-1062.379) (-1070.608) [-1064.367] * (-1065.677) (-1066.595) [-1062.870] (-1067.965) -- 0:03:40
      329000 -- [-1060.358] (-1069.707) (-1064.230) (-1058.964) * [-1062.678] (-1062.867) (-1066.970) (-1056.497) -- 0:03:40
      329500 -- (-1056.804) (-1073.071) [-1061.567] (-1056.305) * (-1066.845) [-1055.425] (-1060.491) (-1060.408) -- 0:03:39
      330000 -- (-1067.097) [-1062.733] (-1063.846) (-1069.604) * (-1064.034) (-1068.572) (-1071.488) [-1064.832] -- 0:03:39

      Average standard deviation of split frequencies: 0.018643

      330500 -- [-1054.336] (-1066.201) (-1067.872) (-1060.344) * (-1057.335) (-1051.865) (-1064.771) [-1058.334] -- 0:03:38
      331000 -- [-1048.688] (-1070.110) (-1070.020) (-1066.414) * [-1064.044] (-1060.315) (-1065.966) (-1061.759) -- 0:03:38
      331500 -- [-1054.538] (-1069.438) (-1053.903) (-1061.017) * (-1067.102) (-1062.935) [-1063.768] (-1056.853) -- 0:03:39
      332000 -- (-1060.621) [-1059.694] (-1063.677) (-1058.777) * [-1061.121] (-1064.921) (-1085.578) (-1074.395) -- 0:03:39
      332500 -- (-1067.824) [-1056.677] (-1059.109) (-1064.644) * (-1064.966) (-1062.676) [-1056.822] (-1062.917) -- 0:03:38
      333000 -- (-1054.382) (-1065.919) [-1058.416] (-1057.571) * [-1059.063] (-1070.250) (-1069.689) (-1056.434) -- 0:03:38
      333500 -- [-1065.184] (-1070.947) (-1074.223) (-1050.239) * (-1061.883) [-1058.850] (-1061.547) (-1061.753) -- 0:03:37
      334000 -- (-1060.353) [-1056.882] (-1070.406) (-1055.540) * [-1050.890] (-1060.438) (-1060.451) (-1060.433) -- 0:03:37
      334500 -- [-1064.011] (-1065.521) (-1070.625) (-1057.184) * (-1069.300) (-1084.316) (-1059.831) [-1056.740] -- 0:03:38
      335000 -- (-1047.715) (-1071.096) (-1061.554) [-1053.360] * [-1064.191] (-1064.733) (-1060.456) (-1065.890) -- 0:03:38

      Average standard deviation of split frequencies: 0.017699

      335500 -- [-1056.601] (-1057.317) (-1064.633) (-1070.912) * (-1052.926) (-1062.069) (-1064.293) [-1062.271] -- 0:03:37
      336000 -- [-1053.627] (-1073.285) (-1077.912) (-1052.694) * [-1056.514] (-1074.204) (-1064.381) (-1057.647) -- 0:03:37
      336500 -- [-1059.302] (-1067.976) (-1078.031) (-1062.260) * (-1053.693) (-1053.948) (-1071.111) [-1048.226] -- 0:03:36
      337000 -- (-1057.286) (-1060.399) (-1066.979) [-1058.102] * (-1055.043) (-1072.196) (-1069.471) [-1064.327] -- 0:03:36
      337500 -- (-1065.165) [-1057.789] (-1071.439) (-1059.200) * (-1054.401) (-1061.430) (-1069.110) [-1056.472] -- 0:03:37
      338000 -- (-1066.521) [-1069.918] (-1069.282) (-1056.223) * [-1057.811] (-1069.247) (-1065.839) (-1061.847) -- 0:03:37
      338500 -- (-1069.972) [-1064.352] (-1053.459) (-1072.517) * (-1064.181) (-1057.074) [-1063.953] (-1061.379) -- 0:03:36
      339000 -- (-1084.839) (-1073.317) [-1051.081] (-1069.274) * (-1063.332) (-1062.768) [-1050.990] (-1055.883) -- 0:03:36
      339500 -- (-1071.597) (-1055.551) [-1050.289] (-1065.039) * (-1062.550) (-1062.166) [-1052.074] (-1070.484) -- 0:03:35
      340000 -- (-1066.798) [-1071.955] (-1057.478) (-1080.342) * (-1065.667) [-1052.978] (-1066.555) (-1062.374) -- 0:03:35

      Average standard deviation of split frequencies: 0.017350

      340500 -- (-1063.070) (-1067.541) [-1060.502] (-1064.372) * [-1055.648] (-1062.658) (-1060.619) (-1071.995) -- 0:03:36
      341000 -- (-1070.173) (-1069.527) (-1068.327) [-1055.805] * (-1072.099) [-1055.080] (-1065.654) (-1067.184) -- 0:03:36
      341500 -- (-1053.049) [-1058.086] (-1056.939) (-1066.926) * (-1070.719) (-1063.141) (-1066.770) [-1060.365] -- 0:03:35
      342000 -- (-1082.383) [-1050.030] (-1067.762) (-1067.467) * (-1064.201) (-1054.742) (-1063.336) [-1071.337] -- 0:03:35
      342500 -- (-1064.260) (-1058.207) (-1072.524) [-1052.175] * (-1055.373) [-1055.257] (-1067.970) (-1060.348) -- 0:03:35
      343000 -- (-1058.863) [-1056.403] (-1074.598) (-1061.989) * (-1058.071) [-1065.826] (-1078.937) (-1061.765) -- 0:03:34
      343500 -- (-1065.163) [-1057.935] (-1065.889) (-1071.734) * (-1061.147) (-1069.763) (-1071.851) [-1063.337] -- 0:03:35
      344000 -- [-1055.525] (-1057.490) (-1061.558) (-1054.848) * [-1065.408] (-1064.881) (-1070.874) (-1058.826) -- 0:03:35
      344500 -- (-1089.373) (-1062.775) (-1066.322) [-1057.813] * (-1061.691) (-1052.271) (-1062.347) [-1057.408] -- 0:03:35
      345000 -- (-1073.454) [-1059.692] (-1062.519) (-1059.549) * (-1078.453) [-1051.078] (-1079.185) (-1074.416) -- 0:03:34

      Average standard deviation of split frequencies: 0.017083

      345500 -- (-1064.569) [-1053.689] (-1064.124) (-1075.599) * (-1063.035) (-1061.194) [-1065.095] (-1076.068) -- 0:03:34
      346000 -- (-1061.967) (-1066.286) [-1052.947] (-1065.198) * (-1064.437) [-1062.030] (-1064.149) (-1073.591) -- 0:03:33
      346500 -- (-1069.105) (-1080.393) (-1055.465) [-1063.405] * (-1061.510) (-1058.837) (-1061.725) [-1066.312] -- 0:03:35
      347000 -- (-1065.433) [-1065.725] (-1062.320) (-1077.863) * (-1064.054) [-1064.358] (-1056.093) (-1070.305) -- 0:03:34
      347500 -- (-1055.889) (-1072.667) [-1046.645] (-1065.253) * [-1054.558] (-1073.361) (-1063.087) (-1056.594) -- 0:03:34
      348000 -- [-1052.566] (-1078.528) (-1066.506) (-1053.046) * (-1065.278) (-1069.449) [-1056.913] (-1063.758) -- 0:03:33
      348500 -- (-1064.348) (-1071.782) (-1058.172) [-1061.633] * (-1064.086) (-1067.935) [-1057.151] (-1063.339) -- 0:03:33
      349000 -- [-1058.258] (-1063.769) (-1053.441) (-1064.108) * (-1068.469) (-1062.849) [-1055.236] (-1053.084) -- 0:03:32
      349500 -- (-1064.489) (-1070.772) (-1063.108) [-1049.977] * (-1053.340) (-1072.466) [-1065.644] (-1062.027) -- 0:03:32
      350000 -- (-1056.662) [-1052.396] (-1068.603) (-1065.639) * [-1054.375] (-1063.468) (-1066.876) (-1064.365) -- 0:03:33

      Average standard deviation of split frequencies: 0.017373

      350500 -- [-1059.183] (-1059.480) (-1072.857) (-1061.980) * (-1061.727) (-1062.038) (-1084.620) [-1055.256] -- 0:03:33
      351000 -- (-1060.623) (-1061.188) [-1063.145] (-1069.276) * (-1068.097) (-1065.699) [-1062.465] (-1067.120) -- 0:03:32
      351500 -- (-1078.301) [-1058.891] (-1059.131) (-1055.853) * (-1069.763) (-1071.535) (-1056.805) [-1048.240] -- 0:03:32
      352000 -- (-1071.170) [-1055.122] (-1072.388) (-1056.341) * (-1073.190) (-1064.061) [-1055.481] (-1076.589) -- 0:03:31
      352500 -- (-1070.989) [-1060.993] (-1066.334) (-1075.611) * [-1053.776] (-1076.411) (-1068.586) (-1065.463) -- 0:03:31
      353000 -- (-1057.783) [-1052.752] (-1074.734) (-1060.579) * (-1065.169) (-1075.130) (-1058.339) [-1053.445] -- 0:03:32
      353500 -- (-1061.406) (-1070.286) [-1056.949] (-1066.310) * (-1062.120) (-1073.206) (-1072.752) [-1055.120] -- 0:03:32
      354000 -- (-1068.985) [-1056.611] (-1067.420) (-1073.691) * (-1071.948) [-1058.931] (-1074.662) (-1067.870) -- 0:03:31
      354500 -- (-1058.631) (-1064.396) [-1055.414] (-1072.583) * [-1053.575] (-1059.142) (-1060.168) (-1065.315) -- 0:03:31
      355000 -- (-1061.325) (-1062.124) (-1054.776) [-1050.883] * (-1064.755) (-1068.118) [-1056.403] (-1068.007) -- 0:03:30

      Average standard deviation of split frequencies: 0.018538

      355500 -- [-1053.816] (-1059.995) (-1065.498) (-1055.180) * (-1060.992) (-1068.980) [-1063.105] (-1075.693) -- 0:03:30
      356000 -- (-1065.918) (-1073.723) [-1053.282] (-1055.838) * (-1064.126) (-1051.026) (-1075.679) [-1062.469] -- 0:03:31
      356500 -- (-1056.148) [-1055.576] (-1052.292) (-1061.803) * (-1060.804) (-1063.452) [-1065.807] (-1059.471) -- 0:03:31
      357000 -- (-1066.548) (-1063.469) (-1054.329) [-1052.680] * (-1064.234) (-1072.876) (-1060.370) [-1059.347] -- 0:03:30
      357500 -- (-1063.509) [-1059.072] (-1054.382) (-1073.768) * (-1068.622) (-1065.682) [-1053.971] (-1065.670) -- 0:03:30
      358000 -- (-1061.462) [-1064.216] (-1064.176) (-1063.150) * (-1077.103) (-1057.227) [-1054.274] (-1059.644) -- 0:03:29
      358500 -- (-1062.447) (-1079.475) [-1049.126] (-1060.350) * (-1063.087) [-1060.313] (-1066.645) (-1055.363) -- 0:03:29
      359000 -- (-1072.261) (-1066.395) [-1059.533] (-1054.805) * (-1067.410) [-1062.241] (-1074.244) (-1056.204) -- 0:03:30
      359500 -- (-1058.921) (-1063.137) [-1064.252] (-1065.199) * (-1067.260) [-1054.303] (-1075.744) (-1061.534) -- 0:03:30
      360000 -- (-1082.561) (-1056.351) (-1066.561) [-1054.762] * (-1057.429) (-1075.611) (-1057.405) [-1050.184] -- 0:03:29

      Average standard deviation of split frequencies: 0.017595

      360500 -- (-1056.754) [-1053.187] (-1070.159) (-1070.647) * [-1057.227] (-1064.746) (-1063.129) (-1070.951) -- 0:03:29
      361000 -- (-1068.755) (-1075.818) [-1056.238] (-1061.758) * (-1066.833) (-1059.977) (-1063.639) [-1060.541] -- 0:03:28
      361500 -- (-1057.433) (-1061.538) [-1050.926] (-1054.703) * (-1062.555) (-1073.076) (-1066.964) [-1059.693] -- 0:03:28
      362000 -- (-1070.740) (-1066.107) (-1068.576) [-1060.537] * (-1074.699) (-1078.209) (-1068.173) [-1054.891] -- 0:03:29
      362500 -- [-1071.733] (-1063.269) (-1064.065) (-1056.596) * (-1058.697) (-1075.314) (-1075.371) [-1061.208] -- 0:03:29
      363000 -- (-1068.904) (-1059.322) [-1048.578] (-1076.281) * (-1061.239) (-1079.912) (-1060.049) [-1052.213] -- 0:03:28
      363500 -- (-1069.363) [-1052.963] (-1062.014) (-1061.437) * (-1066.906) (-1069.347) (-1068.283) [-1056.794] -- 0:03:28
      364000 -- [-1053.658] (-1070.370) (-1063.453) (-1046.079) * [-1060.272] (-1070.166) (-1051.489) (-1069.396) -- 0:03:27
      364500 -- (-1067.268) (-1076.112) (-1055.779) [-1057.224] * (-1068.393) (-1064.984) (-1062.388) [-1078.644] -- 0:03:29
      365000 -- (-1065.221) (-1065.841) (-1066.469) [-1052.684] * (-1064.654) (-1068.278) [-1056.949] (-1078.799) -- 0:03:28

      Average standard deviation of split frequencies: 0.017536

      365500 -- (-1064.932) (-1084.416) [-1063.972] (-1061.834) * (-1062.676) (-1075.623) (-1067.122) [-1052.844] -- 0:03:28
      366000 -- (-1060.987) [-1063.740] (-1068.282) (-1054.308) * (-1070.694) (-1066.030) [-1063.707] (-1049.796) -- 0:03:27
      366500 -- (-1053.337) (-1050.697) (-1076.132) [-1051.986] * (-1064.433) (-1091.074) [-1051.692] (-1060.394) -- 0:03:27
      367000 -- (-1063.820) (-1065.187) (-1074.395) [-1059.088] * (-1072.210) (-1092.104) (-1052.799) [-1061.234] -- 0:03:26
      367500 -- (-1065.595) (-1059.882) (-1074.727) [-1056.213] * (-1072.085) [-1052.049] (-1059.194) (-1079.088) -- 0:03:28
      368000 -- (-1078.751) [-1055.221] (-1057.967) (-1065.827) * (-1055.964) (-1054.913) (-1060.478) [-1061.985] -- 0:03:27
      368500 -- (-1073.258) [-1056.791] (-1068.697) (-1057.365) * (-1069.047) (-1065.849) (-1066.091) [-1056.829] -- 0:03:27
      369000 -- (-1066.875) (-1067.727) (-1072.535) [-1057.966] * (-1063.972) [-1061.402] (-1079.083) (-1059.495) -- 0:03:26
      369500 -- (-1084.435) [-1060.973] (-1058.840) (-1051.235) * [-1060.276] (-1057.385) (-1093.225) (-1071.143) -- 0:03:26
      370000 -- (-1071.305) [-1059.498] (-1061.455) (-1065.725) * [-1048.352] (-1057.900) (-1068.038) (-1064.894) -- 0:03:26

      Average standard deviation of split frequencies: 0.016827

      370500 -- (-1061.481) (-1059.780) (-1065.001) [-1053.298] * [-1056.567] (-1061.551) (-1074.619) (-1069.492) -- 0:03:27
      371000 -- (-1066.334) (-1072.804) [-1064.850] (-1077.950) * (-1068.272) (-1078.970) [-1057.220] (-1072.421) -- 0:03:26
      371500 -- (-1070.672) (-1065.387) (-1064.639) [-1066.694] * [-1062.016] (-1084.091) (-1070.614) (-1059.647) -- 0:03:26
      372000 -- (-1062.344) (-1064.831) [-1056.405] (-1070.084) * [-1057.238] (-1090.363) (-1059.195) (-1056.324) -- 0:03:25
      372500 -- (-1070.390) [-1060.028] (-1062.059) (-1079.348) * [-1054.113] (-1073.850) (-1065.906) (-1062.264) -- 0:03:25
      373000 -- (-1077.355) (-1068.107) [-1055.082] (-1064.986) * (-1063.116) (-1071.154) [-1063.887] (-1074.308) -- 0:03:26
      373500 -- [-1054.568] (-1055.044) (-1059.748) (-1060.591) * [-1068.848] (-1069.152) (-1062.715) (-1052.877) -- 0:03:26
      374000 -- [-1053.265] (-1074.910) (-1059.414) (-1070.465) * (-1064.046) (-1067.699) (-1069.862) [-1061.705] -- 0:03:25
      374500 -- (-1066.184) [-1056.345] (-1066.811) (-1076.905) * [-1060.317] (-1056.997) (-1058.191) (-1053.195) -- 0:03:25
      375000 -- (-1056.996) (-1054.454) [-1058.168] (-1066.052) * (-1071.749) (-1077.151) [-1051.303] (-1064.488) -- 0:03:25

      Average standard deviation of split frequencies: 0.016491

      375500 -- (-1052.872) [-1075.347] (-1071.172) (-1073.017) * (-1066.062) (-1053.411) [-1057.416] (-1063.078) -- 0:03:24
      376000 -- (-1052.793) (-1050.524) [-1062.095] (-1063.552) * (-1062.887) (-1054.785) [-1055.707] (-1073.316) -- 0:03:25
      376500 -- (-1061.971) [-1052.985] (-1052.752) (-1076.695) * [-1059.312] (-1084.183) (-1070.365) (-1059.423) -- 0:03:25
      377000 -- (-1066.974) (-1056.384) [-1051.918] (-1069.734) * (-1070.316) [-1054.178] (-1077.583) (-1055.192) -- 0:03:24
      377500 -- [-1060.542] (-1074.082) (-1056.480) (-1078.726) * (-1064.985) [-1058.812] (-1059.509) (-1061.316) -- 0:03:24
      378000 -- (-1073.510) (-1060.079) [-1058.748] (-1062.667) * (-1055.616) [-1055.490] (-1065.410) (-1070.870) -- 0:03:24
      378500 -- (-1069.817) (-1058.725) [-1060.159] (-1063.212) * [-1055.457] (-1057.911) (-1071.323) (-1067.930) -- 0:03:25
      379000 -- (-1071.482) (-1062.183) (-1060.792) [-1064.126] * (-1066.428) (-1060.832) (-1052.122) [-1057.181] -- 0:03:24
      379500 -- (-1073.230) (-1057.414) (-1070.211) [-1057.031] * (-1080.454) (-1059.672) (-1065.670) [-1056.798] -- 0:03:24
      380000 -- (-1077.960) [-1058.303] (-1060.139) (-1048.556) * (-1067.259) (-1063.738) [-1048.014] (-1063.458) -- 0:03:23

      Average standard deviation of split frequencies: 0.017528

      380500 -- (-1066.168) (-1052.714) (-1075.004) [-1050.225] * (-1062.941) [-1056.970] (-1056.543) (-1057.894) -- 0:03:23
      381000 -- (-1068.902) (-1059.954) (-1064.596) [-1055.326] * (-1070.817) (-1060.034) [-1051.779] (-1065.720) -- 0:03:23
      381500 -- (-1073.024) (-1068.436) [-1058.345] (-1062.858) * [-1064.725] (-1060.700) (-1051.227) (-1064.772) -- 0:03:24
      382000 -- (-1058.543) [-1057.188] (-1064.590) (-1054.873) * (-1061.175) [-1054.397] (-1061.990) (-1077.326) -- 0:03:23
      382500 -- (-1073.104) (-1072.709) [-1052.184] (-1066.640) * (-1080.565) [-1063.331] (-1051.604) (-1063.393) -- 0:03:23
      383000 -- (-1058.946) (-1078.188) [-1057.376] (-1060.362) * (-1069.482) [-1052.100] (-1059.294) (-1066.835) -- 0:03:22
      383500 -- (-1072.378) [-1064.567] (-1058.434) (-1059.681) * (-1067.947) (-1066.542) (-1069.523) [-1068.540] -- 0:03:22
      384000 -- (-1077.785) (-1081.488) (-1069.915) [-1059.843] * (-1054.873) (-1063.554) (-1068.754) [-1053.477] -- 0:03:23
      384500 -- [-1061.229] (-1061.342) (-1067.150) (-1055.848) * (-1054.599) (-1073.548) [-1067.479] (-1059.284) -- 0:03:23
      385000 -- [-1053.816] (-1060.335) (-1065.775) (-1054.170) * (-1059.982) (-1070.614) [-1055.333] (-1092.133) -- 0:03:22

      Average standard deviation of split frequencies: 0.017004

      385500 -- (-1054.482) (-1081.914) (-1062.806) [-1054.879] * (-1060.877) [-1077.530] (-1065.914) (-1055.887) -- 0:03:22
      386000 -- [-1071.029] (-1062.253) (-1067.395) (-1065.152) * [-1064.573] (-1070.966) (-1062.193) (-1073.192) -- 0:03:22
      386500 -- (-1069.786) (-1064.292) (-1057.921) [-1053.607] * (-1065.117) (-1070.175) [-1061.146] (-1063.958) -- 0:03:21
      387000 -- (-1064.940) (-1070.016) (-1065.027) [-1064.461] * (-1058.924) [-1060.285] (-1055.362) (-1058.102) -- 0:03:21
      387500 -- (-1065.315) (-1069.974) [-1057.597] (-1062.208) * (-1060.711) [-1055.968] (-1060.644) (-1061.200) -- 0:03:22
      388000 -- (-1056.489) [-1063.194] (-1066.245) (-1069.571) * [-1054.722] (-1056.978) (-1070.529) (-1061.965) -- 0:03:21
      388500 -- [-1063.275] (-1073.496) (-1059.229) (-1059.967) * (-1075.324) (-1066.803) (-1065.578) [-1051.856] -- 0:03:21
      389000 -- (-1067.118) [-1061.787] (-1060.041) (-1064.611) * [-1056.057] (-1058.965) (-1069.867) (-1054.118) -- 0:03:21
      389500 -- [-1053.832] (-1060.366) (-1054.158) (-1073.728) * (-1053.893) [-1051.572] (-1070.594) (-1060.950) -- 0:03:20
      390000 -- (-1064.319) (-1077.776) (-1083.342) [-1054.554] * (-1069.610) [-1067.246] (-1061.070) (-1063.978) -- 0:03:20

      Average standard deviation of split frequencies: 0.015965

      390500 -- (-1074.544) (-1056.188) [-1056.113] (-1060.940) * (-1056.033) (-1057.524) (-1060.308) [-1059.884] -- 0:03:21
      391000 -- (-1063.708) (-1064.176) [-1063.319] (-1060.399) * [-1054.556] (-1059.149) (-1069.101) (-1058.792) -- 0:03:20
      391500 -- (-1059.162) (-1068.349) [-1048.506] (-1055.934) * [-1053.486] (-1060.199) (-1057.524) (-1065.311) -- 0:03:20
      392000 -- [-1052.386] (-1067.941) (-1062.575) (-1061.658) * (-1075.770) (-1068.076) (-1051.155) [-1056.853] -- 0:03:20
      392500 -- (-1059.623) (-1081.752) (-1075.584) [-1072.745] * (-1068.131) (-1064.467) (-1059.277) [-1062.438] -- 0:03:19
      393000 -- (-1066.851) (-1070.685) (-1059.782) [-1052.881] * (-1056.846) [-1060.058] (-1086.565) (-1068.658) -- 0:03:19
      393500 -- (-1070.722) (-1062.209) [-1056.247] (-1055.626) * (-1055.579) (-1071.670) (-1079.394) [-1058.603] -- 0:03:18
      394000 -- (-1065.808) (-1070.817) [-1057.104] (-1065.088) * (-1055.965) (-1053.708) (-1077.337) [-1064.331] -- 0:03:19
      394500 -- (-1066.108) [-1054.082] (-1078.000) (-1052.569) * (-1049.174) (-1068.105) (-1080.841) [-1052.896] -- 0:03:19
      395000 -- [-1055.580] (-1065.403) (-1060.015) (-1059.494) * (-1069.513) (-1055.956) [-1068.618] (-1054.023) -- 0:03:19

      Average standard deviation of split frequencies: 0.016025

      395500 -- (-1055.940) [-1058.503] (-1058.032) (-1066.372) * [-1056.324] (-1063.542) (-1065.965) (-1061.580) -- 0:03:18
      396000 -- (-1060.225) (-1067.531) [-1060.765] (-1074.094) * (-1059.938) (-1073.666) (-1064.227) [-1063.621] -- 0:03:18
      396500 -- (-1066.471) (-1062.965) (-1068.475) [-1057.303] * [-1063.573] (-1069.007) (-1069.892) (-1069.320) -- 0:03:17
      397000 -- (-1052.914) (-1068.318) (-1077.652) [-1056.165] * (-1061.876) [-1050.832] (-1076.146) (-1062.565) -- 0:03:18
      397500 -- [-1059.592] (-1061.715) (-1063.966) (-1061.531) * (-1050.787) [-1052.775] (-1064.383) (-1079.783) -- 0:03:18
      398000 -- (-1076.259) [-1055.863] (-1068.390) (-1059.433) * [-1059.982] (-1060.105) (-1076.774) (-1067.784) -- 0:03:18
      398500 -- [-1046.325] (-1068.103) (-1058.395) (-1062.127) * (-1070.240) (-1055.246) [-1060.767] (-1075.624) -- 0:03:17
      399000 -- (-1063.477) (-1068.563) [-1060.560] (-1059.613) * (-1063.136) (-1065.604) (-1056.700) [-1054.872] -- 0:03:17
      399500 -- (-1076.888) [-1054.326] (-1051.917) (-1063.347) * (-1064.398) (-1057.223) [-1058.434] (-1068.629) -- 0:03:16
      400000 -- [-1061.378] (-1063.000) (-1057.086) (-1059.846) * (-1056.641) (-1059.934) [-1063.787] (-1070.688) -- 0:03:18

      Average standard deviation of split frequencies: 0.015838

      400500 -- (-1052.514) (-1054.565) [-1054.655] (-1083.082) * (-1065.117) [-1055.148] (-1049.098) (-1084.484) -- 0:03:17
      401000 -- (-1054.007) (-1063.777) [-1055.958] (-1073.776) * [-1057.746] (-1071.382) (-1062.090) (-1072.729) -- 0:03:17
      401500 -- [-1053.409] (-1057.202) (-1069.998) (-1063.206) * (-1058.056) [-1058.843] (-1060.900) (-1082.882) -- 0:03:16
      402000 -- [-1056.737] (-1066.847) (-1069.341) (-1075.039) * (-1055.735) (-1070.537) [-1056.131] (-1067.385) -- 0:03:16
      402500 -- (-1064.786) (-1062.129) (-1066.551) [-1057.974] * (-1074.265) (-1056.313) [-1064.708] (-1067.653) -- 0:03:15
      403000 -- (-1061.072) (-1057.939) (-1059.847) [-1057.754] * (-1065.269) [-1056.126] (-1054.713) (-1076.906) -- 0:03:17
      403500 -- (-1065.475) (-1069.798) (-1069.301) [-1055.390] * (-1074.064) (-1067.891) (-1059.760) [-1060.682] -- 0:03:16
      404000 -- (-1054.045) (-1053.642) [-1063.321] (-1058.676) * (-1075.971) (-1060.991) [-1058.486] (-1066.183) -- 0:03:16
      404500 -- (-1059.652) [-1059.596] (-1070.966) (-1053.331) * (-1065.208) (-1054.234) [-1054.433] (-1054.434) -- 0:03:15
      405000 -- (-1048.479) (-1067.889) [-1059.005] (-1066.673) * (-1075.363) [-1058.237] (-1060.046) (-1060.664) -- 0:03:15

      Average standard deviation of split frequencies: 0.015630

      405500 -- (-1064.226) [-1061.312] (-1065.311) (-1064.547) * (-1062.450) [-1064.474] (-1060.602) (-1062.853) -- 0:03:14
      406000 -- (-1054.315) (-1067.829) [-1056.356] (-1061.763) * (-1061.153) (-1060.617) [-1053.736] (-1065.604) -- 0:03:14
      406500 -- (-1061.157) (-1069.007) (-1058.880) [-1062.251] * (-1069.158) (-1062.703) [-1048.585] (-1083.762) -- 0:03:15
      407000 -- (-1061.756) (-1068.420) [-1051.682] (-1058.312) * (-1069.753) (-1059.328) [-1049.194] (-1071.365) -- 0:03:15
      407500 -- (-1069.687) (-1061.544) (-1061.940) [-1058.307] * [-1057.323] (-1061.713) (-1054.288) (-1071.722) -- 0:03:14
      408000 -- (-1069.623) (-1070.152) (-1056.055) [-1058.573] * (-1064.299) (-1046.807) [-1059.934] (-1067.341) -- 0:03:14
      408500 -- [-1060.391] (-1069.134) (-1061.855) (-1066.778) * (-1071.519) (-1054.190) [-1061.546] (-1051.713) -- 0:03:14
      409000 -- [-1057.860] (-1071.346) (-1069.852) (-1060.080) * (-1069.832) (-1071.246) (-1060.683) [-1069.495] -- 0:03:13
      409500 -- (-1061.643) (-1071.714) (-1067.169) [-1061.332] * (-1064.744) (-1062.429) [-1052.717] (-1058.813) -- 0:03:14
      410000 -- [-1056.165] (-1088.682) (-1063.364) (-1065.258) * (-1068.602) (-1066.600) (-1058.544) [-1058.701] -- 0:03:14

      Average standard deviation of split frequencies: 0.015099

      410500 -- (-1064.000) (-1072.999) [-1054.778] (-1054.188) * (-1070.476) (-1063.817) [-1058.401] (-1068.410) -- 0:03:13
      411000 -- [-1066.683] (-1070.677) (-1051.111) (-1060.069) * (-1079.177) (-1056.766) (-1063.222) [-1059.475] -- 0:03:13
      411500 -- (-1074.306) (-1067.891) [-1048.357] (-1068.103) * [-1050.941] (-1071.326) (-1065.099) (-1060.870) -- 0:03:13
      412000 -- (-1058.169) (-1062.282) (-1065.422) [-1051.248] * [-1066.640] (-1063.283) (-1065.815) (-1059.130) -- 0:03:12
      412500 -- (-1074.500) [-1054.091] (-1074.566) (-1061.821) * (-1067.730) (-1060.796) (-1069.083) [-1061.736] -- 0:03:13
      413000 -- (-1054.608) [-1055.823] (-1066.948) (-1065.565) * (-1070.199) (-1064.007) [-1068.482] (-1066.232) -- 0:03:13
      413500 -- (-1068.367) [-1057.561] (-1061.674) (-1068.587) * (-1061.713) (-1078.052) (-1079.991) [-1063.726] -- 0:03:12
      414000 -- (-1068.262) [-1065.335] (-1068.295) (-1067.160) * [-1054.926] (-1067.329) (-1053.787) (-1063.348) -- 0:03:12
      414500 -- (-1063.751) (-1067.999) [-1055.337] (-1057.232) * (-1059.570) (-1080.343) [-1056.409] (-1053.735) -- 0:03:12
      415000 -- (-1070.544) [-1059.899] (-1059.440) (-1064.959) * (-1057.886) (-1077.537) [-1062.100] (-1063.124) -- 0:03:11

      Average standard deviation of split frequencies: 0.015167

      415500 -- (-1067.982) (-1064.824) (-1056.317) [-1052.130] * (-1061.685) (-1084.713) [-1058.401] (-1064.810) -- 0:03:12
      416000 -- [-1055.659] (-1076.831) (-1055.729) (-1059.443) * (-1064.295) (-1061.400) [-1067.960] (-1060.921) -- 0:03:12
      416500 -- [-1063.093] (-1072.077) (-1059.312) (-1063.424) * (-1046.727) (-1062.446) [-1047.220] (-1071.304) -- 0:03:11
      417000 -- [-1054.716] (-1053.333) (-1067.603) (-1065.862) * [-1063.185] (-1072.160) (-1057.638) (-1081.106) -- 0:03:11
      417500 -- (-1059.583) (-1061.771) [-1061.546] (-1055.320) * (-1082.377) (-1055.930) [-1065.869] (-1070.697) -- 0:03:11
      418000 -- (-1049.139) (-1054.786) (-1061.837) [-1054.812] * (-1068.193) (-1053.580) (-1070.615) [-1052.496] -- 0:03:10
      418500 -- (-1053.761) (-1049.784) (-1073.081) [-1056.132] * (-1060.683) (-1054.017) (-1067.888) [-1056.109] -- 0:03:11
      419000 -- (-1055.812) [-1049.440] (-1069.801) (-1067.303) * (-1065.068) (-1072.510) [-1069.320] (-1056.205) -- 0:03:11
      419500 -- (-1057.188) [-1057.289] (-1062.945) (-1063.950) * [-1062.773] (-1067.901) (-1065.733) (-1062.460) -- 0:03:10
      420000 -- (-1071.459) (-1067.325) [-1057.674] (-1065.374) * [-1056.764] (-1058.645) (-1067.852) (-1061.770) -- 0:03:10

      Average standard deviation of split frequencies: 0.015516

      420500 -- (-1068.284) [-1048.940] (-1056.946) (-1057.292) * (-1065.417) (-1066.852) (-1061.899) [-1055.204] -- 0:03:10
      421000 -- [-1054.605] (-1063.697) (-1060.268) (-1065.506) * (-1068.008) (-1066.538) [-1062.869] (-1070.365) -- 0:03:09
      421500 -- (-1063.714) (-1068.742) [-1059.677] (-1055.425) * [-1060.720] (-1060.037) (-1059.825) (-1077.755) -- 0:03:10
      422000 -- (-1073.674) (-1056.335) (-1081.728) [-1059.307] * (-1062.166) [-1063.619] (-1076.278) (-1062.874) -- 0:03:10
      422500 -- (-1069.363) [-1052.244] (-1067.905) (-1071.551) * (-1064.268) [-1046.633] (-1065.466) (-1073.371) -- 0:03:09
      423000 -- (-1068.062) [-1055.610] (-1058.750) (-1064.917) * [-1047.328] (-1062.545) (-1070.763) (-1065.091) -- 0:03:09
      423500 -- (-1058.887) (-1062.296) [-1049.300] (-1062.261) * (-1074.902) [-1054.793] (-1067.989) (-1058.561) -- 0:03:09
      424000 -- (-1065.544) (-1074.568) [-1049.428] (-1068.047) * (-1069.797) (-1064.278) [-1063.671] (-1064.068) -- 0:03:08
      424500 -- [-1051.752] (-1066.171) (-1060.143) (-1057.061) * [-1057.081] (-1060.649) (-1060.036) (-1067.413) -- 0:03:09
      425000 -- [-1054.272] (-1067.253) (-1053.536) (-1071.691) * (-1066.298) (-1057.673) (-1059.655) [-1050.021] -- 0:03:09

      Average standard deviation of split frequencies: 0.014811

      425500 -- (-1073.724) (-1058.558) (-1069.916) [-1056.258] * (-1066.017) (-1063.455) [-1049.474] (-1055.632) -- 0:03:09
      426000 -- (-1052.654) [-1064.296] (-1062.621) (-1069.913) * (-1065.001) (-1056.680) [-1063.086] (-1070.476) -- 0:03:08
      426500 -- (-1065.696) (-1067.426) [-1065.273] (-1056.678) * [-1055.689] (-1061.105) (-1069.020) (-1063.642) -- 0:03:08
      427000 -- (-1070.669) (-1064.984) [-1071.034] (-1056.973) * [-1060.601] (-1066.396) (-1068.516) (-1060.591) -- 0:03:07
      427500 -- (-1066.209) (-1067.584) (-1060.913) [-1054.524] * (-1056.506) (-1072.496) [-1058.231] (-1068.000) -- 0:03:08
      428000 -- [-1061.521] (-1061.436) (-1067.476) (-1069.491) * [-1064.794] (-1070.278) (-1061.669) (-1061.298) -- 0:03:08
      428500 -- [-1060.991] (-1079.451) (-1065.519) (-1057.484) * (-1072.133) [-1056.379] (-1062.572) (-1056.774) -- 0:03:08
      429000 -- [-1059.931] (-1050.804) (-1059.495) (-1062.958) * (-1059.070) (-1057.983) [-1061.381] (-1077.083) -- 0:03:07
      429500 -- (-1055.919) (-1056.107) (-1059.617) [-1070.086] * (-1069.028) (-1058.757) [-1055.901] (-1070.408) -- 0:03:07
      430000 -- (-1053.552) [-1059.101] (-1058.941) (-1064.994) * (-1061.007) [-1055.758] (-1066.480) (-1064.332) -- 0:03:06

      Average standard deviation of split frequencies: 0.014903

      430500 -- (-1064.958) (-1054.952) [-1065.088] (-1087.491) * (-1064.042) [-1056.216] (-1053.802) (-1058.276) -- 0:03:07
      431000 -- [-1057.901] (-1059.536) (-1062.325) (-1063.431) * (-1057.792) (-1056.421) [-1052.551] (-1067.415) -- 0:03:07
      431500 -- (-1065.823) [-1062.030] (-1071.268) (-1064.661) * (-1051.512) [-1044.895] (-1057.524) (-1052.326) -- 0:03:07
      432000 -- (-1063.595) (-1058.711) (-1058.860) [-1057.129] * (-1053.216) (-1049.964) [-1059.560] (-1057.581) -- 0:03:06
      432500 -- (-1053.916) (-1057.469) [-1049.208] (-1062.656) * (-1056.266) (-1058.838) (-1055.998) [-1067.315] -- 0:03:06
      433000 -- (-1067.584) (-1074.958) (-1050.570) [-1055.332] * [-1058.409] (-1065.802) (-1049.057) (-1067.165) -- 0:03:05
      433500 -- (-1072.246) (-1051.655) (-1075.155) [-1061.385] * [-1055.561] (-1064.004) (-1071.468) (-1059.734) -- 0:03:06
      434000 -- (-1061.918) (-1057.230) (-1048.597) [-1057.066] * (-1061.611) [-1049.172] (-1056.798) (-1057.226) -- 0:03:06
      434500 -- (-1058.149) (-1054.770) (-1056.808) [-1052.393] * (-1062.335) (-1062.617) (-1076.673) [-1072.989] -- 0:03:06
      435000 -- (-1072.040) [-1055.621] (-1071.300) (-1055.121) * (-1064.547) (-1072.105) (-1061.895) [-1061.754] -- 0:03:05

      Average standard deviation of split frequencies: 0.014555

      435500 -- (-1052.711) (-1067.875) [-1059.983] (-1065.978) * (-1069.280) [-1057.694] (-1054.751) (-1073.874) -- 0:03:05
      436000 -- [-1052.720] (-1072.384) (-1062.971) (-1067.236) * (-1054.803) (-1058.831) [-1057.938] (-1069.146) -- 0:03:04
      436500 -- (-1072.439) (-1065.605) [-1047.095] (-1066.576) * (-1054.067) (-1059.209) [-1053.925] (-1066.566) -- 0:03:05
      437000 -- (-1066.502) [-1062.308] (-1065.006) (-1058.064) * (-1069.196) [-1064.397] (-1062.160) (-1056.556) -- 0:03:05
      437500 -- (-1064.091) [-1063.723] (-1060.364) (-1063.625) * (-1075.770) (-1067.441) [-1052.948] (-1071.423) -- 0:03:05
      438000 -- [-1059.199] (-1068.110) (-1064.471) (-1063.107) * (-1063.073) [-1061.117] (-1071.600) (-1062.747) -- 0:03:04
      438500 -- (-1087.143) (-1061.691) [-1061.610] (-1069.377) * (-1057.306) (-1069.486) [-1070.915] (-1057.915) -- 0:03:04
      439000 -- (-1059.549) (-1060.341) [-1066.740] (-1057.753) * [-1048.037] (-1069.712) (-1059.272) (-1065.971) -- 0:03:04
      439500 -- (-1063.100) (-1077.909) (-1053.862) [-1057.332] * [-1066.371] (-1077.795) (-1070.027) (-1056.196) -- 0:03:04
      440000 -- (-1066.760) (-1056.291) (-1062.856) [-1053.266] * (-1065.203) (-1069.912) (-1059.020) [-1069.264] -- 0:03:04

      Average standard deviation of split frequencies: 0.014894

      440500 -- (-1064.720) [-1053.391] (-1062.008) (-1067.616) * [-1062.844] (-1066.099) (-1057.665) (-1070.147) -- 0:03:04
      441000 -- (-1069.540) (-1060.022) [-1063.639] (-1072.584) * (-1060.919) (-1059.545) [-1057.795] (-1079.831) -- 0:03:03
      441500 -- (-1066.470) (-1066.101) (-1067.817) [-1065.072] * (-1064.407) [-1066.132] (-1063.770) (-1059.181) -- 0:03:03
      442000 -- (-1060.452) (-1064.048) (-1062.810) [-1057.017] * (-1066.737) (-1082.048) [-1058.749] (-1071.978) -- 0:03:03
      442500 -- [-1053.349] (-1059.032) (-1064.303) (-1059.686) * [-1060.662] (-1069.435) (-1074.584) (-1059.670) -- 0:03:03
      443000 -- (-1065.319) (-1071.150) (-1064.284) [-1061.157] * [-1062.192] (-1047.634) (-1065.321) (-1072.611) -- 0:03:03
      443500 -- (-1074.393) (-1062.809) [-1052.455] (-1069.667) * [-1057.390] (-1075.449) (-1069.146) (-1063.261) -- 0:03:03
      444000 -- (-1052.372) (-1073.143) (-1058.083) [-1062.332] * (-1059.499) (-1071.291) (-1075.758) [-1056.681] -- 0:03:02
      444500 -- [-1054.291] (-1058.627) (-1064.034) (-1064.298) * (-1059.940) (-1061.725) [-1064.627] (-1059.790) -- 0:03:02
      445000 -- (-1053.453) (-1054.437) [-1067.345] (-1065.261) * (-1067.219) (-1070.293) [-1059.248] (-1057.220) -- 0:03:02

      Average standard deviation of split frequencies: 0.015285

      445500 -- [-1049.933] (-1065.783) (-1065.145) (-1065.470) * (-1065.117) [-1054.501] (-1061.297) (-1060.104) -- 0:03:02
      446000 -- (-1064.584) (-1057.489) [-1055.173] (-1064.452) * (-1057.496) (-1063.197) (-1055.923) [-1058.123] -- 0:03:02
      446500 -- (-1059.280) (-1068.959) [-1059.464] (-1057.626) * (-1068.766) [-1053.950] (-1055.861) (-1081.205) -- 0:03:02
      447000 -- (-1069.034) (-1073.684) (-1061.486) [-1052.161] * [-1060.709] (-1054.141) (-1054.499) (-1066.157) -- 0:03:01
      447500 -- [-1051.375] (-1069.312) (-1067.823) (-1067.852) * (-1065.001) (-1052.751) [-1052.258] (-1086.195) -- 0:03:01
      448000 -- [-1051.909] (-1082.345) (-1070.028) (-1052.930) * (-1078.277) (-1062.144) (-1066.352) [-1054.408] -- 0:03:01
      448500 -- (-1061.544) (-1074.899) (-1065.181) [-1055.893] * (-1058.738) [-1057.255] (-1059.355) (-1062.245) -- 0:03:00
      449000 -- (-1070.890) (-1063.360) (-1072.935) [-1052.952] * (-1053.002) (-1072.928) (-1059.241) [-1067.358] -- 0:03:01
      449500 -- [-1057.292] (-1063.350) (-1056.863) (-1054.517) * (-1074.814) (-1052.819) [-1065.487] (-1085.496) -- 0:03:01
      450000 -- (-1056.410) (-1059.496) [-1058.806] (-1066.875) * (-1068.857) (-1069.283) [-1058.727] (-1062.319) -- 0:03:00

      Average standard deviation of split frequencies: 0.015047

      450500 -- (-1060.018) (-1060.308) [-1053.892] (-1057.810) * [-1067.702] (-1069.454) (-1054.847) (-1062.308) -- 0:03:00
      451000 -- (-1063.687) (-1072.655) [-1054.861] (-1057.688) * (-1053.114) (-1073.434) (-1061.142) [-1058.562] -- 0:03:00
      451500 -- (-1055.003) (-1062.195) [-1048.904] (-1057.037) * (-1061.251) (-1072.366) [-1060.273] (-1063.815) -- 0:02:59
      452000 -- (-1069.692) [-1065.329] (-1067.231) (-1054.972) * [-1064.047] (-1065.836) (-1058.582) (-1076.358) -- 0:03:00
      452500 -- [-1058.297] (-1058.794) (-1057.126) (-1065.927) * [-1058.070] (-1071.996) (-1055.356) (-1058.458) -- 0:03:00
      453000 -- (-1064.144) [-1059.160] (-1087.533) (-1063.140) * (-1062.206) (-1061.616) (-1066.271) [-1055.329] -- 0:02:59
      453500 -- (-1063.628) (-1058.578) (-1085.721) [-1060.095] * (-1064.403) (-1052.977) (-1059.321) [-1049.656] -- 0:02:59
      454000 -- (-1060.529) [-1057.112] (-1064.762) (-1059.470) * [-1056.459] (-1073.493) (-1062.710) (-1059.111) -- 0:02:59
      454500 -- (-1067.331) (-1068.134) (-1068.341) [-1058.313] * [-1072.440] (-1064.177) (-1069.682) (-1059.945) -- 0:02:58
      455000 -- (-1061.288) (-1072.908) (-1061.653) [-1065.606] * (-1076.935) (-1058.404) (-1070.374) [-1048.450] -- 0:02:59

      Average standard deviation of split frequencies: 0.014155

      455500 -- (-1069.836) (-1057.850) [-1063.430] (-1066.944) * (-1082.858) [-1047.492] (-1057.980) (-1060.320) -- 0:02:59
      456000 -- [-1061.906] (-1058.244) (-1075.137) (-1065.505) * (-1058.663) [-1049.160] (-1076.390) (-1076.204) -- 0:02:58
      456500 -- (-1064.127) (-1054.916) (-1061.383) [-1063.845] * [-1060.272] (-1063.835) (-1070.018) (-1062.121) -- 0:02:58
      457000 -- (-1059.835) [-1053.782] (-1054.453) (-1060.041) * (-1057.712) (-1069.753) (-1057.526) [-1065.833] -- 0:02:58
      457500 -- [-1055.482] (-1061.165) (-1062.347) (-1073.027) * (-1056.131) (-1058.120) (-1063.689) [-1066.501] -- 0:02:57
      458000 -- (-1074.003) (-1064.176) [-1053.896] (-1067.119) * (-1059.980) [-1055.379] (-1071.870) (-1075.741) -- 0:02:58
      458500 -- (-1069.785) [-1063.046] (-1061.833) (-1079.978) * (-1072.619) [-1061.892] (-1053.861) (-1061.410) -- 0:02:58
      459000 -- (-1073.105) (-1063.544) (-1073.501) [-1061.119] * (-1061.494) [-1053.232] (-1065.316) (-1072.154) -- 0:02:57
      459500 -- [-1065.202] (-1062.391) (-1066.110) (-1066.450) * (-1062.787) [-1059.494] (-1071.006) (-1069.559) -- 0:02:57
      460000 -- (-1066.662) (-1061.679) (-1055.501) [-1056.548] * (-1068.464) [-1054.045] (-1056.606) (-1074.650) -- 0:02:57

      Average standard deviation of split frequencies: 0.013303

      460500 -- (-1069.995) [-1057.808] (-1061.385) (-1065.038) * [-1060.982] (-1055.710) (-1066.003) (-1061.340) -- 0:02:56
      461000 -- (-1066.920) [-1054.404] (-1068.123) (-1074.958) * (-1072.316) [-1058.814] (-1057.399) (-1067.961) -- 0:02:57
      461500 -- [-1051.389] (-1069.380) (-1064.865) (-1066.578) * (-1061.090) [-1048.938] (-1072.216) (-1060.259) -- 0:02:57
      462000 -- (-1081.222) [-1057.907] (-1060.500) (-1059.067) * (-1065.270) [-1063.925] (-1077.687) (-1064.117) -- 0:02:57
      462500 -- (-1072.962) (-1079.124) (-1072.034) [-1052.199] * (-1062.827) (-1061.464) [-1062.636] (-1073.906) -- 0:02:56
      463000 -- (-1067.696) [-1064.152] (-1056.227) (-1059.112) * (-1061.747) [-1053.958] (-1060.346) (-1077.244) -- 0:02:56
      463500 -- (-1070.491) (-1056.755) (-1055.498) [-1052.777] * (-1055.177) (-1063.075) [-1059.403] (-1074.195) -- 0:02:55
      464000 -- (-1065.259) (-1057.138) [-1055.199] (-1064.363) * (-1052.329) (-1061.824) (-1071.599) [-1059.266] -- 0:02:56
      464500 -- (-1057.131) (-1068.640) (-1064.320) [-1057.768] * (-1068.800) [-1060.642] (-1074.072) (-1069.386) -- 0:02:56
      465000 -- (-1059.329) (-1057.106) [-1059.883] (-1058.172) * [-1064.815] (-1060.071) (-1061.344) (-1056.650) -- 0:02:56

      Average standard deviation of split frequencies: 0.014007

      465500 -- (-1079.042) [-1062.026] (-1064.139) (-1061.830) * (-1059.002) (-1057.888) [-1056.713] (-1059.831) -- 0:02:55
      466000 -- (-1064.238) [-1050.531] (-1067.766) (-1064.743) * (-1068.142) (-1062.383) [-1062.689] (-1072.702) -- 0:02:55
      466500 -- (-1066.449) (-1053.830) [-1060.663] (-1069.693) * (-1079.762) (-1069.764) [-1056.760] (-1067.607) -- 0:02:54
      467000 -- (-1083.520) [-1072.618] (-1057.397) (-1075.220) * (-1081.112) (-1061.162) (-1063.826) [-1056.631] -- 0:02:55
      467500 -- (-1064.505) [-1067.951] (-1058.885) (-1072.022) * (-1077.396) (-1062.963) (-1065.319) [-1054.527] -- 0:02:55
      468000 -- [-1054.957] (-1059.737) (-1067.037) (-1065.745) * (-1078.807) (-1061.987) (-1082.104) [-1069.081] -- 0:02:55
      468500 -- (-1085.580) (-1070.399) [-1064.169] (-1061.178) * (-1072.578) (-1057.704) (-1070.575) [-1058.552] -- 0:02:54
      469000 -- (-1066.804) (-1064.623) (-1062.417) [-1063.782] * (-1075.975) [-1057.102] (-1062.419) (-1060.766) -- 0:02:54
      469500 -- (-1064.697) (-1066.106) [-1051.075] (-1061.924) * (-1057.455) (-1059.300) (-1059.437) [-1061.766] -- 0:02:54
      470000 -- (-1066.515) (-1073.133) (-1058.204) [-1059.679] * [-1052.780] (-1059.768) (-1070.455) (-1069.783) -- 0:02:54

      Average standard deviation of split frequencies: 0.013945

      470500 -- (-1069.185) [-1066.582] (-1070.333) (-1049.089) * (-1073.399) [-1052.202] (-1068.427) (-1072.895) -- 0:02:54
      471000 -- (-1072.842) (-1063.229) (-1070.609) [-1062.018] * (-1068.112) [-1052.872] (-1060.867) (-1078.955) -- 0:02:54
      471500 -- (-1054.913) (-1061.622) [-1054.490] (-1051.319) * (-1049.876) (-1057.394) (-1067.117) [-1067.571] -- 0:02:53
      472000 -- (-1072.332) (-1072.366) [-1052.397] (-1055.083) * (-1060.375) [-1056.525] (-1057.474) (-1071.016) -- 0:02:53
      472500 -- (-1059.060) [-1062.308] (-1060.063) (-1063.436) * (-1059.366) (-1059.524) [-1063.069] (-1070.263) -- 0:02:53
      473000 -- (-1068.348) [-1068.706] (-1060.474) (-1052.409) * (-1066.891) (-1053.028) (-1061.509) [-1053.634] -- 0:02:53
      473500 -- (-1066.050) (-1059.084) [-1047.421] (-1054.095) * (-1064.292) (-1059.261) (-1063.302) [-1058.793] -- 0:02:53
      474000 -- [-1064.552] (-1063.425) (-1062.038) (-1055.757) * (-1066.790) (-1059.906) (-1071.239) [-1061.906] -- 0:02:53
      474500 -- (-1080.523) [-1056.787] (-1061.649) (-1060.470) * [-1057.438] (-1071.602) (-1059.443) (-1077.693) -- 0:02:52
      475000 -- (-1064.561) (-1079.586) (-1065.660) [-1065.354] * [-1060.004] (-1064.481) (-1066.022) (-1067.016) -- 0:02:52

      Average standard deviation of split frequencies: 0.013332

      475500 -- (-1066.636) [-1050.824] (-1058.954) (-1064.168) * (-1064.885) [-1053.221] (-1060.600) (-1064.572) -- 0:02:52
      476000 -- (-1082.491) (-1061.721) (-1059.999) [-1058.437] * (-1069.333) (-1054.810) (-1071.919) [-1061.762] -- 0:02:52
      476500 -- (-1079.142) [-1058.673] (-1052.790) (-1062.284) * (-1064.653) (-1058.676) (-1061.479) [-1057.720] -- 0:02:52
      477000 -- (-1066.688) [-1061.252] (-1050.298) (-1066.493) * (-1064.149) [-1056.600] (-1070.248) (-1054.919) -- 0:02:52
      477500 -- [-1065.269] (-1056.575) (-1064.950) (-1069.749) * (-1072.988) [-1054.889] (-1069.821) (-1060.420) -- 0:02:51
      478000 -- (-1071.910) [-1063.289] (-1069.334) (-1080.726) * (-1058.058) [-1064.537] (-1067.433) (-1060.536) -- 0:02:51
      478500 -- (-1070.178) (-1068.144) (-1050.633) [-1065.367] * [-1056.996] (-1061.836) (-1073.390) (-1070.816) -- 0:02:51
      479000 -- (-1080.511) (-1065.436) [-1054.364] (-1052.147) * (-1062.835) [-1066.545] (-1067.239) (-1066.640) -- 0:02:51
      479500 -- (-1060.984) (-1079.791) (-1064.569) [-1066.639] * (-1063.142) (-1053.771) (-1056.690) [-1060.078] -- 0:02:51
      480000 -- (-1066.995) (-1067.065) (-1067.143) [-1059.570] * [-1059.509] (-1076.798) (-1087.805) (-1063.136) -- 0:02:51

      Average standard deviation of split frequencies: 0.013504

      480500 -- (-1062.962) (-1066.109) [-1055.356] (-1066.455) * (-1063.822) (-1056.650) (-1065.488) [-1059.974] -- 0:02:50
      481000 -- (-1062.881) (-1079.050) [-1055.195] (-1069.985) * (-1055.016) (-1073.659) (-1070.321) [-1057.198] -- 0:02:50
      481500 -- [-1061.797] (-1056.907) (-1076.079) (-1068.197) * (-1071.884) (-1074.417) (-1072.105) [-1058.425] -- 0:02:50
      482000 -- (-1075.908) [-1056.483] (-1057.513) (-1067.635) * (-1077.409) (-1066.797) (-1057.602) [-1063.491] -- 0:02:49
      482500 -- (-1058.460) [-1057.577] (-1070.099) (-1061.813) * (-1068.950) (-1083.880) (-1079.130) [-1050.373] -- 0:02:50
      483000 -- (-1065.986) (-1060.289) (-1063.290) [-1070.452] * (-1057.285) (-1069.434) (-1057.504) [-1054.515] -- 0:02:50
      483500 -- [-1060.898] (-1051.062) (-1068.383) (-1072.211) * (-1064.750) (-1076.060) [-1063.028] (-1060.476) -- 0:02:49
      484000 -- [-1056.391] (-1068.277) (-1064.469) (-1079.421) * (-1050.856) (-1064.006) [-1053.373] (-1055.915) -- 0:02:49
      484500 -- [-1059.177] (-1073.708) (-1066.003) (-1066.278) * [-1050.549] (-1059.732) (-1088.238) (-1061.245) -- 0:02:49
      485000 -- (-1056.844) (-1067.294) [-1056.742] (-1059.687) * (-1064.836) [-1055.476] (-1064.178) (-1060.166) -- 0:02:48

      Average standard deviation of split frequencies: 0.013132

      485500 -- [-1053.992] (-1059.873) (-1061.675) (-1069.774) * (-1062.136) [-1057.013] (-1088.699) (-1061.352) -- 0:02:49
      486000 -- [-1052.035] (-1049.808) (-1072.134) (-1052.362) * (-1059.017) (-1054.643) (-1061.911) [-1059.162] -- 0:02:49
      486500 -- (-1058.995) (-1059.864) (-1079.302) [-1052.735] * (-1066.512) (-1059.508) (-1058.059) [-1060.471] -- 0:02:48
      487000 -- (-1068.394) (-1055.784) (-1063.574) [-1053.890] * (-1062.676) (-1064.837) [-1053.355] (-1061.729) -- 0:02:48
      487500 -- (-1080.132) (-1068.601) [-1061.628] (-1068.794) * (-1065.364) [-1052.471] (-1059.030) (-1070.337) -- 0:02:48
      488000 -- (-1075.810) (-1056.285) [-1063.342] (-1076.865) * (-1062.025) [-1055.141] (-1063.135) (-1059.636) -- 0:02:47
      488500 -- [-1053.861] (-1071.596) (-1050.150) (-1069.960) * (-1076.807) (-1067.039) [-1061.021] (-1069.931) -- 0:02:48
      489000 -- (-1065.873) [-1059.287] (-1056.475) (-1054.736) * [-1057.522] (-1063.397) (-1058.462) (-1061.216) -- 0:02:48
      489500 -- (-1063.993) (-1067.308) (-1054.340) [-1049.997] * (-1071.425) [-1061.116] (-1070.021) (-1055.818) -- 0:02:47
      490000 -- [-1062.352] (-1073.077) (-1060.098) (-1059.717) * [-1058.406] (-1071.233) (-1067.531) (-1071.336) -- 0:02:47

      Average standard deviation of split frequencies: 0.013524

      490500 -- (-1074.643) (-1064.825) (-1058.987) [-1056.769] * [-1057.621] (-1074.246) (-1056.043) (-1060.858) -- 0:02:47
      491000 -- (-1069.125) (-1061.891) (-1060.692) [-1047.544] * [-1059.437] (-1063.788) (-1068.826) (-1073.207) -- 0:02:46
      491500 -- (-1052.565) [-1054.274] (-1077.636) (-1070.034) * (-1059.803) [-1052.098] (-1069.085) (-1073.322) -- 0:02:47
      492000 -- [-1061.622] (-1050.040) (-1063.267) (-1072.443) * (-1066.280) [-1053.402] (-1069.188) (-1053.816) -- 0:02:47
      492500 -- (-1061.479) [-1049.163] (-1050.698) (-1078.381) * [-1056.608] (-1059.892) (-1056.015) (-1060.886) -- 0:02:46
      493000 -- (-1057.791) (-1065.895) [-1055.271] (-1076.919) * [-1048.687] (-1071.140) (-1059.369) (-1071.922) -- 0:02:46
      493500 -- [-1056.258] (-1073.896) (-1068.622) (-1070.511) * (-1059.641) [-1061.749] (-1057.932) (-1064.686) -- 0:02:46
      494000 -- (-1068.894) [-1053.984] (-1049.751) (-1073.336) * (-1056.865) (-1069.557) (-1062.574) [-1055.725] -- 0:02:45
      494500 -- (-1057.635) [-1054.540] (-1057.778) (-1066.241) * (-1072.473) (-1068.420) [-1068.631] (-1058.171) -- 0:02:46
      495000 -- (-1072.196) [-1061.095] (-1054.425) (-1057.537) * (-1067.813) [-1060.515] (-1056.479) (-1059.878) -- 0:02:46

      Average standard deviation of split frequencies: 0.013525

      495500 -- (-1059.354) (-1073.859) [-1055.549] (-1063.045) * (-1065.905) [-1052.890] (-1075.572) (-1063.699) -- 0:02:45
      496000 -- (-1074.464) [-1050.593] (-1058.089) (-1076.007) * (-1073.255) (-1059.362) (-1072.639) [-1054.291] -- 0:02:45
      496500 -- (-1070.249) [-1049.213] (-1055.133) (-1056.682) * (-1072.530) (-1062.898) [-1051.330] (-1071.375) -- 0:02:45
      497000 -- (-1059.547) [-1050.258] (-1075.571) (-1056.004) * (-1073.469) [-1060.065] (-1050.183) (-1062.104) -- 0:02:44
      497500 -- (-1069.723) [-1059.125] (-1073.933) (-1059.829) * (-1071.983) (-1063.603) (-1070.293) [-1064.615] -- 0:02:45
      498000 -- (-1062.415) (-1054.011) [-1055.083] (-1058.584) * [-1051.734] (-1063.680) (-1061.141) (-1067.306) -- 0:02:45
      498500 -- (-1064.499) (-1064.242) (-1073.978) [-1059.840] * (-1060.327) [-1052.697] (-1070.184) (-1060.189) -- 0:02:44
      499000 -- [-1055.929] (-1063.249) (-1055.192) (-1067.767) * [-1059.158] (-1063.204) (-1069.874) (-1066.303) -- 0:02:44
      499500 -- (-1064.010) [-1051.899] (-1066.175) (-1061.205) * (-1061.172) (-1068.558) (-1080.892) [-1064.667] -- 0:02:44
      500000 -- (-1067.280) [-1055.767] (-1082.576) (-1075.203) * [-1060.418] (-1063.909) (-1065.788) (-1071.309) -- 0:02:44

      Average standard deviation of split frequencies: 0.013399

      500500 -- (-1070.265) (-1066.892) (-1059.893) [-1059.070] * (-1060.517) (-1072.398) (-1048.006) [-1053.783] -- 0:02:44
      501000 -- [-1067.988] (-1079.558) (-1065.441) (-1059.080) * (-1062.151) (-1057.769) (-1050.658) [-1063.319] -- 0:02:44
      501500 -- [-1059.083] (-1074.226) (-1061.587) (-1061.092) * (-1062.615) [-1051.115] (-1062.257) (-1074.743) -- 0:02:44
      502000 -- [-1053.618] (-1078.053) (-1061.111) (-1053.620) * [-1052.323] (-1065.724) (-1060.072) (-1081.994) -- 0:02:43
      502500 -- [-1060.352] (-1060.155) (-1066.107) (-1062.142) * (-1061.549) (-1070.945) [-1061.373] (-1064.752) -- 0:02:43
      503000 -- (-1080.679) [-1064.842] (-1050.808) (-1075.028) * [-1055.987] (-1062.064) (-1061.897) (-1069.659) -- 0:02:43
      503500 -- (-1065.449) (-1076.554) (-1052.296) [-1062.663] * (-1064.723) [-1060.051] (-1064.303) (-1063.729) -- 0:02:43
      504000 -- [-1053.449] (-1071.024) (-1054.109) (-1058.731) * (-1072.073) (-1071.354) (-1065.684) [-1050.751] -- 0:02:43
      504500 -- [-1060.285] (-1061.701) (-1077.553) (-1053.277) * [-1063.248] (-1068.776) (-1068.913) (-1049.291) -- 0:02:43
      505000 -- (-1049.773) [-1054.060] (-1062.345) (-1069.662) * (-1061.093) (-1063.643) (-1053.710) [-1057.807] -- 0:02:42

      Average standard deviation of split frequencies: 0.012971

      505500 -- (-1056.596) [-1056.597] (-1069.398) (-1082.830) * [-1064.703] (-1076.393) (-1055.072) (-1060.934) -- 0:02:42
      506000 -- (-1057.466) (-1063.415) (-1077.493) [-1057.024] * (-1067.504) (-1067.968) (-1068.928) [-1056.499] -- 0:02:42
      506500 -- [-1057.789] (-1060.303) (-1066.039) (-1069.777) * (-1068.112) (-1073.413) (-1065.105) [-1056.068] -- 0:02:42
      507000 -- [-1050.876] (-1056.866) (-1075.979) (-1066.116) * (-1070.437) (-1060.962) (-1061.977) [-1074.255] -- 0:02:42
      507500 -- [-1048.700] (-1073.888) (-1074.338) (-1065.768) * (-1076.155) (-1064.934) [-1063.117] (-1059.879) -- 0:02:42
      508000 -- (-1068.214) (-1058.594) (-1063.477) [-1054.344] * (-1064.548) [-1053.524] (-1066.701) (-1057.757) -- 0:02:41
      508500 -- (-1071.066) (-1050.555) (-1059.054) [-1061.832] * (-1064.835) (-1067.731) (-1067.272) [-1060.449] -- 0:02:41
      509000 -- (-1056.629) (-1068.753) (-1065.891) [-1052.984] * [-1063.339] (-1047.298) (-1056.347) (-1069.147) -- 0:02:41
      509500 -- (-1069.176) (-1062.346) (-1065.548) [-1047.513] * (-1065.452) (-1052.860) [-1058.125] (-1075.097) -- 0:02:41
      510000 -- (-1072.773) (-1074.622) [-1068.693] (-1059.060) * (-1068.699) (-1059.914) [-1051.117] (-1066.792) -- 0:02:41

      Average standard deviation of split frequencies: 0.012072

      510500 -- (-1079.503) (-1076.341) (-1055.739) [-1071.752] * (-1059.536) [-1057.734] (-1061.905) (-1060.865) -- 0:02:41
      511000 -- (-1079.491) (-1068.498) [-1064.178] (-1083.671) * [-1066.673] (-1069.172) (-1065.017) (-1054.029) -- 0:02:40
      511500 -- (-1082.079) [-1067.154] (-1074.159) (-1060.189) * (-1071.108) (-1068.561) [-1067.417] (-1072.380) -- 0:02:40
      512000 -- (-1084.146) (-1058.143) (-1079.810) [-1071.075] * (-1063.039) (-1054.411) [-1047.125] (-1072.818) -- 0:02:40
      512500 -- (-1057.929) [-1056.187] (-1074.769) (-1060.336) * (-1059.513) [-1048.081] (-1060.944) (-1050.657) -- 0:02:40
      513000 -- [-1056.920] (-1062.344) (-1066.841) (-1056.416) * (-1077.620) (-1055.527) (-1075.421) [-1053.837] -- 0:02:40
      513500 -- [-1057.638] (-1065.077) (-1069.693) (-1070.760) * (-1077.347) (-1058.853) (-1084.599) [-1060.402] -- 0:02:40
      514000 -- (-1070.869) [-1056.987] (-1066.172) (-1065.456) * [-1069.923] (-1062.813) (-1065.402) (-1068.659) -- 0:02:39
      514500 -- (-1058.563) (-1070.039) [-1060.450] (-1071.027) * (-1054.146) (-1068.843) (-1067.036) [-1057.047] -- 0:02:39
      515000 -- [-1059.994] (-1066.283) (-1058.820) (-1055.931) * [-1058.787] (-1061.166) (-1057.349) (-1055.667) -- 0:02:39

      Average standard deviation of split frequencies: 0.010682

      515500 -- [-1057.574] (-1072.048) (-1056.541) (-1064.642) * (-1071.939) (-1066.206) [-1056.815] (-1065.916) -- 0:02:39
      516000 -- (-1069.164) [-1059.970] (-1062.052) (-1060.847) * [-1050.088] (-1062.937) (-1058.853) (-1063.623) -- 0:02:39
      516500 -- (-1076.049) (-1065.367) (-1057.965) [-1058.681] * (-1062.387) [-1061.428] (-1065.779) (-1063.253) -- 0:02:39
      517000 -- (-1063.693) (-1060.572) [-1056.799] (-1060.412) * (-1062.792) [-1055.448] (-1056.885) (-1059.846) -- 0:02:38
      517500 -- [-1083.179] (-1072.776) (-1064.430) (-1059.742) * (-1063.386) (-1069.697) [-1052.516] (-1058.299) -- 0:02:38
      518000 -- (-1071.544) (-1065.934) (-1068.037) [-1052.260] * (-1071.908) (-1067.990) [-1056.483] (-1074.346) -- 0:02:39
      518500 -- (-1065.363) [-1058.279] (-1071.001) (-1078.312) * (-1059.992) (-1053.458) (-1058.944) [-1059.022] -- 0:02:38
      519000 -- (-1078.285) [-1058.346] (-1055.278) (-1073.222) * (-1066.426) [-1047.607] (-1050.273) (-1075.180) -- 0:02:38
      519500 -- (-1076.091) (-1069.946) [-1051.427] (-1061.571) * [-1059.134] (-1060.493) (-1070.578) (-1060.202) -- 0:02:38
      520000 -- (-1060.556) [-1055.542] (-1056.006) (-1061.486) * (-1054.272) (-1076.167) [-1053.297] (-1068.146) -- 0:02:37

      Average standard deviation of split frequencies: 0.010934

      520500 -- (-1049.336) (-1065.046) (-1070.664) [-1057.831] * (-1075.458) [-1056.573] (-1065.128) (-1061.455) -- 0:02:37
      521000 -- (-1049.874) [-1052.322] (-1077.399) (-1068.429) * (-1068.881) [-1065.961] (-1052.544) (-1059.012) -- 0:02:38
      521500 -- (-1052.548) (-1060.400) [-1067.002] (-1069.326) * (-1079.200) (-1056.277) (-1062.722) [-1059.791] -- 0:02:37
      522000 -- (-1065.793) (-1069.631) [-1052.257] (-1076.245) * (-1068.678) [-1058.279] (-1074.663) (-1086.430) -- 0:02:37
      522500 -- (-1057.912) [-1056.919] (-1081.989) (-1068.958) * (-1061.774) [-1068.523] (-1062.143) (-1057.249) -- 0:02:37
      523000 -- (-1059.206) (-1067.282) (-1087.183) [-1062.215] * (-1073.903) [-1053.009] (-1075.921) (-1054.521) -- 0:02:36
      523500 -- (-1070.547) (-1067.728) [-1063.702] (-1057.860) * (-1071.669) [-1060.510] (-1076.309) (-1065.973) -- 0:02:36
      524000 -- (-1072.729) [-1057.289] (-1076.960) (-1058.729) * (-1063.523) [-1055.114] (-1063.332) (-1057.338) -- 0:02:37
      524500 -- (-1070.243) (-1061.370) (-1075.984) [-1054.518] * (-1055.719) (-1056.469) (-1072.694) [-1057.027] -- 0:02:36
      525000 -- [-1059.176] (-1069.958) (-1077.472) (-1081.260) * (-1063.222) [-1057.517] (-1067.899) (-1057.054) -- 0:02:36

      Average standard deviation of split frequencies: 0.010203

      525500 -- [-1051.658] (-1067.457) (-1071.184) (-1059.601) * (-1067.677) (-1055.502) [-1053.999] (-1065.112) -- 0:02:36
      526000 -- (-1069.877) (-1072.828) [-1060.723] (-1067.836) * (-1060.079) (-1051.346) [-1059.201] (-1067.144) -- 0:02:35
      526500 -- (-1066.236) (-1063.533) (-1055.109) [-1063.820] * [-1057.808] (-1067.717) (-1070.060) (-1066.582) -- 0:02:36
      527000 -- (-1072.772) (-1078.472) [-1056.295] (-1068.167) * [-1055.257] (-1080.629) (-1069.905) (-1061.713) -- 0:02:36
      527500 -- (-1063.485) (-1074.725) [-1052.205] (-1066.755) * (-1055.019) [-1057.378] (-1070.611) (-1073.703) -- 0:02:35
      528000 -- (-1060.659) (-1062.831) (-1063.820) [-1062.669] * (-1062.488) (-1063.744) [-1056.665] (-1066.306) -- 0:02:35
      528500 -- (-1056.478) (-1073.291) (-1058.336) [-1058.272] * (-1069.840) (-1078.715) [-1059.973] (-1067.193) -- 0:02:35
      529000 -- [-1054.420] (-1067.782) (-1065.868) (-1078.281) * (-1059.348) [-1057.065] (-1068.646) (-1050.316) -- 0:02:34
      529500 -- [-1061.788] (-1058.716) (-1059.544) (-1073.182) * (-1064.485) [-1056.862] (-1076.333) (-1066.570) -- 0:02:35
      530000 -- (-1067.543) [-1048.361] (-1056.894) (-1063.612) * (-1057.105) [-1062.385] (-1069.426) (-1063.646) -- 0:02:35

      Average standard deviation of split frequencies: 0.010113

      530500 -- (-1079.591) [-1065.841] (-1060.890) (-1060.164) * [-1051.225] (-1070.955) (-1067.674) (-1076.737) -- 0:02:34
      531000 -- (-1064.792) [-1063.093] (-1065.474) (-1068.321) * (-1061.721) (-1082.535) [-1057.557] (-1077.023) -- 0:02:34
      531500 -- [-1054.164] (-1059.192) (-1071.842) (-1064.383) * (-1057.479) [-1062.691] (-1065.967) (-1072.146) -- 0:02:34
      532000 -- (-1060.200) [-1051.922] (-1064.606) (-1063.128) * [-1052.615] (-1062.896) (-1058.087) (-1065.381) -- 0:02:33
      532500 -- (-1063.907) [-1063.833] (-1071.935) (-1056.582) * (-1064.710) (-1065.196) (-1074.329) [-1053.552] -- 0:02:34
      533000 -- (-1069.377) (-1061.044) [-1059.470] (-1064.265) * (-1060.993) (-1074.446) [-1060.136] (-1066.084) -- 0:02:34
      533500 -- (-1064.168) (-1063.396) [-1063.576] (-1062.691) * [-1058.977] (-1060.154) (-1067.412) (-1066.389) -- 0:02:33
      534000 -- (-1055.230) [-1059.181] (-1060.058) (-1072.503) * [-1074.159] (-1069.513) (-1054.630) (-1080.605) -- 0:02:33
      534500 -- (-1071.361) (-1053.311) (-1061.158) [-1063.573] * (-1067.980) [-1062.363] (-1078.480) (-1074.801) -- 0:02:33
      535000 -- (-1057.754) [-1064.465] (-1062.492) (-1070.092) * (-1068.516) (-1073.097) (-1072.780) [-1056.351] -- 0:02:32

      Average standard deviation of split frequencies: 0.009607

      535500 -- [-1057.370] (-1076.338) (-1069.897) (-1061.999) * [-1060.587] (-1072.354) (-1077.113) (-1072.493) -- 0:02:33
      536000 -- (-1067.371) (-1066.868) (-1064.564) [-1062.641] * (-1061.158) (-1069.222) (-1058.921) [-1058.192] -- 0:02:33
      536500 -- (-1053.391) (-1081.388) (-1065.913) [-1059.389] * [-1061.066] (-1067.424) (-1074.026) (-1050.656) -- 0:02:32
      537000 -- (-1055.548) (-1072.796) [-1058.419] (-1063.438) * (-1065.972) (-1071.048) (-1071.870) [-1051.664] -- 0:02:32
      537500 -- [-1058.088] (-1064.644) (-1057.974) (-1071.336) * (-1057.984) [-1059.456] (-1068.427) (-1056.391) -- 0:02:32
      538000 -- (-1062.241) [-1046.596] (-1069.165) (-1061.374) * (-1055.274) [-1059.334] (-1064.429) (-1063.140) -- 0:02:31
      538500 -- (-1058.492) (-1066.950) [-1057.484] (-1070.508) * (-1058.686) [-1054.741] (-1057.104) (-1065.980) -- 0:02:32
      539000 -- [-1065.318] (-1057.502) (-1079.276) (-1058.571) * [-1047.726] (-1061.076) (-1057.915) (-1063.504) -- 0:02:32
      539500 -- [-1052.633] (-1074.111) (-1056.242) (-1078.724) * (-1056.298) (-1062.764) (-1056.937) [-1044.557] -- 0:02:31
      540000 -- (-1066.396) (-1067.639) (-1058.541) [-1066.040] * (-1062.021) [-1060.286] (-1075.612) (-1067.832) -- 0:02:31

      Average standard deviation of split frequencies: 0.009591

      540500 -- (-1061.106) [-1068.637] (-1070.266) (-1061.996) * (-1076.971) (-1060.010) [-1061.529] (-1061.088) -- 0:02:31
      541000 -- (-1064.078) (-1072.485) (-1061.442) [-1060.859] * (-1077.722) (-1077.825) (-1064.143) [-1058.342] -- 0:02:31
      541500 -- (-1069.972) (-1057.625) [-1054.732] (-1057.942) * (-1068.806) (-1052.542) [-1061.472] (-1053.443) -- 0:02:31
      542000 -- (-1065.312) [-1056.418] (-1065.063) (-1061.104) * (-1062.718) [-1061.579] (-1053.194) (-1060.765) -- 0:02:31
      542500 -- (-1063.549) (-1075.061) (-1057.894) [-1055.911] * (-1074.704) (-1069.018) (-1067.748) [-1058.089] -- 0:02:30
      543000 -- (-1069.717) (-1073.935) (-1061.524) [-1052.339] * (-1064.326) (-1070.638) [-1060.004] (-1066.635) -- 0:02:30
      543500 -- [-1065.317] (-1057.965) (-1072.408) (-1053.042) * (-1064.546) (-1067.637) (-1069.914) [-1054.371] -- 0:02:30
      544000 -- (-1059.150) [-1063.363] (-1058.661) (-1079.260) * [-1060.190] (-1073.782) (-1065.662) (-1061.759) -- 0:02:30
      544500 -- (-1062.588) (-1054.806) (-1060.021) [-1063.908] * [-1058.390] (-1072.308) (-1071.974) (-1055.117) -- 0:02:30
      545000 -- (-1074.901) (-1061.366) [-1060.008] (-1067.050) * (-1054.000) [-1055.692] (-1074.182) (-1061.576) -- 0:02:30

      Average standard deviation of split frequencies: 0.009564

      545500 -- (-1069.125) (-1057.204) (-1073.662) [-1050.119] * [-1055.592] (-1058.488) (-1069.599) (-1062.112) -- 0:02:29
      546000 -- [-1069.358] (-1070.792) (-1070.859) (-1062.190) * [-1056.873] (-1060.422) (-1077.567) (-1061.005) -- 0:02:29
      546500 -- (-1056.522) (-1086.931) [-1049.183] (-1071.270) * (-1060.817) [-1052.369] (-1081.516) (-1058.949) -- 0:02:29
      547000 -- [-1059.602] (-1070.377) (-1063.376) (-1063.304) * (-1077.518) (-1050.761) [-1070.390] (-1059.901) -- 0:02:29
      547500 -- (-1057.763) (-1063.281) [-1064.424] (-1060.505) * (-1068.782) [-1073.135] (-1048.875) (-1061.368) -- 0:02:29
      548000 -- (-1057.031) (-1063.071) (-1067.181) [-1056.863] * (-1073.226) (-1063.990) [-1055.932] (-1063.803) -- 0:02:29
      548500 -- [-1058.311] (-1057.957) (-1063.094) (-1057.950) * (-1065.555) [-1050.571] (-1066.161) (-1065.809) -- 0:02:28
      549000 -- [-1054.645] (-1072.326) (-1054.845) (-1065.453) * (-1060.805) [-1056.169] (-1067.079) (-1070.574) -- 0:02:28
      549500 -- (-1060.442) (-1075.599) [-1054.020] (-1058.845) * [-1062.377] (-1058.596) (-1070.375) (-1079.504) -- 0:02:28
      550000 -- (-1070.543) (-1055.234) (-1067.924) [-1066.236] * (-1061.896) [-1052.905] (-1067.764) (-1067.800) -- 0:02:28

      Average standard deviation of split frequencies: 0.009483

      550500 -- (-1073.785) (-1078.156) (-1056.554) [-1060.177] * (-1068.302) (-1075.741) (-1071.582) [-1056.352] -- 0:02:28
      551000 -- (-1076.608) [-1058.308] (-1063.284) (-1060.368) * [-1052.182] (-1055.367) (-1062.595) (-1058.855) -- 0:02:28
      551500 -- (-1068.044) (-1060.686) (-1070.003) [-1055.142] * (-1060.381) (-1058.594) (-1064.276) [-1051.488] -- 0:02:28
      552000 -- [-1062.784] (-1060.323) (-1064.025) (-1061.960) * [-1055.648] (-1079.491) (-1057.198) (-1054.681) -- 0:02:27
      552500 -- (-1060.375) (-1072.231) [-1055.319] (-1071.911) * (-1053.400) (-1061.259) (-1065.776) [-1056.141] -- 0:02:27
      553000 -- (-1073.820) (-1071.775) [-1064.365] (-1069.436) * (-1069.218) [-1058.504] (-1064.799) (-1066.768) -- 0:02:27
      553500 -- [-1058.989] (-1073.880) (-1056.221) (-1054.213) * (-1056.422) (-1049.603) [-1054.287] (-1068.019) -- 0:02:27
      554000 -- [-1055.607] (-1060.873) (-1068.720) (-1064.587) * (-1057.783) (-1054.895) [-1048.542] (-1070.067) -- 0:02:27
      554500 -- (-1060.418) [-1053.290] (-1073.877) (-1054.639) * (-1067.528) [-1051.131] (-1062.899) (-1076.190) -- 0:02:27
      555000 -- (-1062.782) [-1055.220] (-1066.850) (-1078.081) * (-1053.848) (-1065.587) [-1065.786] (-1067.687) -- 0:02:26

      Average standard deviation of split frequencies: 0.009522

      555500 -- (-1068.162) [-1059.754] (-1064.707) (-1078.293) * (-1064.360) [-1057.333] (-1067.197) (-1064.448) -- 0:02:26
      556000 -- [-1056.985] (-1050.206) (-1067.543) (-1074.689) * (-1066.574) [-1054.549] (-1074.374) (-1069.314) -- 0:02:26
      556500 -- (-1059.693) (-1056.804) (-1070.182) [-1060.224] * (-1058.849) [-1058.596] (-1063.571) (-1061.818) -- 0:02:26
      557000 -- (-1074.685) [-1049.275] (-1055.981) (-1066.442) * (-1069.424) (-1074.136) (-1063.494) [-1052.383] -- 0:02:26
      557500 -- (-1050.416) (-1060.203) [-1057.237] (-1066.015) * (-1061.888) [-1055.585] (-1063.269) (-1055.361) -- 0:02:26
      558000 -- (-1058.047) [-1057.845] (-1067.515) (-1070.215) * [-1057.336] (-1067.758) (-1060.282) (-1066.743) -- 0:02:25
      558500 -- (-1057.637) [-1060.313] (-1060.354) (-1053.764) * (-1051.150) (-1069.135) (-1087.512) [-1063.337] -- 0:02:25
      559000 -- [-1055.702] (-1056.103) (-1074.560) (-1073.025) * [-1056.925] (-1061.693) (-1086.237) (-1062.154) -- 0:02:25
      559500 -- (-1081.178) [-1058.023] (-1059.538) (-1060.721) * (-1070.195) (-1058.392) [-1056.977] (-1064.593) -- 0:02:25
      560000 -- (-1058.409) (-1076.551) (-1059.974) [-1054.706] * (-1077.901) [-1054.616] (-1059.078) (-1074.410) -- 0:02:25

      Average standard deviation of split frequencies: 0.009249

      560500 -- [-1057.282] (-1065.380) (-1064.522) (-1058.232) * (-1066.613) (-1052.836) [-1057.936] (-1052.681) -- 0:02:25
      561000 -- [-1057.120] (-1056.473) (-1076.644) (-1055.697) * (-1077.043) (-1053.021) [-1064.795] (-1052.301) -- 0:02:24
      561500 -- (-1070.371) (-1057.488) (-1053.004) [-1061.111] * (-1076.155) (-1065.794) (-1068.816) [-1057.160] -- 0:02:24
      562000 -- [-1057.736] (-1074.260) (-1069.926) (-1067.337) * (-1068.663) (-1065.223) [-1075.030] (-1056.198) -- 0:02:24
      562500 -- (-1064.679) [-1063.755] (-1063.506) (-1060.407) * (-1060.271) [-1061.275] (-1073.760) (-1061.973) -- 0:02:24
      563000 -- (-1056.993) (-1074.160) [-1058.297] (-1070.524) * (-1062.439) (-1062.224) [-1056.666] (-1068.127) -- 0:02:24
      563500 -- (-1059.080) (-1080.274) [-1066.043] (-1058.649) * (-1074.101) (-1059.838) [-1068.121] (-1063.684) -- 0:02:24
      564000 -- (-1067.653) [-1062.105] (-1077.731) (-1058.875) * (-1062.792) (-1062.683) (-1066.344) [-1060.528] -- 0:02:23
      564500 -- (-1083.327) (-1062.805) [-1062.917] (-1047.708) * (-1074.040) [-1054.959] (-1062.642) (-1079.589) -- 0:02:23
      565000 -- (-1073.943) (-1065.043) [-1048.223] (-1062.802) * (-1063.253) (-1076.117) [-1056.218] (-1072.038) -- 0:02:23

      Average standard deviation of split frequencies: 0.009418

      565500 -- (-1065.346) (-1060.160) (-1061.526) [-1058.241] * (-1069.282) (-1060.609) (-1063.503) [-1072.185] -- 0:02:23
      566000 -- (-1068.685) (-1068.777) (-1051.432) [-1061.095] * (-1067.221) (-1065.484) [-1059.910] (-1069.881) -- 0:02:23
      566500 -- (-1071.664) (-1060.074) (-1062.376) [-1055.912] * (-1069.642) (-1062.550) [-1053.236] (-1073.102) -- 0:02:23
      567000 -- (-1064.071) (-1066.005) [-1061.321] (-1060.751) * (-1063.588) [-1055.633] (-1066.772) (-1057.170) -- 0:02:22
      567500 -- (-1068.681) (-1059.294) (-1056.365) [-1060.924] * (-1066.578) (-1074.290) (-1068.291) [-1056.001] -- 0:02:22
      568000 -- (-1055.645) (-1067.203) [-1059.278] (-1055.168) * (-1069.242) (-1049.733) (-1057.102) [-1051.895] -- 0:02:22
      568500 -- (-1057.104) (-1075.606) [-1053.354] (-1065.152) * (-1068.748) (-1067.714) (-1060.288) [-1056.813] -- 0:02:22
      569000 -- [-1058.743] (-1069.513) (-1065.366) (-1060.781) * (-1058.066) (-1065.206) (-1060.420) [-1058.165] -- 0:02:22
      569500 -- (-1061.829) (-1051.220) [-1055.220] (-1064.095) * (-1065.111) (-1059.021) [-1052.625] (-1077.268) -- 0:02:22
      570000 -- (-1056.173) [-1052.113] (-1069.059) (-1054.512) * (-1060.446) (-1061.871) [-1056.210] (-1065.491) -- 0:02:21

      Average standard deviation of split frequencies: 0.009786

      570500 -- (-1061.887) (-1071.085) [-1057.148] (-1069.815) * (-1062.884) (-1068.868) [-1056.597] (-1061.703) -- 0:02:21
      571000 -- [-1061.156] (-1062.654) (-1055.441) (-1078.391) * (-1068.119) (-1053.636) [-1054.014] (-1061.124) -- 0:02:21
      571500 -- (-1062.236) (-1069.373) [-1061.633] (-1064.108) * (-1073.247) (-1058.367) [-1054.539] (-1060.275) -- 0:02:21
      572000 -- (-1066.064) [-1064.922] (-1058.950) (-1060.660) * (-1056.891) (-1059.186) (-1056.086) [-1065.046] -- 0:02:21
      572500 -- (-1070.944) (-1065.695) [-1052.032] (-1058.124) * [-1058.288] (-1057.601) (-1057.851) (-1069.836) -- 0:02:21
      573000 -- (-1072.404) (-1078.705) (-1065.454) [-1055.850] * (-1065.200) [-1055.998] (-1062.608) (-1070.185) -- 0:02:20
      573500 -- (-1063.983) (-1071.252) (-1064.393) [-1049.040] * [-1066.984] (-1061.968) (-1060.661) (-1057.911) -- 0:02:20
      574000 -- (-1068.085) (-1066.201) [-1053.889] (-1062.898) * (-1055.117) [-1053.105] (-1049.828) (-1075.435) -- 0:02:20
      574500 -- (-1064.558) (-1064.160) [-1061.315] (-1064.345) * (-1059.057) [-1064.264] (-1055.427) (-1074.248) -- 0:02:20
      575000 -- (-1072.162) [-1049.607] (-1061.762) (-1072.828) * (-1063.767) [-1057.637] (-1052.509) (-1063.799) -- 0:02:20

      Average standard deviation of split frequencies: 0.009821

      575500 -- (-1067.269) (-1059.210) [-1060.795] (-1066.360) * (-1051.952) (-1068.331) (-1051.371) [-1055.768] -- 0:02:20
      576000 -- [-1059.315] (-1070.892) (-1065.099) (-1069.060) * [-1056.627] (-1066.063) (-1070.233) (-1060.824) -- 0:02:19
      576500 -- (-1071.235) (-1060.804) (-1065.026) [-1064.213] * (-1060.177) (-1065.308) [-1058.650] (-1081.514) -- 0:02:19
      577000 -- (-1067.997) [-1052.802] (-1067.098) (-1062.755) * (-1067.472) (-1059.331) (-1056.922) [-1062.135] -- 0:02:19
      577500 -- (-1054.782) (-1062.532) (-1072.070) [-1049.170] * (-1057.889) [-1068.457] (-1055.533) (-1069.888) -- 0:02:19
      578000 -- (-1071.575) (-1063.836) (-1062.566) [-1056.383] * [-1052.737] (-1055.951) (-1063.512) (-1068.017) -- 0:02:19
      578500 -- (-1067.402) (-1064.207) (-1054.974) [-1054.481] * (-1081.684) [-1069.219] (-1057.322) (-1056.631) -- 0:02:19
      579000 -- (-1056.343) (-1068.195) (-1069.892) [-1054.971] * (-1055.001) [-1071.547] (-1056.291) (-1066.275) -- 0:02:18
      579500 -- (-1048.943) (-1062.513) (-1070.930) [-1059.170] * (-1064.859) (-1059.301) [-1058.406] (-1062.811) -- 0:02:18
      580000 -- [-1061.028] (-1058.935) (-1062.553) (-1060.032) * [-1065.692] (-1054.298) (-1061.103) (-1081.628) -- 0:02:18

      Average standard deviation of split frequencies: 0.009929

      580500 -- (-1055.861) (-1059.797) (-1064.859) [-1057.163] * (-1070.696) [-1050.477] (-1057.996) (-1051.770) -- 0:02:18
      581000 -- (-1059.001) (-1063.612) (-1061.655) [-1057.376] * (-1075.216) (-1058.161) [-1054.765] (-1062.777) -- 0:02:18
      581500 -- (-1067.506) [-1059.457] (-1072.561) (-1052.439) * (-1063.835) [-1059.045] (-1066.341) (-1066.351) -- 0:02:18
      582000 -- (-1062.306) [-1058.722] (-1066.955) (-1057.408) * (-1069.311) (-1073.557) [-1052.355] (-1063.525) -- 0:02:17
      582500 -- [-1057.660] (-1061.932) (-1068.412) (-1058.969) * (-1060.759) (-1060.390) [-1060.207] (-1067.104) -- 0:02:17
      583000 -- (-1056.530) [-1062.348] (-1071.408) (-1075.096) * (-1060.661) [-1064.163] (-1067.874) (-1065.168) -- 0:02:17
      583500 -- [-1058.566] (-1055.589) (-1077.007) (-1064.668) * (-1050.729) [-1055.082] (-1064.023) (-1074.940) -- 0:02:17
      584000 -- (-1072.823) [-1058.216] (-1062.610) (-1055.696) * (-1067.114) (-1073.011) [-1065.547] (-1070.315) -- 0:02:17
      584500 -- (-1069.125) (-1069.110) (-1065.445) [-1054.862] * [-1062.885] (-1064.865) (-1064.383) (-1056.384) -- 0:02:17
      585000 -- (-1059.243) [-1061.005] (-1055.108) (-1062.612) * [-1060.579] (-1075.314) (-1079.452) (-1061.629) -- 0:02:16

      Average standard deviation of split frequencies: 0.009777

      585500 -- [-1054.572] (-1067.820) (-1061.894) (-1061.005) * (-1070.321) [-1060.818] (-1058.494) (-1059.296) -- 0:02:16
      586000 -- (-1054.285) (-1059.368) (-1063.587) [-1066.199] * (-1064.831) (-1059.544) (-1060.341) [-1054.034] -- 0:02:16
      586500 -- (-1055.306) [-1056.215] (-1060.454) (-1071.411) * [-1054.086] (-1059.947) (-1062.361) (-1059.594) -- 0:02:16
      587000 -- [-1054.638] (-1070.642) (-1054.564) (-1062.912) * (-1052.651) (-1051.395) (-1072.750) [-1052.703] -- 0:02:16
      587500 -- (-1061.131) [-1066.648] (-1061.585) (-1076.856) * (-1074.086) [-1057.392] (-1063.132) (-1064.961) -- 0:02:16
      588000 -- (-1070.354) [-1063.521] (-1053.194) (-1074.428) * [-1052.072] (-1050.852) (-1062.542) (-1065.285) -- 0:02:15
      588500 -- [-1060.408] (-1056.608) (-1067.175) (-1067.517) * (-1063.154) (-1064.240) (-1070.060) [-1054.833] -- 0:02:15
      589000 -- (-1073.662) [-1063.440] (-1070.033) (-1071.294) * (-1063.322) (-1072.863) (-1061.665) [-1054.632] -- 0:02:15
      589500 -- (-1074.392) (-1061.974) (-1069.540) [-1061.343] * (-1071.526) (-1066.266) (-1061.847) [-1057.543] -- 0:02:15
      590000 -- (-1062.777) (-1057.986) [-1053.084] (-1067.688) * (-1072.124) [-1063.942] (-1066.536) (-1057.570) -- 0:02:15

      Average standard deviation of split frequencies: 0.009823

      590500 -- (-1071.351) [-1061.479] (-1073.245) (-1066.880) * (-1079.063) (-1076.095) [-1072.009] (-1079.782) -- 0:02:15
      591000 -- (-1066.865) (-1074.192) (-1064.811) [-1048.847] * (-1061.731) (-1064.441) (-1074.113) [-1062.639] -- 0:02:14
      591500 -- (-1072.643) (-1066.429) [-1058.827] (-1062.062) * (-1067.598) [-1070.543] (-1061.655) (-1069.782) -- 0:02:14
      592000 -- (-1084.970) (-1054.531) (-1062.784) [-1054.746] * (-1060.073) (-1062.616) [-1064.976] (-1076.269) -- 0:02:14
      592500 -- (-1060.848) (-1061.716) [-1058.928] (-1062.278) * (-1064.975) [-1054.632] (-1082.322) (-1056.996) -- 0:02:14
      593000 -- (-1072.664) (-1065.256) [-1060.644] (-1054.372) * (-1071.249) (-1054.405) (-1068.551) [-1051.922] -- 0:02:14
      593500 -- (-1077.725) (-1063.132) (-1076.853) [-1052.641] * (-1069.500) (-1062.175) [-1065.457] (-1057.889) -- 0:02:14
      594000 -- (-1067.749) (-1063.826) [-1063.870] (-1054.048) * (-1053.388) (-1079.102) [-1056.068] (-1060.856) -- 0:02:13
      594500 -- (-1057.814) [-1070.245] (-1057.238) (-1053.466) * (-1059.981) (-1083.751) (-1063.913) [-1059.316] -- 0:02:13
      595000 -- [-1054.652] (-1052.744) (-1064.237) (-1062.425) * (-1060.970) (-1058.866) [-1061.485] (-1067.019) -- 0:02:13

      Average standard deviation of split frequencies: 0.010100

      595500 -- (-1059.296) (-1058.343) [-1064.488] (-1064.923) * [-1063.742] (-1061.014) (-1064.215) (-1071.444) -- 0:02:13
      596000 -- (-1063.122) [-1057.177] (-1077.834) (-1062.739) * (-1068.230) (-1065.869) [-1056.329] (-1061.406) -- 0:02:13
      596500 -- [-1065.035] (-1070.046) (-1062.623) (-1078.107) * (-1062.668) [-1064.802] (-1058.168) (-1066.018) -- 0:02:13
      597000 -- (-1054.387) (-1054.644) [-1056.932] (-1077.536) * [-1056.134] (-1077.616) (-1073.299) (-1071.594) -- 0:02:12
      597500 -- (-1062.964) (-1054.637) (-1059.000) [-1067.069] * (-1057.266) (-1074.141) (-1076.510) [-1058.615] -- 0:02:12
      598000 -- (-1061.226) (-1065.064) (-1058.666) [-1068.548] * (-1062.457) (-1060.704) (-1067.719) [-1053.179] -- 0:02:12
      598500 -- (-1058.171) (-1076.822) (-1066.250) [-1057.678] * [-1051.271] (-1066.526) (-1071.500) (-1051.795) -- 0:02:12
      599000 -- (-1055.883) (-1067.437) (-1059.230) [-1059.599] * (-1060.002) [-1060.335] (-1062.736) (-1059.256) -- 0:02:12
      599500 -- (-1070.401) (-1073.479) [-1051.428] (-1069.745) * [-1063.207] (-1069.534) (-1056.451) (-1068.504) -- 0:02:12
      600000 -- (-1068.412) (-1064.345) [-1052.372] (-1062.523) * (-1054.726) (-1072.533) [-1052.850] (-1069.409) -- 0:02:12

      Average standard deviation of split frequencies: 0.010444

      600500 -- (-1060.213) (-1072.109) [-1058.343] (-1075.581) * (-1064.359) (-1070.815) [-1049.548] (-1068.735) -- 0:02:11
      601000 -- (-1060.359) [-1052.677] (-1062.523) (-1059.943) * [-1053.526] (-1073.619) (-1072.516) (-1064.803) -- 0:02:11
      601500 -- (-1060.269) [-1054.375] (-1066.430) (-1050.140) * [-1057.324] (-1065.956) (-1067.718) (-1065.537) -- 0:02:11
      602000 -- (-1060.761) (-1061.425) (-1063.308) [-1054.120] * (-1060.400) (-1069.327) (-1058.895) [-1064.211] -- 0:02:11
      602500 -- (-1078.855) (-1054.561) (-1057.680) [-1051.826] * [-1057.278] (-1059.380) (-1055.196) (-1062.062) -- 0:02:11
      603000 -- (-1069.527) [-1059.812] (-1056.890) (-1065.828) * (-1062.478) [-1072.447] (-1061.286) (-1057.171) -- 0:02:11
      603500 -- (-1063.324) [-1050.099] (-1055.657) (-1066.394) * (-1058.943) [-1064.230] (-1060.689) (-1056.132) -- 0:02:10
      604000 -- (-1073.168) (-1070.379) [-1052.436] (-1054.168) * (-1055.968) (-1070.553) (-1082.529) [-1053.329] -- 0:02:11
      604500 -- [-1065.490] (-1074.975) (-1058.771) (-1058.493) * (-1056.541) (-1075.289) (-1079.488) [-1050.402] -- 0:02:10
      605000 -- [-1057.892] (-1086.196) (-1067.808) (-1060.417) * (-1055.128) (-1075.406) (-1072.897) [-1052.053] -- 0:02:10

      Average standard deviation of split frequencies: 0.010946

      605500 -- (-1055.950) (-1082.651) (-1081.076) [-1056.141] * (-1066.655) (-1064.748) (-1064.054) [-1054.269] -- 0:02:10
      606000 -- [-1061.480] (-1063.787) (-1073.888) (-1063.011) * (-1061.483) (-1072.187) [-1060.362] (-1057.209) -- 0:02:10
      606500 -- (-1075.378) (-1072.736) [-1062.923] (-1047.801) * (-1067.874) (-1056.911) (-1059.897) [-1057.103] -- 0:02:09
      607000 -- (-1061.775) (-1069.862) [-1069.377] (-1068.605) * (-1077.135) (-1062.492) [-1056.774] (-1070.966) -- 0:02:10
      607500 -- (-1069.367) (-1076.172) [-1069.037] (-1063.321) * (-1059.605) (-1061.461) [-1056.901] (-1054.485) -- 0:02:09
      608000 -- [-1058.726] (-1069.756) (-1074.816) (-1056.818) * (-1060.188) [-1054.752] (-1064.934) (-1057.128) -- 0:02:09
      608500 -- [-1055.791] (-1058.047) (-1071.146) (-1053.905) * [-1056.900] (-1062.993) (-1064.788) (-1064.073) -- 0:02:09
      609000 -- [-1063.258] (-1075.474) (-1052.561) (-1056.176) * (-1059.290) (-1054.955) [-1059.167] (-1068.668) -- 0:02:09
      609500 -- (-1071.241) (-1069.394) (-1062.428) [-1047.492] * (-1056.149) (-1064.563) [-1056.123] (-1079.748) -- 0:02:08
      610000 -- [-1058.711] (-1066.097) (-1078.124) (-1062.551) * [-1064.565] (-1069.906) (-1055.833) (-1070.229) -- 0:02:08

      Average standard deviation of split frequencies: 0.010035

      610500 -- (-1057.272) (-1055.867) [-1071.099] (-1064.783) * (-1071.059) (-1056.507) [-1049.856] (-1064.402) -- 0:02:08
      611000 -- [-1056.774] (-1061.123) (-1070.083) (-1060.025) * (-1069.101) (-1072.404) [-1065.432] (-1081.350) -- 0:02:08
      611500 -- (-1068.682) (-1058.831) (-1064.321) [-1066.672] * [-1058.396] (-1057.472) (-1080.401) (-1063.962) -- 0:02:08
      612000 -- [-1058.371] (-1058.652) (-1078.731) (-1052.893) * (-1062.633) (-1060.594) (-1076.211) [-1055.830] -- 0:02:08
      612500 -- (-1058.044) (-1062.895) (-1057.364) [-1049.845] * (-1067.634) [-1056.785] (-1059.123) (-1067.385) -- 0:02:07
      613000 -- (-1065.680) (-1072.651) (-1058.776) [-1057.520] * (-1090.677) [-1055.913] (-1059.133) (-1074.794) -- 0:02:08
      613500 -- (-1066.880) (-1070.177) (-1070.885) [-1062.285] * [-1067.372] (-1053.028) (-1076.651) (-1070.271) -- 0:02:07
      614000 -- (-1060.469) (-1055.501) [-1057.372] (-1069.173) * (-1076.478) (-1053.284) (-1063.100) [-1056.848] -- 0:02:07
      614500 -- (-1057.749) [-1068.229] (-1055.192) (-1073.647) * (-1073.730) (-1065.514) (-1068.364) [-1060.721] -- 0:02:07
      615000 -- (-1067.735) [-1060.493] (-1060.224) (-1070.385) * (-1067.882) (-1069.361) (-1057.221) [-1069.822] -- 0:02:07

      Average standard deviation of split frequencies: 0.009242

      615500 -- (-1067.623) [-1060.407] (-1064.590) (-1057.302) * (-1055.661) [-1060.937] (-1058.594) (-1058.908) -- 0:02:06
      616000 -- (-1070.061) [-1055.892] (-1056.643) (-1053.456) * (-1071.103) (-1065.369) (-1069.054) [-1064.615] -- 0:02:07
      616500 -- (-1074.576) [-1059.803] (-1062.654) (-1071.184) * [-1056.025] (-1058.322) (-1072.086) (-1058.793) -- 0:02:06
      617000 -- [-1060.387] (-1065.797) (-1061.347) (-1063.232) * (-1056.977) [-1057.406] (-1077.441) (-1063.898) -- 0:02:06
      617500 -- [-1058.750] (-1053.730) (-1056.152) (-1066.165) * (-1050.501) (-1055.068) (-1066.325) [-1057.106] -- 0:02:06
      618000 -- (-1066.353) [-1054.996] (-1059.115) (-1076.024) * (-1061.072) (-1061.213) (-1065.040) [-1061.606] -- 0:02:06
      618500 -- (-1063.717) (-1072.992) (-1068.491) [-1056.342] * [-1053.496] (-1070.751) (-1057.024) (-1066.522) -- 0:02:05
      619000 -- (-1063.208) (-1071.114) (-1066.104) [-1065.932] * (-1060.871) [-1056.886] (-1064.665) (-1054.336) -- 0:02:06
      619500 -- [-1072.741] (-1083.472) (-1061.743) (-1065.135) * (-1074.753) [-1057.638] (-1055.930) (-1053.582) -- 0:02:05
      620000 -- (-1064.570) (-1066.143) (-1062.826) [-1059.248] * (-1064.476) [-1056.228] (-1072.982) (-1054.127) -- 0:02:05

      Average standard deviation of split frequencies: 0.009231

      620500 -- (-1066.299) [-1052.848] (-1072.634) (-1060.534) * [-1062.653] (-1062.273) (-1059.955) (-1065.136) -- 0:02:05
      621000 -- (-1062.433) [-1057.473] (-1067.503) (-1055.341) * (-1066.651) (-1063.637) (-1060.781) [-1050.796] -- 0:02:05
      621500 -- (-1068.458) (-1065.845) (-1067.404) [-1051.492] * [-1051.994] (-1062.196) (-1074.069) (-1072.705) -- 0:02:04
      622000 -- (-1075.597) (-1059.263) (-1065.155) [-1055.763] * (-1069.181) (-1058.548) (-1069.902) [-1046.055] -- 0:02:05
      622500 -- [-1055.832] (-1056.448) (-1067.936) (-1074.606) * (-1057.149) [-1056.331] (-1062.118) (-1056.104) -- 0:02:04
      623000 -- [-1058.141] (-1072.870) (-1060.423) (-1072.484) * (-1062.129) [-1051.547] (-1055.969) (-1065.715) -- 0:02:04
      623500 -- (-1073.694) (-1055.874) [-1056.981] (-1060.170) * (-1072.782) [-1057.694] (-1061.176) (-1071.555) -- 0:02:04
      624000 -- (-1064.130) [-1059.951] (-1061.779) (-1061.637) * (-1058.587) [-1053.535] (-1053.534) (-1068.923) -- 0:02:04
      624500 -- (-1057.784) (-1067.943) [-1048.705] (-1060.642) * (-1060.779) [-1059.494] (-1054.259) (-1060.294) -- 0:02:03
      625000 -- (-1070.578) (-1062.626) (-1063.737) [-1056.876] * (-1055.734) (-1065.680) (-1067.902) [-1052.480] -- 0:02:04

      Average standard deviation of split frequencies: 0.009790

      625500 -- [-1058.282] (-1068.972) (-1052.649) (-1060.334) * (-1055.407) (-1063.622) (-1059.129) [-1060.682] -- 0:02:03
      626000 -- (-1067.138) [-1045.925] (-1077.106) (-1070.982) * (-1061.145) (-1048.789) [-1069.272] (-1068.152) -- 0:02:03
      626500 -- [-1058.870] (-1066.768) (-1075.708) (-1065.377) * (-1050.257) (-1066.397) [-1058.044] (-1064.133) -- 0:02:03
      627000 -- (-1081.590) (-1059.971) (-1058.757) [-1060.226] * (-1079.040) (-1074.580) (-1063.074) [-1062.871] -- 0:02:03
      627500 -- (-1064.627) (-1057.534) [-1063.647] (-1058.733) * [-1065.299] (-1065.965) (-1057.379) (-1075.867) -- 0:02:02
      628000 -- [-1065.299] (-1069.439) (-1078.602) (-1053.723) * (-1062.679) (-1065.011) [-1055.130] (-1062.961) -- 0:02:03
      628500 -- (-1055.217) (-1063.802) (-1059.389) [-1053.429] * [-1061.892] (-1068.640) (-1066.271) (-1062.139) -- 0:02:02
      629000 -- (-1067.997) (-1055.411) (-1057.173) [-1061.182] * (-1056.925) (-1064.786) (-1061.776) [-1058.567] -- 0:02:02
      629500 -- (-1081.791) [-1052.373] (-1063.602) (-1059.223) * (-1072.044) (-1056.837) (-1069.339) [-1055.618] -- 0:02:02
      630000 -- (-1058.474) [-1061.120] (-1067.161) (-1076.581) * (-1064.451) (-1070.740) (-1067.364) [-1058.250] -- 0:02:02

      Average standard deviation of split frequencies: 0.010062

      630500 -- (-1056.079) [-1057.042] (-1065.958) (-1064.449) * (-1063.251) (-1062.953) [-1061.918] (-1054.324) -- 0:02:01
      631000 -- (-1062.675) [-1057.329] (-1053.212) (-1057.740) * [-1054.340] (-1069.220) (-1071.580) (-1058.064) -- 0:02:02
      631500 -- (-1072.033) [-1066.344] (-1066.279) (-1056.825) * (-1061.295) [-1049.759] (-1060.326) (-1062.290) -- 0:02:01
      632000 -- [-1069.857] (-1062.040) (-1055.923) (-1061.226) * (-1066.567) (-1068.290) (-1063.914) [-1054.667] -- 0:02:01
      632500 -- (-1066.513) (-1062.153) (-1058.373) [-1051.776] * (-1064.022) (-1063.458) (-1073.472) [-1056.754] -- 0:02:01
      633000 -- (-1070.022) (-1066.817) (-1056.379) [-1057.559] * (-1051.512) (-1059.356) (-1058.141) [-1044.073] -- 0:02:01
      633500 -- (-1065.795) (-1068.343) [-1059.192] (-1058.935) * [-1057.148] (-1061.012) (-1075.863) (-1062.988) -- 0:02:00
      634000 -- (-1059.467) (-1067.878) (-1066.383) [-1058.473] * (-1061.415) (-1067.433) [-1057.578] (-1080.106) -- 0:02:01
      634500 -- (-1060.148) [-1057.755] (-1067.296) (-1059.961) * (-1065.404) [-1058.861] (-1057.606) (-1074.673) -- 0:02:00
      635000 -- (-1064.621) (-1057.344) [-1057.202] (-1065.560) * (-1072.914) [-1057.254] (-1056.649) (-1055.163) -- 0:02:00

      Average standard deviation of split frequencies: 0.010434

      635500 -- (-1072.414) (-1053.242) (-1057.351) [-1061.407] * (-1074.725) [-1061.095] (-1055.713) (-1056.960) -- 0:02:00
      636000 -- (-1052.780) (-1058.576) [-1062.051] (-1070.084) * [-1066.678] (-1062.969) (-1062.070) (-1073.215) -- 0:02:00
      636500 -- (-1076.344) (-1053.967) [-1049.837] (-1063.886) * (-1062.327) (-1068.679) (-1059.384) [-1055.862] -- 0:01:59
      637000 -- (-1062.553) [-1062.729] (-1056.221) (-1062.798) * (-1059.498) (-1059.833) (-1069.520) [-1060.637] -- 0:02:00
      637500 -- (-1075.560) [-1055.031] (-1063.512) (-1066.457) * (-1084.459) (-1074.495) [-1059.080] (-1069.204) -- 0:01:59
      638000 -- [-1055.405] (-1070.046) (-1049.699) (-1054.373) * (-1061.331) (-1058.296) (-1071.969) [-1059.613] -- 0:01:59
      638500 -- [-1054.051] (-1060.372) (-1053.115) (-1060.870) * (-1061.983) (-1079.698) (-1063.175) [-1054.277] -- 0:01:59
      639000 -- (-1069.414) (-1080.945) [-1055.220] (-1059.515) * (-1059.394) (-1048.350) (-1055.958) [-1051.471] -- 0:01:59
      639500 -- [-1075.875] (-1097.194) (-1062.525) (-1058.709) * (-1063.543) (-1053.270) [-1051.367] (-1057.493) -- 0:01:58
      640000 -- (-1055.192) (-1058.739) (-1063.536) [-1055.622] * (-1074.163) (-1068.618) [-1060.956] (-1061.452) -- 0:01:59

      Average standard deviation of split frequencies: 0.010697

      640500 -- (-1062.831) (-1064.441) (-1064.394) [-1053.653] * (-1050.062) (-1069.383) (-1058.265) [-1053.264] -- 0:01:58
      641000 -- (-1056.920) (-1070.658) [-1055.119] (-1060.233) * (-1063.199) (-1055.227) (-1061.603) [-1064.929] -- 0:01:58
      641500 -- (-1064.765) (-1071.192) (-1061.651) [-1069.374] * (-1073.429) (-1067.337) [-1047.876] (-1068.806) -- 0:01:58
      642000 -- (-1067.105) (-1060.626) [-1074.645] (-1058.900) * [-1061.049] (-1087.029) (-1058.316) (-1075.022) -- 0:01:58
      642500 -- (-1068.103) (-1060.241) (-1071.897) [-1070.995] * (-1068.754) (-1081.017) (-1049.488) [-1056.591] -- 0:01:57
      643000 -- (-1063.378) (-1058.138) (-1060.419) [-1074.036] * (-1056.105) (-1062.879) (-1067.410) [-1064.898] -- 0:01:58
      643500 -- (-1063.234) (-1060.712) [-1054.203] (-1065.577) * [-1055.231] (-1060.912) (-1073.335) (-1060.193) -- 0:01:58
      644000 -- (-1070.652) (-1055.702) [-1053.074] (-1066.925) * (-1068.088) (-1070.941) (-1061.135) [-1055.934] -- 0:01:57
      644500 -- (-1060.855) (-1059.312) (-1062.744) [-1065.751] * (-1065.532) (-1059.149) [-1053.683] (-1062.536) -- 0:01:57
      645000 -- (-1065.871) (-1077.034) [-1054.658] (-1056.062) * [-1053.176] (-1082.568) (-1059.867) (-1051.761) -- 0:01:57

      Average standard deviation of split frequencies: 0.010048

      645500 -- (-1061.955) (-1074.629) (-1059.785) [-1056.615] * [-1057.374] (-1080.717) (-1067.129) (-1063.967) -- 0:01:56
      646000 -- (-1056.007) (-1067.365) (-1055.385) [-1044.922] * (-1067.240) (-1068.276) [-1057.163] (-1074.564) -- 0:01:57
      646500 -- (-1060.958) (-1052.367) (-1062.409) [-1063.344] * (-1069.869) (-1068.005) [-1055.299] (-1066.200) -- 0:01:57
      647000 -- (-1056.830) (-1054.820) (-1071.433) [-1060.115] * (-1057.539) [-1062.383] (-1075.229) (-1064.621) -- 0:01:56
      647500 -- [-1053.998] (-1068.487) (-1064.773) (-1061.177) * (-1077.202) (-1078.584) [-1066.118] (-1065.847) -- 0:01:56
      648000 -- (-1085.181) (-1062.260) [-1054.006] (-1062.504) * [-1052.555] (-1070.001) (-1062.391) (-1064.288) -- 0:01:56
      648500 -- (-1071.300) (-1062.482) [-1057.014] (-1069.566) * [-1052.953] (-1061.997) (-1069.505) (-1060.494) -- 0:01:55
      649000 -- (-1073.056) (-1064.674) [-1060.500] (-1063.224) * (-1072.910) (-1059.899) [-1062.316] (-1055.365) -- 0:01:56
      649500 -- [-1053.509] (-1072.110) (-1055.014) (-1057.403) * (-1059.012) (-1065.276) [-1060.038] (-1065.442) -- 0:01:56
      650000 -- (-1066.589) [-1057.152] (-1051.289) (-1080.218) * [-1065.182] (-1059.900) (-1068.605) (-1063.745) -- 0:01:55

      Average standard deviation of split frequencies: 0.009641

      650500 -- (-1063.687) [-1060.493] (-1071.592) (-1068.781) * (-1066.012) [-1058.116] (-1066.019) (-1059.826) -- 0:01:55
      651000 -- (-1072.542) [-1057.972] (-1056.333) (-1062.893) * (-1062.527) (-1061.054) (-1053.899) [-1061.315] -- 0:01:55
      651500 -- (-1082.895) [-1056.319] (-1056.452) (-1068.312) * (-1065.181) [-1055.068] (-1074.035) (-1069.481) -- 0:01:55
      652000 -- (-1079.542) (-1058.141) (-1067.972) [-1056.386] * (-1061.957) [-1061.562] (-1069.375) (-1068.973) -- 0:01:55
      652500 -- (-1071.162) (-1057.465) (-1079.304) [-1063.066] * [-1063.728] (-1068.589) (-1062.195) (-1061.721) -- 0:01:55
      653000 -- (-1074.202) [-1053.738] (-1059.413) (-1066.814) * (-1060.320) (-1066.396) (-1054.651) [-1054.766] -- 0:01:54
      653500 -- (-1066.598) [-1052.461] (-1057.523) (-1070.545) * [-1052.624] (-1085.219) (-1063.479) (-1065.135) -- 0:01:54
      654000 -- (-1073.350) (-1059.362) (-1072.350) [-1057.449] * (-1056.816) (-1083.949) [-1054.733] (-1051.244) -- 0:01:54
      654500 -- (-1074.032) [-1052.145] (-1058.048) (-1066.265) * (-1065.537) (-1081.727) [-1057.298] (-1063.411) -- 0:01:54
      655000 -- (-1075.664) (-1060.612) (-1059.097) [-1062.388] * [-1060.301] (-1072.099) (-1059.397) (-1064.113) -- 0:01:54

      Average standard deviation of split frequencies: 0.009508

      655500 -- (-1072.014) (-1063.594) (-1073.738) [-1057.471] * (-1059.756) (-1061.579) [-1058.015] (-1064.707) -- 0:01:54
      656000 -- (-1086.194) (-1069.565) [-1055.255] (-1056.358) * (-1068.147) (-1057.634) [-1054.407] (-1064.148) -- 0:01:53
      656500 -- (-1073.373) (-1059.093) (-1067.458) [-1047.145] * (-1067.598) [-1058.811] (-1058.101) (-1066.609) -- 0:01:53
      657000 -- (-1078.487) (-1061.339) (-1064.854) [-1051.810] * (-1074.487) (-1061.165) (-1053.887) [-1065.218] -- 0:01:53
      657500 -- [-1057.041] (-1066.609) (-1067.339) (-1065.371) * (-1075.144) (-1072.504) (-1063.291) [-1063.384] -- 0:01:53
      658000 -- (-1055.273) [-1052.665] (-1070.432) (-1063.131) * [-1056.504] (-1073.232) (-1049.507) (-1074.217) -- 0:01:53
      658500 -- (-1058.266) [-1054.476] (-1060.932) (-1064.223) * (-1062.790) (-1066.313) (-1062.626) [-1060.042] -- 0:01:53
      659000 -- [-1061.206] (-1064.773) (-1077.977) (-1060.379) * (-1063.918) [-1055.139] (-1069.103) (-1060.705) -- 0:01:52
      659500 -- [-1051.952] (-1058.022) (-1075.273) (-1063.982) * [-1065.777] (-1058.924) (-1067.888) (-1055.053) -- 0:01:52
      660000 -- (-1068.005) (-1066.117) (-1058.905) [-1062.731] * (-1054.382) (-1075.726) (-1064.027) [-1053.389] -- 0:01:52

      Average standard deviation of split frequencies: 0.009386

      660500 -- (-1060.705) (-1052.113) [-1053.099] (-1059.269) * [-1059.918] (-1072.885) (-1064.220) (-1066.554) -- 0:01:52
      661000 -- [-1058.153] (-1072.882) (-1056.524) (-1063.881) * [-1053.116] (-1066.972) (-1060.395) (-1067.628) -- 0:01:52
      661500 -- [-1058.708] (-1070.920) (-1068.897) (-1062.207) * (-1059.364) (-1071.818) (-1060.654) [-1057.232] -- 0:01:52
      662000 -- (-1051.662) [-1051.228] (-1052.305) (-1064.623) * (-1057.475) (-1080.453) [-1055.504] (-1059.552) -- 0:01:51
      662500 -- (-1050.034) (-1070.067) (-1073.224) [-1059.875] * (-1078.041) [-1063.041] (-1057.629) (-1066.484) -- 0:01:51
      663000 -- [-1058.373] (-1058.970) (-1069.243) (-1062.634) * (-1061.681) (-1069.809) [-1064.470] (-1056.023) -- 0:01:51
      663500 -- (-1070.375) (-1065.984) (-1071.073) [-1054.756] * [-1052.873] (-1058.548) (-1062.989) (-1065.116) -- 0:01:51
      664000 -- (-1068.352) (-1052.211) (-1073.607) [-1054.956] * [-1055.462] (-1076.916) (-1062.306) (-1057.772) -- 0:01:51
      664500 -- (-1063.013) (-1062.914) (-1059.964) [-1056.788] * [-1065.240] (-1063.031) (-1063.687) (-1070.030) -- 0:01:51
      665000 -- [-1056.908] (-1056.107) (-1063.848) (-1064.289) * [-1059.656] (-1065.522) (-1068.540) (-1064.075) -- 0:01:50

      Average standard deviation of split frequencies: 0.008929

      665500 -- (-1054.615) (-1058.945) (-1064.253) [-1063.143] * (-1057.924) [-1060.695] (-1079.050) (-1063.962) -- 0:01:50
      666000 -- [-1055.901] (-1080.886) (-1062.361) (-1061.702) * [-1066.054] (-1068.889) (-1072.585) (-1057.435) -- 0:01:50
      666500 -- (-1054.107) (-1064.131) [-1069.091] (-1059.217) * (-1066.199) [-1051.891] (-1061.676) (-1054.546) -- 0:01:50
      667000 -- (-1077.018) (-1068.542) (-1063.392) [-1060.049] * (-1060.765) (-1068.869) [-1057.812] (-1056.870) -- 0:01:50
      667500 -- [-1058.139] (-1067.417) (-1080.691) (-1062.571) * [-1057.971] (-1067.700) (-1057.775) (-1058.109) -- 0:01:50
      668000 -- [-1057.264] (-1055.639) (-1052.463) (-1066.250) * (-1062.586) (-1065.482) (-1067.213) [-1054.040] -- 0:01:49
      668500 -- (-1076.599) (-1075.342) [-1051.343] (-1059.579) * (-1068.360) (-1066.748) (-1061.140) [-1055.046] -- 0:01:49
      669000 -- (-1056.139) (-1077.960) [-1052.735] (-1066.494) * (-1071.597) (-1060.960) [-1064.779] (-1069.261) -- 0:01:49
      669500 -- (-1050.948) (-1085.414) (-1059.146) [-1060.049] * (-1070.084) (-1059.852) [-1058.299] (-1063.614) -- 0:01:49
      670000 -- [-1063.134] (-1073.640) (-1064.464) (-1066.139) * [-1063.234] (-1069.699) (-1062.090) (-1070.261) -- 0:01:49

      Average standard deviation of split frequencies: 0.008327

      670500 -- (-1073.905) [-1055.102] (-1061.388) (-1053.170) * [-1060.736] (-1063.977) (-1063.717) (-1059.721) -- 0:01:49
      671000 -- (-1062.628) (-1067.886) [-1059.295] (-1067.801) * [-1061.494] (-1072.200) (-1060.969) (-1062.418) -- 0:01:48
      671500 -- [-1053.250] (-1065.337) (-1077.369) (-1055.441) * (-1059.713) (-1062.491) [-1078.416] (-1068.620) -- 0:01:48
      672000 -- (-1074.186) (-1057.423) (-1057.170) [-1064.914] * (-1073.033) (-1079.133) [-1056.643] (-1074.355) -- 0:01:48
      672500 -- (-1065.520) (-1058.390) (-1064.204) [-1061.752] * (-1058.005) (-1056.536) [-1051.264] (-1064.607) -- 0:01:48
      673000 -- (-1064.695) [-1061.062] (-1055.527) (-1059.322) * [-1052.789] (-1068.131) (-1062.789) (-1062.295) -- 0:01:48
      673500 -- (-1069.545) (-1056.665) (-1052.218) [-1061.924] * (-1060.242) [-1065.802] (-1055.107) (-1067.578) -- 0:01:48
      674000 -- (-1068.257) (-1072.520) [-1057.996] (-1056.993) * [-1055.855] (-1065.753) (-1065.043) (-1062.764) -- 0:01:47
      674500 -- [-1055.241] (-1069.824) (-1053.614) (-1067.672) * [-1059.444] (-1064.399) (-1077.005) (-1062.191) -- 0:01:47
      675000 -- (-1056.483) [-1062.313] (-1071.295) (-1058.463) * [-1058.865] (-1058.313) (-1061.638) (-1064.068) -- 0:01:47

      Average standard deviation of split frequencies: 0.008046

      675500 -- (-1058.547) (-1076.375) (-1055.514) [-1052.866] * (-1057.815) (-1062.935) [-1046.673] (-1051.927) -- 0:01:47
      676000 -- (-1073.210) (-1061.612) (-1075.508) [-1054.951] * (-1061.261) (-1063.598) (-1055.234) [-1064.958] -- 0:01:47
      676500 -- [-1058.479] (-1062.638) (-1083.239) (-1054.973) * [-1062.641] (-1058.538) (-1056.457) (-1063.835) -- 0:01:47
      677000 -- (-1083.023) [-1057.943] (-1063.126) (-1067.618) * (-1055.230) (-1061.764) (-1062.480) [-1061.170] -- 0:01:46
      677500 -- (-1074.198) (-1061.014) (-1054.135) [-1058.294] * (-1062.544) [-1051.698] (-1064.996) (-1063.466) -- 0:01:46
      678000 -- (-1065.442) (-1049.357) (-1060.110) [-1053.121] * (-1080.735) [-1064.946] (-1060.716) (-1057.719) -- 0:01:46
      678500 -- [-1060.989] (-1054.675) (-1072.112) (-1058.200) * [-1053.049] (-1057.401) (-1067.218) (-1059.152) -- 0:01:46
      679000 -- (-1056.830) (-1065.171) [-1063.315] (-1062.509) * (-1056.135) [-1063.215] (-1066.394) (-1066.030) -- 0:01:46
      679500 -- (-1068.983) (-1062.834) [-1060.196] (-1062.308) * (-1070.554) (-1056.935) [-1054.890] (-1071.707) -- 0:01:46
      680000 -- (-1066.205) (-1061.368) [-1057.967] (-1056.257) * [-1067.820] (-1057.928) (-1070.641) (-1066.884) -- 0:01:45

      Average standard deviation of split frequencies: 0.008204

      680500 -- [-1066.703] (-1064.188) (-1058.766) (-1063.938) * [-1062.555] (-1060.181) (-1070.759) (-1064.946) -- 0:01:45
      681000 -- [-1058.603] (-1062.596) (-1066.653) (-1051.149) * [-1048.147] (-1061.080) (-1066.651) (-1055.821) -- 0:01:45
      681500 -- (-1061.855) (-1076.471) (-1083.254) [-1056.134] * (-1056.228) (-1066.975) [-1063.700] (-1070.040) -- 0:01:45
      682000 -- [-1067.823] (-1071.025) (-1087.743) (-1057.089) * [-1055.759] (-1058.441) (-1062.642) (-1053.919) -- 0:01:45
      682500 -- [-1057.490] (-1059.465) (-1079.023) (-1070.106) * (-1063.510) [-1059.474] (-1066.896) (-1064.952) -- 0:01:45
      683000 -- (-1073.588) (-1062.059) [-1063.342] (-1062.341) * [-1053.796] (-1066.026) (-1073.624) (-1078.014) -- 0:01:44
      683500 -- (-1067.171) (-1053.139) (-1062.565) [-1060.956] * [-1051.867] (-1058.166) (-1063.201) (-1064.427) -- 0:01:45
      684000 -- [-1052.280] (-1063.089) (-1067.436) (-1063.993) * (-1061.254) (-1063.615) [-1063.571] (-1069.959) -- 0:01:44
      684500 -- (-1062.942) (-1067.674) (-1052.894) [-1053.610] * (-1052.540) (-1058.250) [-1060.651] (-1062.894) -- 0:01:44
      685000 -- [-1060.371] (-1060.547) (-1059.705) (-1061.995) * [-1058.186] (-1066.020) (-1059.760) (-1067.515) -- 0:01:44

      Average standard deviation of split frequencies: 0.007718

      685500 -- [-1059.579] (-1050.692) (-1070.778) (-1064.597) * (-1060.655) [-1053.904] (-1065.217) (-1057.519) -- 0:01:44
      686000 -- (-1068.373) (-1067.647) [-1053.360] (-1057.281) * (-1064.676) (-1068.765) [-1060.575] (-1053.455) -- 0:01:43
      686500 -- [-1055.089] (-1063.731) (-1062.468) (-1063.372) * (-1063.772) (-1058.366) [-1057.507] (-1058.610) -- 0:01:44
      687000 -- (-1048.374) [-1062.495] (-1063.148) (-1065.322) * (-1066.614) (-1065.254) [-1062.311] (-1071.798) -- 0:01:43
      687500 -- [-1054.771] (-1069.006) (-1068.297) (-1060.178) * (-1067.653) [-1059.842] (-1058.751) (-1074.433) -- 0:01:43
      688000 -- (-1055.295) (-1070.693) [-1074.643] (-1067.782) * [-1051.581] (-1058.995) (-1060.404) (-1066.538) -- 0:01:43
      688500 -- [-1053.854] (-1083.834) (-1061.640) (-1059.573) * [-1059.844] (-1075.171) (-1057.489) (-1061.478) -- 0:01:43
      689000 -- [-1052.847] (-1073.180) (-1055.104) (-1055.830) * (-1063.661) (-1068.184) [-1059.013] (-1073.740) -- 0:01:42
      689500 -- (-1066.527) [-1066.358] (-1062.812) (-1058.440) * (-1060.426) (-1068.875) (-1062.468) [-1069.172] -- 0:01:43
      690000 -- (-1064.209) (-1056.986) [-1052.259] (-1064.427) * [-1059.396] (-1060.316) (-1065.754) (-1064.791) -- 0:01:42

      Average standard deviation of split frequencies: 0.007823

      690500 -- (-1075.024) [-1052.670] (-1061.474) (-1071.582) * [-1064.497] (-1063.253) (-1081.671) (-1063.950) -- 0:01:42
      691000 -- (-1057.987) [-1058.084] (-1063.509) (-1065.709) * [-1060.959] (-1062.745) (-1067.704) (-1065.475) -- 0:01:42
      691500 -- (-1072.469) (-1055.342) [-1057.060] (-1066.837) * [-1050.164] (-1068.997) (-1063.745) (-1067.455) -- 0:01:42
      692000 -- (-1079.021) (-1064.489) [-1056.223] (-1058.827) * (-1063.649) [-1057.160] (-1060.051) (-1056.227) -- 0:01:41
      692500 -- (-1063.844) (-1070.685) [-1049.248] (-1056.970) * (-1065.309) [-1048.505] (-1063.620) (-1071.865) -- 0:01:42
      693000 -- (-1064.027) [-1053.196] (-1061.115) (-1055.543) * (-1074.357) [-1053.727] (-1068.472) (-1062.300) -- 0:01:41
      693500 -- (-1059.654) [-1055.212] (-1062.689) (-1069.087) * (-1063.993) (-1067.646) [-1064.416] (-1067.352) -- 0:01:41
      694000 -- (-1061.777) [-1059.664] (-1062.457) (-1063.299) * (-1064.214) [-1046.997] (-1066.866) (-1065.993) -- 0:01:41
      694500 -- (-1063.521) (-1061.940) [-1061.550] (-1057.920) * (-1071.171) (-1071.144) [-1052.436] (-1056.966) -- 0:01:41
      695000 -- (-1068.203) [-1058.158] (-1060.625) (-1059.607) * (-1063.970) (-1063.069) [-1054.943] (-1061.883) -- 0:01:40

      Average standard deviation of split frequencies: 0.007607

      695500 -- (-1078.263) (-1053.781) (-1054.626) [-1056.440] * (-1080.193) (-1060.008) (-1077.554) [-1061.890] -- 0:01:41
      696000 -- (-1073.620) (-1073.623) [-1059.395] (-1062.861) * (-1080.183) [-1055.883] (-1062.166) (-1050.469) -- 0:01:40
      696500 -- (-1052.644) (-1072.875) [-1052.726] (-1073.073) * (-1058.844) [-1058.466] (-1061.476) (-1063.824) -- 0:01:40
      697000 -- [-1047.923] (-1065.808) (-1058.723) (-1074.446) * (-1052.823) (-1057.882) [-1051.208] (-1062.745) -- 0:01:40
      697500 -- (-1064.524) (-1054.998) [-1056.390] (-1061.072) * (-1061.347) (-1060.587) (-1063.001) [-1057.351] -- 0:01:40
      698000 -- [-1057.140] (-1060.058) (-1058.573) (-1070.268) * (-1067.985) [-1056.721] (-1062.917) (-1068.156) -- 0:01:40
      698500 -- (-1059.980) [-1063.353] (-1060.693) (-1059.434) * [-1057.891] (-1064.243) (-1076.011) (-1065.339) -- 0:01:40
      699000 -- [-1049.104] (-1051.689) (-1055.397) (-1060.583) * (-1052.858) (-1066.634) [-1057.718] (-1063.234) -- 0:01:39
      699500 -- (-1061.755) (-1060.501) [-1053.471] (-1069.354) * (-1058.869) (-1066.296) (-1073.654) [-1061.985] -- 0:01:39
      700000 -- (-1061.685) (-1057.276) (-1069.782) [-1064.631] * [-1054.064] (-1068.258) (-1066.828) (-1071.865) -- 0:01:39

      Average standard deviation of split frequencies: 0.007245

      700500 -- [-1059.422] (-1060.866) (-1069.057) (-1058.443) * (-1057.338) [-1067.009] (-1071.000) (-1069.481) -- 0:01:39
      701000 -- (-1074.623) (-1058.094) [-1054.350] (-1072.661) * [-1055.005] (-1078.487) (-1066.418) (-1083.630) -- 0:01:39
      701500 -- [-1058.116] (-1058.470) (-1076.052) (-1059.074) * (-1063.237) [-1060.169] (-1054.359) (-1058.828) -- 0:01:39
      702000 -- (-1079.458) [-1055.419] (-1064.442) (-1067.331) * [-1062.866] (-1063.050) (-1054.648) (-1060.273) -- 0:01:38
      702500 -- (-1072.642) (-1056.267) [-1064.143] (-1078.617) * [-1062.278] (-1050.721) (-1083.753) (-1061.309) -- 0:01:38
      703000 -- (-1060.346) [-1062.240] (-1066.443) (-1070.830) * [-1053.236] (-1051.899) (-1069.250) (-1065.262) -- 0:01:38
      703500 -- (-1064.281) (-1061.985) (-1064.526) [-1056.132] * (-1058.877) (-1069.339) [-1053.958] (-1057.737) -- 0:01:38
      704000 -- [-1070.302] (-1070.171) (-1056.139) (-1062.596) * (-1061.326) [-1068.365] (-1066.003) (-1078.005) -- 0:01:38
      704500 -- (-1062.481) [-1063.729] (-1076.014) (-1066.393) * (-1066.407) (-1074.308) (-1062.381) [-1056.872] -- 0:01:38
      705000 -- [-1064.198] (-1061.090) (-1067.947) (-1060.422) * (-1060.040) (-1051.587) [-1053.342] (-1068.274) -- 0:01:37

      Average standard deviation of split frequencies: 0.006831

      705500 -- [-1060.780] (-1069.605) (-1058.510) (-1056.912) * (-1069.617) (-1062.112) [-1052.678] (-1064.279) -- 0:01:37
      706000 -- (-1068.948) (-1066.121) [-1057.912] (-1057.711) * (-1056.535) (-1072.026) [-1057.907] (-1060.106) -- 0:01:37
      706500 -- [-1055.623] (-1045.605) (-1067.853) (-1073.996) * (-1074.610) (-1064.707) (-1065.174) [-1048.885] -- 0:01:37
      707000 -- (-1057.006) [-1056.746] (-1058.659) (-1073.384) * (-1072.947) (-1064.007) [-1052.918] (-1060.464) -- 0:01:37
      707500 -- (-1070.637) [-1056.646] (-1066.968) (-1061.313) * (-1062.518) [-1054.647] (-1056.994) (-1064.069) -- 0:01:37
      708000 -- (-1062.750) (-1052.082) [-1054.342] (-1056.617) * (-1059.753) [-1049.403] (-1071.627) (-1071.511) -- 0:01:36
      708500 -- (-1067.514) (-1060.970) [-1056.977] (-1057.865) * (-1068.537) (-1060.977) (-1054.108) [-1058.446] -- 0:01:36
      709000 -- (-1075.830) [-1050.656] (-1064.550) (-1076.561) * [-1055.792] (-1066.363) (-1050.527) (-1057.463) -- 0:01:36
      709500 -- [-1049.492] (-1072.790) (-1065.507) (-1056.146) * (-1066.194) (-1057.973) (-1059.410) [-1063.399] -- 0:01:36
      710000 -- [-1065.370] (-1066.441) (-1062.628) (-1069.161) * (-1064.447) (-1072.713) [-1058.113] (-1066.482) -- 0:01:36

      Average standard deviation of split frequencies: 0.006582

      710500 -- (-1067.347) [-1063.627] (-1049.906) (-1068.460) * (-1064.488) (-1064.485) [-1052.351] (-1055.066) -- 0:01:36
      711000 -- [-1048.913] (-1073.410) (-1056.335) (-1072.866) * [-1062.413] (-1065.928) (-1058.470) (-1075.501) -- 0:01:35
      711500 -- (-1051.915) [-1068.787] (-1060.993) (-1074.068) * (-1061.439) (-1079.161) [-1054.040] (-1059.044) -- 0:01:35
      712000 -- (-1062.449) [-1068.312] (-1056.853) (-1062.416) * (-1071.935) (-1071.807) (-1068.708) [-1057.140] -- 0:01:35
      712500 -- (-1074.481) (-1063.691) [-1051.957] (-1075.685) * (-1058.090) (-1068.898) [-1059.105] (-1056.549) -- 0:01:35
      713000 -- [-1054.975] (-1059.512) (-1055.605) (-1080.119) * (-1055.371) [-1070.704] (-1066.751) (-1062.487) -- 0:01:35
      713500 -- (-1066.394) [-1058.193] (-1055.913) (-1063.413) * (-1060.067) [-1063.827] (-1059.307) (-1059.628) -- 0:01:35
      714000 -- (-1057.543) (-1052.218) (-1062.975) [-1052.677] * (-1069.068) (-1062.644) (-1063.166) [-1055.154] -- 0:01:34
      714500 -- (-1064.244) (-1069.411) [-1057.651] (-1062.929) * (-1066.831) [-1056.532] (-1064.072) (-1058.878) -- 0:01:34
      715000 -- (-1057.711) (-1067.301) [-1062.788] (-1067.573) * [-1061.937] (-1061.172) (-1072.158) (-1056.186) -- 0:01:34

      Average standard deviation of split frequencies: 0.006736

      715500 -- (-1060.142) (-1083.407) (-1068.468) [-1062.858] * (-1076.639) (-1061.836) [-1059.667] (-1074.147) -- 0:01:34
      716000 -- (-1053.442) [-1052.295] (-1060.140) (-1066.367) * (-1061.848) (-1059.039) [-1053.848] (-1064.453) -- 0:01:34
      716500 -- (-1057.381) (-1064.081) (-1058.123) [-1061.048] * (-1063.163) (-1054.383) (-1072.025) [-1058.514] -- 0:01:34
      717000 -- [-1059.982] (-1073.380) (-1055.536) (-1056.602) * (-1050.005) (-1071.364) (-1056.308) [-1059.039] -- 0:01:33
      717500 -- [-1062.667] (-1068.957) (-1057.920) (-1061.855) * (-1064.877) [-1057.969] (-1061.181) (-1056.758) -- 0:01:33
      718000 -- (-1063.662) (-1076.101) [-1057.685] (-1063.789) * [-1061.119] (-1056.524) (-1061.167) (-1060.738) -- 0:01:33
      718500 -- [-1061.764] (-1061.267) (-1055.370) (-1071.251) * [-1061.201] (-1056.423) (-1059.363) (-1053.267) -- 0:01:33
      719000 -- (-1059.598) (-1060.256) [-1056.022] (-1076.063) * (-1058.209) (-1055.651) [-1055.936] (-1062.246) -- 0:01:33
      719500 -- [-1055.738] (-1064.346) (-1054.532) (-1067.941) * (-1061.037) [-1057.118] (-1061.194) (-1056.992) -- 0:01:33
      720000 -- (-1060.159) (-1060.746) (-1060.504) [-1060.334] * (-1063.453) (-1070.158) [-1056.473] (-1061.460) -- 0:01:32

      Average standard deviation of split frequencies: 0.006994

      720500 -- [-1056.999] (-1071.242) (-1062.686) (-1071.122) * (-1060.174) [-1050.790] (-1073.902) (-1053.353) -- 0:01:32
      721000 -- (-1066.018) (-1072.092) [-1057.985] (-1075.287) * (-1056.967) (-1058.098) [-1057.686] (-1061.094) -- 0:01:32
      721500 -- (-1067.645) [-1052.607] (-1057.309) (-1083.538) * (-1063.336) (-1062.988) [-1056.693] (-1063.046) -- 0:01:32
      722000 -- (-1070.319) [-1056.376] (-1068.751) (-1069.384) * (-1063.214) (-1072.806) (-1067.399) [-1065.097] -- 0:01:32
      722500 -- (-1060.511) [-1056.357] (-1063.917) (-1064.059) * (-1069.839) (-1062.977) [-1053.618] (-1053.349) -- 0:01:32
      723000 -- (-1071.532) (-1062.157) (-1059.532) [-1048.768] * (-1067.338) (-1069.970) (-1075.389) [-1055.240] -- 0:01:31
      723500 -- (-1065.781) [-1052.272] (-1059.669) (-1065.018) * (-1057.986) (-1053.278) (-1081.186) [-1049.926] -- 0:01:31
      724000 -- [-1057.776] (-1071.408) (-1069.178) (-1067.476) * [-1058.804] (-1049.224) (-1089.707) (-1072.700) -- 0:01:31
      724500 -- (-1062.383) (-1075.087) [-1050.503] (-1068.698) * [-1051.191] (-1070.026) (-1067.668) (-1075.061) -- 0:01:31
      725000 -- (-1068.343) [-1060.076] (-1062.074) (-1066.484) * (-1066.948) [-1058.958] (-1076.411) (-1057.919) -- 0:01:31

      Average standard deviation of split frequencies: 0.007242

      725500 -- [-1069.180] (-1060.997) (-1070.530) (-1068.877) * (-1076.127) [-1053.958] (-1059.873) (-1053.366) -- 0:01:31
      726000 -- (-1057.710) (-1064.665) [-1063.279] (-1069.081) * (-1060.973) [-1058.244] (-1055.471) (-1072.255) -- 0:01:30
      726500 -- (-1062.398) [-1063.939] (-1075.063) (-1069.079) * [-1059.569] (-1065.399) (-1065.945) (-1057.059) -- 0:01:30
      727000 -- (-1062.705) [-1052.306] (-1085.332) (-1068.476) * (-1069.225) [-1069.753] (-1063.233) (-1060.470) -- 0:01:30
      727500 -- (-1078.803) (-1058.814) (-1069.554) [-1055.197] * [-1059.968] (-1067.854) (-1054.653) (-1063.578) -- 0:01:30
      728000 -- (-1065.481) [-1063.642] (-1063.422) (-1061.049) * (-1069.150) (-1083.318) (-1068.552) [-1052.744] -- 0:01:30
      728500 -- (-1060.966) (-1061.298) [-1057.731] (-1068.045) * [-1058.422] (-1057.794) (-1059.479) (-1054.259) -- 0:01:30
      729000 -- (-1067.830) (-1069.752) [-1064.793] (-1058.629) * (-1067.305) [-1055.943] (-1057.242) (-1060.926) -- 0:01:29
      729500 -- (-1068.586) (-1058.883) (-1061.768) [-1056.413] * [-1065.973] (-1088.092) (-1052.251) (-1056.830) -- 0:01:29
      730000 -- (-1056.257) (-1064.632) (-1073.022) [-1056.198] * (-1072.905) (-1071.270) (-1053.791) [-1067.562] -- 0:01:29

      Average standard deviation of split frequencies: 0.007345

      730500 -- (-1067.576) (-1055.993) (-1067.790) [-1066.733] * (-1067.971) (-1063.285) (-1057.484) [-1069.704] -- 0:01:29
      731000 -- (-1071.962) [-1070.679] (-1078.939) (-1075.933) * (-1069.962) (-1070.367) [-1054.717] (-1063.335) -- 0:01:29
      731500 -- [-1062.053] (-1073.689) (-1060.920) (-1064.961) * [-1057.279] (-1060.896) (-1064.401) (-1072.310) -- 0:01:29
      732000 -- (-1061.081) [-1055.828] (-1064.483) (-1059.430) * [-1056.413] (-1057.871) (-1059.339) (-1063.148) -- 0:01:28
      732500 -- (-1064.402) (-1070.175) (-1058.139) [-1057.250] * (-1073.236) [-1052.261] (-1070.931) (-1065.287) -- 0:01:28
      733000 -- [-1067.241] (-1068.177) (-1061.912) (-1063.802) * (-1066.244) [-1056.596] (-1076.679) (-1057.882) -- 0:01:28
      733500 -- [-1059.089] (-1060.581) (-1071.763) (-1065.048) * (-1062.664) (-1055.416) (-1055.036) [-1056.580] -- 0:01:28
      734000 -- [-1063.113] (-1051.158) (-1073.625) (-1069.319) * (-1066.378) (-1064.993) (-1074.654) [-1055.631] -- 0:01:28
      734500 -- (-1071.672) (-1060.892) (-1073.693) [-1060.766] * (-1066.431) (-1077.089) [-1061.395] (-1064.275) -- 0:01:28
      735000 -- [-1061.155] (-1067.743) (-1074.616) (-1064.952) * (-1062.840) (-1078.090) (-1056.143) [-1053.466] -- 0:01:27

      Average standard deviation of split frequencies: 0.007243

      735500 -- [-1058.697] (-1064.639) (-1068.254) (-1077.238) * (-1080.522) (-1082.889) (-1063.143) [-1051.768] -- 0:01:27
      736000 -- (-1060.649) [-1072.541] (-1066.606) (-1058.629) * [-1059.409] (-1065.577) (-1061.031) (-1078.733) -- 0:01:27
      736500 -- (-1060.212) (-1068.030) [-1055.131] (-1067.725) * (-1065.455) (-1066.360) (-1063.909) [-1058.681] -- 0:01:27
      737000 -- [-1055.154] (-1077.309) (-1060.454) (-1063.706) * (-1052.164) (-1053.864) (-1074.098) [-1051.775] -- 0:01:27
      737500 -- (-1055.473) (-1066.695) (-1071.992) [-1063.992] * (-1062.967) (-1063.181) (-1069.253) [-1050.203] -- 0:01:27
      738000 -- (-1055.335) (-1074.169) (-1074.331) [-1061.161] * (-1053.823) (-1072.683) (-1070.943) [-1053.077] -- 0:01:26
      738500 -- [-1052.948] (-1073.792) (-1076.059) (-1060.842) * (-1056.732) (-1058.031) [-1059.926] (-1058.349) -- 0:01:26
      739000 -- (-1067.134) (-1064.079) [-1063.569] (-1058.125) * (-1061.666) [-1053.435] (-1062.355) (-1071.918) -- 0:01:26
      739500 -- (-1057.542) (-1064.775) [-1058.734] (-1064.535) * (-1073.089) (-1064.619) [-1056.340] (-1072.917) -- 0:01:26
      740000 -- [-1058.294] (-1068.523) (-1054.323) (-1065.493) * [-1053.697] (-1071.414) (-1064.378) (-1058.370) -- 0:01:26

      Average standard deviation of split frequencies: 0.007344

      740500 -- (-1068.726) (-1072.514) (-1069.193) [-1059.113] * (-1061.867) (-1070.392) (-1079.006) [-1072.921] -- 0:01:26
      741000 -- (-1065.296) [-1061.441] (-1080.133) (-1074.887) * [-1062.103] (-1071.702) (-1084.560) (-1058.330) -- 0:01:25
      741500 -- [-1060.352] (-1060.642) (-1059.996) (-1075.374) * (-1052.031) (-1060.183) [-1065.596] (-1068.836) -- 0:01:25
      742000 -- (-1061.665) [-1051.647] (-1061.666) (-1079.160) * (-1062.430) (-1059.450) (-1069.090) [-1073.192] -- 0:01:25
      742500 -- (-1048.423) [-1059.547] (-1060.024) (-1060.058) * (-1061.210) (-1060.954) [-1062.189] (-1078.116) -- 0:01:25
      743000 -- [-1049.601] (-1075.268) (-1057.076) (-1068.380) * (-1059.119) (-1059.262) (-1060.515) [-1063.943] -- 0:01:25
      743500 -- (-1058.739) (-1064.118) (-1063.904) [-1052.598] * (-1060.340) (-1073.037) [-1060.964] (-1057.859) -- 0:01:25
      744000 -- (-1058.179) (-1053.354) [-1054.930] (-1076.650) * (-1063.825) [-1061.315] (-1070.166) (-1051.464) -- 0:01:24
      744500 -- (-1069.645) (-1059.641) [-1056.932] (-1070.042) * [-1055.792] (-1056.812) (-1061.997) (-1066.662) -- 0:01:24
      745000 -- (-1062.575) [-1055.913] (-1058.836) (-1062.524) * (-1057.627) (-1063.032) (-1072.652) [-1048.728] -- 0:01:24

      Average standard deviation of split frequencies: 0.006854

      745500 -- (-1055.927) [-1054.111] (-1063.769) (-1066.853) * (-1060.910) [-1064.644] (-1063.055) (-1061.297) -- 0:01:24
      746000 -- (-1064.790) [-1055.951] (-1071.595) (-1071.113) * (-1064.665) (-1057.023) [-1058.327] (-1058.998) -- 0:01:24
      746500 -- [-1059.565] (-1059.011) (-1080.576) (-1061.095) * (-1064.296) (-1063.158) (-1065.878) [-1051.088] -- 0:01:24
      747000 -- [-1053.781] (-1073.283) (-1079.599) (-1060.787) * [-1053.587] (-1060.089) (-1068.805) (-1055.491) -- 0:01:23
      747500 -- (-1063.852) [-1050.028] (-1071.660) (-1057.395) * (-1067.472) [-1057.425] (-1055.768) (-1067.429) -- 0:01:23
      748000 -- (-1059.056) (-1060.083) (-1071.258) [-1064.930] * (-1073.225) (-1068.062) [-1057.192] (-1061.546) -- 0:01:23
      748500 -- (-1054.322) (-1054.218) [-1062.117] (-1066.524) * (-1062.314) (-1059.935) (-1071.633) [-1055.906] -- 0:01:23
      749000 -- (-1049.060) (-1065.994) [-1055.550] (-1075.800) * (-1076.992) [-1055.018] (-1064.239) (-1055.999) -- 0:01:23
      749500 -- [-1057.071] (-1063.802) (-1065.213) (-1067.410) * (-1059.742) [-1072.954] (-1069.371) (-1063.838) -- 0:01:23
      750000 -- [-1052.892] (-1065.784) (-1073.870) (-1060.315) * [-1049.699] (-1069.288) (-1063.329) (-1065.007) -- 0:01:23

      Average standard deviation of split frequencies: 0.007053

      750500 -- (-1058.774) (-1064.904) (-1075.162) [-1067.515] * (-1066.313) [-1069.326] (-1059.367) (-1069.084) -- 0:01:22
      751000 -- [-1051.543] (-1057.394) (-1061.446) (-1083.057) * [-1052.983] (-1056.547) (-1055.037) (-1066.058) -- 0:01:22
      751500 -- (-1067.723) [-1057.698] (-1060.705) (-1064.880) * (-1057.922) [-1060.217] (-1057.731) (-1078.160) -- 0:01:22
      752000 -- (-1070.120) (-1062.471) [-1063.064] (-1071.444) * (-1065.111) (-1059.278) [-1054.961] (-1067.302) -- 0:01:22
      752500 -- (-1073.026) [-1054.595] (-1066.065) (-1068.737) * (-1068.377) [-1054.347] (-1064.053) (-1081.873) -- 0:01:22
      753000 -- (-1069.107) [-1056.211] (-1057.526) (-1066.592) * [-1065.030] (-1057.953) (-1062.848) (-1055.424) -- 0:01:22
      753500 -- (-1069.234) [-1058.066] (-1059.321) (-1064.008) * (-1062.302) (-1058.760) (-1078.802) [-1053.278] -- 0:01:21
      754000 -- (-1081.755) (-1056.978) [-1053.088] (-1055.892) * (-1070.397) [-1064.411] (-1068.506) (-1049.252) -- 0:01:21
      754500 -- (-1058.962) (-1066.543) [-1052.256] (-1064.534) * [-1060.965] (-1074.170) (-1057.396) (-1053.076) -- 0:01:21
      755000 -- (-1061.188) (-1057.655) [-1065.249] (-1065.220) * (-1062.918) [-1060.048] (-1067.204) (-1062.840) -- 0:01:21

      Average standard deviation of split frequencies: 0.006859

      755500 -- (-1076.713) [-1060.660] (-1056.197) (-1060.942) * (-1056.636) (-1066.332) [-1063.145] (-1081.089) -- 0:01:21
      756000 -- (-1056.846) (-1074.963) (-1066.989) [-1057.703] * (-1075.645) [-1052.303] (-1059.055) (-1067.828) -- 0:01:21
      756500 -- (-1062.912) (-1085.351) (-1063.417) [-1051.637] * (-1080.849) (-1064.314) [-1068.157] (-1068.872) -- 0:01:20
      757000 -- (-1061.982) (-1067.073) [-1053.605] (-1063.732) * (-1065.795) (-1063.045) (-1070.728) [-1062.608] -- 0:01:20
      757500 -- (-1070.385) [-1065.754] (-1068.254) (-1056.538) * [-1056.327] (-1061.702) (-1064.418) (-1073.070) -- 0:01:20
      758000 -- (-1076.482) (-1060.646) [-1056.164] (-1063.082) * (-1061.534) (-1060.925) [-1056.436] (-1067.401) -- 0:01:20
      758500 -- (-1067.178) (-1062.601) [-1056.861] (-1059.440) * (-1061.159) [-1059.730] (-1067.370) (-1063.473) -- 0:01:20
      759000 -- (-1053.965) [-1053.355] (-1068.524) (-1060.822) * (-1054.947) [-1051.707] (-1064.685) (-1056.475) -- 0:01:20
      759500 -- (-1053.225) (-1055.252) [-1067.920] (-1063.001) * [-1058.299] (-1070.707) (-1066.918) (-1054.153) -- 0:01:19
      760000 -- [-1056.950] (-1066.437) (-1059.864) (-1070.675) * (-1073.461) (-1070.931) [-1059.049] (-1061.243) -- 0:01:19

      Average standard deviation of split frequencies: 0.006626

      760500 -- [-1054.933] (-1077.345) (-1070.225) (-1085.028) * (-1068.607) (-1068.670) (-1055.369) [-1055.795] -- 0:01:19
      761000 -- (-1066.734) [-1065.754] (-1073.105) (-1069.199) * (-1064.419) (-1059.652) (-1062.564) [-1061.521] -- 0:01:19
      761500 -- (-1075.506) (-1084.108) (-1070.158) [-1055.532] * (-1071.879) (-1071.935) [-1050.763] (-1069.579) -- 0:01:19
      762000 -- (-1067.824) (-1053.306) [-1061.463] (-1074.988) * (-1065.310) (-1057.968) [-1050.613] (-1063.262) -- 0:01:19
      762500 -- (-1068.403) (-1055.825) (-1053.644) [-1059.324] * (-1061.778) [-1050.945] (-1059.812) (-1062.121) -- 0:01:18
      763000 -- (-1074.669) [-1055.360] (-1080.826) (-1055.878) * (-1063.525) [-1055.018] (-1061.956) (-1056.234) -- 0:01:18
      763500 -- (-1063.253) (-1067.558) [-1053.745] (-1053.493) * (-1064.345) [-1056.584] (-1073.262) (-1056.790) -- 0:01:18
      764000 -- (-1090.182) (-1066.086) [-1059.411] (-1062.194) * [-1054.217] (-1052.767) (-1057.028) (-1058.955) -- 0:01:18
      764500 -- (-1077.067) (-1072.229) [-1062.873] (-1054.042) * [-1061.911] (-1068.623) (-1070.419) (-1069.793) -- 0:01:18
      765000 -- (-1066.178) (-1071.318) (-1059.320) [-1057.284] * (-1052.103) [-1052.241] (-1065.611) (-1058.122) -- 0:01:18

      Average standard deviation of split frequencies: 0.006722

      765500 -- [-1054.664] (-1057.749) (-1077.473) (-1055.336) * (-1057.642) (-1063.764) [-1052.901] (-1076.180) -- 0:01:17
      766000 -- (-1069.419) (-1065.210) [-1054.104] (-1065.264) * (-1069.390) (-1064.528) [-1057.753] (-1083.942) -- 0:01:17
      766500 -- [-1063.699] (-1076.703) (-1063.228) (-1050.891) * (-1063.240) (-1067.598) (-1061.181) [-1055.025] -- 0:01:17
      767000 -- (-1068.806) (-1075.008) (-1055.748) [-1056.696] * [-1056.103] (-1068.690) (-1064.537) (-1060.712) -- 0:01:17
      767500 -- (-1073.750) (-1073.487) [-1053.791] (-1070.933) * (-1065.983) (-1058.479) [-1054.586] (-1089.685) -- 0:01:17
      768000 -- (-1064.228) (-1063.536) [-1052.149] (-1061.837) * [-1059.114] (-1063.310) (-1070.404) (-1066.723) -- 0:01:17
      768500 -- (-1071.282) (-1066.792) [-1058.564] (-1056.029) * (-1070.869) (-1055.297) (-1064.348) [-1073.734] -- 0:01:16
      769000 -- (-1057.170) (-1063.006) [-1061.985] (-1073.157) * [-1048.628] (-1060.979) (-1084.734) (-1069.348) -- 0:01:16
      769500 -- [-1062.123] (-1059.992) (-1056.414) (-1064.953) * (-1062.094) (-1076.391) (-1061.128) [-1064.812] -- 0:01:16
      770000 -- (-1069.013) (-1055.464) [-1061.402] (-1070.923) * [-1061.570] (-1067.475) (-1066.530) (-1060.738) -- 0:01:16

      Average standard deviation of split frequencies: 0.007058

      770500 -- (-1083.687) (-1063.624) (-1066.750) [-1054.310] * (-1069.429) (-1055.767) (-1068.910) [-1055.248] -- 0:01:16
      771000 -- (-1061.949) [-1061.108] (-1068.046) (-1059.582) * (-1070.792) (-1058.339) (-1080.367) [-1055.278] -- 0:01:16
      771500 -- (-1080.245) (-1060.540) (-1051.855) [-1057.616] * (-1063.078) [-1061.774] (-1069.250) (-1061.839) -- 0:01:15
      772000 -- (-1062.909) (-1063.535) [-1049.441] (-1061.400) * (-1072.675) (-1056.882) (-1060.227) [-1062.623] -- 0:01:15
      772500 -- (-1073.884) (-1064.675) [-1059.698] (-1055.699) * [-1056.760] (-1074.101) (-1055.337) (-1072.127) -- 0:01:15
      773000 -- [-1051.919] (-1055.087) (-1069.870) (-1058.346) * (-1063.015) (-1057.510) [-1054.711] (-1070.704) -- 0:01:15
      773500 -- (-1059.087) [-1062.806] (-1063.644) (-1056.009) * (-1054.486) [-1051.685] (-1057.438) (-1060.684) -- 0:01:15
      774000 -- [-1051.234] (-1069.240) (-1055.531) (-1057.856) * [-1055.898] (-1069.622) (-1058.369) (-1070.845) -- 0:01:15
      774500 -- (-1058.965) (-1058.101) (-1057.241) [-1057.212] * (-1058.265) (-1066.523) [-1054.414] (-1077.001) -- 0:01:14
      775000 -- (-1051.057) (-1066.882) [-1060.126] (-1074.408) * (-1088.194) [-1061.471] (-1051.696) (-1048.920) -- 0:01:14

      Average standard deviation of split frequencies: 0.007103

      775500 -- (-1054.792) (-1068.744) [-1051.585] (-1054.482) * (-1074.011) (-1067.656) [-1052.247] (-1063.504) -- 0:01:14
      776000 -- (-1060.143) [-1056.939] (-1072.059) (-1068.449) * (-1060.755) [-1057.540] (-1055.489) (-1061.780) -- 0:01:14
      776500 -- (-1068.148) (-1060.848) [-1063.461] (-1065.622) * (-1076.506) (-1063.517) [-1060.204] (-1058.227) -- 0:01:14
      777000 -- (-1057.653) [-1060.794] (-1085.089) (-1063.345) * (-1065.460) (-1062.571) [-1053.416] (-1060.464) -- 0:01:14
      777500 -- [-1052.977] (-1082.835) (-1059.547) (-1071.632) * (-1067.438) (-1060.034) (-1051.235) [-1059.960] -- 0:01:13
      778000 -- [-1048.424] (-1066.272) (-1068.159) (-1066.417) * [-1067.035] (-1068.932) (-1059.447) (-1061.664) -- 0:01:13
      778500 -- [-1054.092] (-1070.182) (-1055.004) (-1066.923) * (-1056.527) (-1056.171) [-1056.200] (-1069.591) -- 0:01:13
      779000 -- [-1067.981] (-1058.882) (-1059.231) (-1075.749) * (-1070.921) (-1059.489) (-1061.252) [-1066.307] -- 0:01:13
      779500 -- (-1069.161) (-1079.413) [-1055.805] (-1069.415) * (-1065.887) (-1060.550) [-1057.846] (-1073.681) -- 0:01:13
      780000 -- [-1056.794] (-1063.666) (-1054.599) (-1057.123) * [-1053.055] (-1063.565) (-1061.856) (-1069.430) -- 0:01:13

      Average standard deviation of split frequencies: 0.007618

      780500 -- [-1059.177] (-1067.007) (-1059.196) (-1062.433) * [-1053.893] (-1065.219) (-1061.859) (-1067.113) -- 0:01:12
      781000 -- (-1079.891) (-1079.388) [-1052.258] (-1057.055) * (-1064.305) (-1079.172) [-1051.677] (-1067.364) -- 0:01:12
      781500 -- (-1071.292) [-1060.401] (-1061.360) (-1059.309) * (-1059.429) (-1064.713) (-1069.091) [-1048.769] -- 0:01:12
      782000 -- (-1067.168) (-1068.085) (-1056.714) [-1048.149] * (-1071.057) [-1059.590] (-1075.050) (-1062.816) -- 0:01:12
      782500 -- (-1063.494) (-1066.488) [-1060.050] (-1069.455) * (-1060.341) (-1071.393) (-1067.897) [-1063.851] -- 0:01:12
      783000 -- (-1049.318) [-1052.317] (-1061.553) (-1061.674) * (-1058.688) [-1062.876] (-1071.146) (-1054.710) -- 0:01:12
      783500 -- (-1063.415) (-1068.920) (-1057.802) [-1054.592] * [-1059.785] (-1057.695) (-1074.082) (-1057.766) -- 0:01:11
      784000 -- (-1066.950) (-1069.583) [-1058.761] (-1074.079) * (-1074.035) (-1053.688) (-1057.769) [-1056.206] -- 0:01:11
      784500 -- (-1058.959) (-1084.313) (-1055.798) [-1055.478] * (-1068.559) [-1060.804] (-1074.668) (-1047.799) -- 0:01:11
      785000 -- (-1070.200) (-1062.792) [-1052.815] (-1062.524) * (-1068.528) (-1076.593) (-1061.185) [-1050.638] -- 0:01:11

      Average standard deviation of split frequencies: 0.007704

      785500 -- (-1070.158) [-1066.591] (-1059.875) (-1070.666) * (-1061.980) (-1069.238) (-1058.911) [-1058.639] -- 0:01:11
      786000 -- (-1073.568) (-1063.527) [-1057.399] (-1050.995) * (-1068.201) (-1073.521) (-1069.606) [-1055.688] -- 0:01:11
      786500 -- (-1061.097) (-1065.472) (-1053.061) [-1060.081] * (-1065.091) (-1072.128) [-1054.976] (-1071.849) -- 0:01:10
      787000 -- (-1070.560) [-1060.445] (-1062.662) (-1059.398) * (-1058.524) (-1071.888) [-1052.618] (-1054.056) -- 0:01:10
      787500 -- (-1066.052) (-1089.576) (-1057.821) [-1058.388] * (-1062.085) (-1061.964) (-1057.714) [-1061.265] -- 0:01:10
      788000 -- [-1059.516] (-1070.873) (-1052.780) (-1064.712) * (-1077.572) (-1053.693) [-1058.242] (-1067.783) -- 0:01:10
      788500 -- (-1059.555) [-1050.737] (-1076.982) (-1072.132) * (-1072.083) (-1056.300) (-1067.657) [-1056.155] -- 0:01:10
      789000 -- (-1059.094) (-1065.437) [-1062.416] (-1073.113) * (-1073.167) [-1050.667] (-1060.659) (-1066.282) -- 0:01:10
      789500 -- [-1056.847] (-1063.322) (-1062.914) (-1064.037) * (-1068.233) [-1053.548] (-1061.767) (-1070.070) -- 0:01:09
      790000 -- (-1057.516) (-1067.186) (-1064.617) [-1050.018] * (-1072.253) [-1054.220] (-1066.126) (-1071.470) -- 0:01:09

      Average standard deviation of split frequencies: 0.007384

      790500 -- [-1059.038] (-1061.694) (-1066.717) (-1076.640) * [-1074.708] (-1070.579) (-1073.091) (-1060.201) -- 0:01:09
      791000 -- [-1049.443] (-1057.608) (-1069.961) (-1057.844) * [-1061.254] (-1065.473) (-1054.147) (-1059.385) -- 0:01:09
      791500 -- (-1061.973) (-1059.153) (-1067.109) [-1058.997] * (-1063.352) (-1068.004) (-1062.186) [-1059.117] -- 0:01:09
      792000 -- (-1065.409) (-1065.375) (-1054.121) [-1052.979] * (-1061.098) [-1059.350] (-1057.434) (-1076.856) -- 0:01:09
      792500 -- (-1061.815) [-1058.688] (-1078.334) (-1062.133) * (-1055.205) (-1060.714) [-1051.104] (-1071.818) -- 0:01:08
      793000 -- (-1057.164) (-1068.756) (-1078.770) [-1056.964] * (-1061.407) [-1053.466] (-1057.849) (-1064.814) -- 0:01:08
      793500 -- (-1055.811) (-1060.103) (-1069.275) [-1066.822] * (-1063.282) (-1063.290) [-1053.642] (-1068.023) -- 0:01:08
      794000 -- [-1069.444] (-1077.893) (-1064.133) (-1059.169) * (-1066.124) [-1053.842] (-1054.107) (-1070.462) -- 0:01:08
      794500 -- (-1060.353) (-1095.496) (-1063.126) [-1053.659] * [-1052.253] (-1067.261) (-1059.203) (-1068.313) -- 0:01:08
      795000 -- [-1054.089] (-1071.266) (-1073.890) (-1056.445) * (-1059.908) (-1062.079) (-1058.178) [-1049.954] -- 0:01:08

      Average standard deviation of split frequencies: 0.006742

      795500 -- (-1063.250) (-1072.918) (-1078.740) [-1052.900] * (-1080.072) (-1067.679) (-1058.149) [-1057.122] -- 0:01:07
      796000 -- (-1052.345) (-1064.763) (-1075.262) [-1062.333] * [-1058.835] (-1067.216) (-1054.388) (-1060.965) -- 0:01:07
      796500 -- (-1069.407) (-1052.677) (-1075.266) [-1060.556] * [-1049.236] (-1076.841) (-1058.780) (-1063.751) -- 0:01:07
      797000 -- (-1058.608) [-1052.529] (-1070.072) (-1061.305) * (-1058.065) (-1056.527) [-1056.636] (-1066.775) -- 0:01:07
      797500 -- (-1057.068) (-1057.399) (-1064.348) [-1054.553] * [-1049.026] (-1056.688) (-1074.591) (-1059.434) -- 0:01:07
      798000 -- (-1071.194) (-1059.776) [-1064.688] (-1057.149) * (-1061.682) (-1075.238) [-1063.536] (-1076.374) -- 0:01:07
      798500 -- (-1055.874) (-1068.527) (-1062.734) [-1045.785] * (-1072.247) [-1059.198] (-1058.786) (-1065.608) -- 0:01:06
      799000 -- (-1063.297) [-1053.200] (-1057.677) (-1059.479) * (-1064.518) (-1055.501) (-1063.000) [-1054.198] -- 0:01:06
      799500 -- [-1066.033] (-1061.007) (-1066.848) (-1067.781) * (-1064.195) (-1066.285) (-1056.584) [-1059.515] -- 0:01:06
      800000 -- (-1063.294) [-1056.217] (-1061.374) (-1064.669) * [-1066.126] (-1057.262) (-1067.906) (-1067.558) -- 0:01:06

      Average standard deviation of split frequencies: 0.007156

      800500 -- [-1059.390] (-1056.886) (-1059.726) (-1065.901) * (-1063.504) (-1061.327) [-1055.541] (-1061.567) -- 0:01:06
      801000 -- (-1078.002) [-1050.495] (-1066.074) (-1062.410) * [-1061.263] (-1076.684) (-1065.563) (-1057.229) -- 0:01:06
      801500 -- (-1058.994) (-1074.276) (-1061.908) [-1056.514] * (-1060.476) (-1067.759) [-1055.637] (-1059.334) -- 0:01:05
      802000 -- (-1073.604) (-1069.834) [-1054.152] (-1066.735) * (-1053.045) (-1073.013) [-1059.415] (-1066.628) -- 0:01:05
      802500 -- (-1082.920) (-1061.235) (-1066.678) [-1046.433] * (-1060.767) (-1060.831) (-1056.573) [-1060.714] -- 0:01:05
      803000 -- (-1061.925) (-1064.425) [-1049.110] (-1059.070) * (-1070.194) (-1058.045) [-1054.415] (-1057.738) -- 0:01:05
      803500 -- (-1071.112) [-1059.729] (-1059.973) (-1058.510) * (-1075.472) [-1058.540] (-1063.371) (-1074.644) -- 0:01:05
      804000 -- (-1058.099) (-1067.046) (-1063.912) [-1062.148] * (-1066.313) (-1062.690) (-1081.100) [-1062.391] -- 0:01:05
      804500 -- [-1059.406] (-1074.168) (-1067.168) (-1060.385) * (-1082.212) (-1065.577) (-1062.271) [-1058.918] -- 0:01:05
      805000 -- [-1060.923] (-1062.849) (-1053.881) (-1065.268) * (-1066.639) (-1073.248) [-1056.100] (-1052.294) -- 0:01:04

      Average standard deviation of split frequencies: 0.007153

      805500 -- (-1061.210) [-1055.401] (-1058.521) (-1064.960) * [-1057.460] (-1076.520) (-1063.821) (-1059.594) -- 0:01:04
      806000 -- [-1057.886] (-1063.093) (-1065.912) (-1059.163) * (-1065.187) (-1063.807) [-1056.371] (-1056.982) -- 0:01:04
      806500 -- [-1058.790] (-1067.767) (-1076.075) (-1072.185) * (-1048.620) [-1058.193] (-1052.237) (-1087.896) -- 0:01:04
      807000 -- (-1059.757) (-1068.366) (-1076.902) [-1062.999] * (-1067.490) (-1060.181) (-1046.224) [-1071.414] -- 0:01:04
      807500 -- (-1054.922) (-1073.566) [-1067.067] (-1067.481) * (-1066.108) [-1063.076] (-1066.089) (-1067.046) -- 0:01:03
      808000 -- (-1060.882) [-1058.476] (-1054.339) (-1075.698) * [-1065.498] (-1065.580) (-1069.953) (-1066.226) -- 0:01:03
      808500 -- (-1060.844) (-1051.307) [-1055.729] (-1080.877) * (-1064.845) [-1064.845] (-1061.193) (-1060.448) -- 0:01:03
      809000 -- [-1050.447] (-1064.766) (-1069.994) (-1073.295) * (-1068.135) [-1061.145] (-1063.391) (-1053.873) -- 0:01:03
      809500 -- (-1071.103) [-1052.969] (-1062.830) (-1073.195) * [-1063.268] (-1057.654) (-1070.665) (-1070.577) -- 0:01:03
      810000 -- (-1058.275) (-1057.494) [-1053.137] (-1074.956) * (-1066.028) [-1056.963] (-1070.050) (-1062.495) -- 0:01:03

      Average standard deviation of split frequencies: 0.007560

      810500 -- (-1071.397) [-1065.599] (-1072.429) (-1054.797) * (-1058.858) (-1070.092) (-1065.557) [-1056.607] -- 0:01:02
      811000 -- (-1062.759) (-1063.109) (-1066.773) [-1062.370] * (-1049.459) (-1076.396) [-1060.507] (-1066.864) -- 0:01:02
      811500 -- (-1062.290) (-1067.302) (-1074.737) [-1063.551] * (-1060.983) (-1076.322) (-1070.891) [-1061.257] -- 0:01:02
      812000 -- (-1057.383) (-1057.262) [-1064.031] (-1076.152) * (-1068.098) (-1063.360) (-1076.222) [-1055.669] -- 0:01:02
      812500 -- (-1066.220) (-1067.824) (-1068.885) [-1064.072] * (-1063.466) (-1065.125) [-1062.226] (-1059.255) -- 0:01:02
      813000 -- [-1065.680] (-1069.261) (-1064.418) (-1075.928) * (-1050.100) (-1067.797) (-1079.919) [-1055.271] -- 0:01:02
      813500 -- (-1053.182) (-1076.298) (-1051.690) [-1061.509] * [-1064.799] (-1062.427) (-1063.015) (-1053.300) -- 0:01:01
      814000 -- (-1061.841) (-1076.611) (-1068.254) [-1058.526] * [-1052.288] (-1058.187) (-1059.290) (-1068.175) -- 0:01:01
      814500 -- (-1056.438) (-1062.123) (-1066.829) [-1062.657] * (-1063.021) (-1062.372) (-1060.554) [-1062.804] -- 0:01:01
      815000 -- (-1059.250) [-1064.513] (-1056.668) (-1062.741) * [-1059.257] (-1068.319) (-1067.548) (-1064.924) -- 0:01:01

      Average standard deviation of split frequencies: 0.007155

      815500 -- (-1061.447) (-1075.908) (-1073.205) [-1054.240] * (-1057.634) [-1059.952] (-1061.180) (-1071.544) -- 0:01:01
      816000 -- (-1055.550) (-1067.592) (-1060.718) [-1051.640] * (-1071.651) (-1067.030) (-1067.497) [-1064.747] -- 0:01:01
      816500 -- [-1060.864] (-1080.615) (-1056.521) (-1052.956) * [-1054.156] (-1055.640) (-1088.653) (-1064.927) -- 0:01:00
      817000 -- [-1059.212] (-1080.512) (-1059.711) (-1058.717) * [-1053.455] (-1056.943) (-1074.738) (-1071.620) -- 0:01:00
      817500 -- [-1068.039] (-1076.189) (-1060.325) (-1065.852) * (-1060.795) [-1057.849] (-1067.766) (-1068.678) -- 0:01:00
      818000 -- (-1060.056) (-1070.033) (-1063.871) [-1058.930] * (-1066.751) [-1046.806] (-1060.112) (-1057.933) -- 0:01:00
      818500 -- [-1058.691] (-1071.034) (-1061.871) (-1066.723) * [-1068.893] (-1062.444) (-1083.842) (-1064.173) -- 0:01:00
      819000 -- (-1071.752) (-1055.933) [-1062.587] (-1079.549) * (-1062.935) (-1064.546) (-1065.766) [-1056.215] -- 0:01:00
      819500 -- (-1070.934) (-1058.787) (-1060.603) [-1054.050] * (-1068.022) (-1049.193) (-1072.680) [-1060.806] -- 0:00:59
      820000 -- (-1074.138) [-1059.815] (-1066.308) (-1068.780) * (-1060.171) (-1058.548) (-1069.907) [-1055.333] -- 0:00:59

      Average standard deviation of split frequencies: 0.007202

      820500 -- (-1070.751) (-1060.635) [-1057.628] (-1076.237) * [-1061.204] (-1063.616) (-1079.353) (-1061.019) -- 0:00:59
      821000 -- (-1056.571) [-1057.871] (-1078.409) (-1063.675) * (-1065.781) (-1063.436) (-1068.487) [-1058.441] -- 0:00:59
      821500 -- (-1062.216) (-1063.279) (-1072.801) [-1053.359] * (-1070.339) [-1057.446] (-1059.156) (-1056.181) -- 0:00:59
      822000 -- (-1067.787) (-1054.376) (-1067.700) [-1057.257] * (-1063.589) (-1051.923) (-1074.780) [-1052.483] -- 0:00:59
      822500 -- (-1061.812) (-1061.060) [-1061.675] (-1056.102) * (-1063.369) [-1061.874] (-1068.949) (-1062.009) -- 0:00:58
      823000 -- (-1066.156) [-1062.611] (-1067.771) (-1054.129) * (-1080.590) [-1056.656] (-1055.302) (-1058.513) -- 0:00:58
      823500 -- [-1062.240] (-1071.479) (-1056.978) (-1066.765) * [-1072.979] (-1063.881) (-1062.516) (-1055.123) -- 0:00:58
      824000 -- (-1061.120) [-1065.745] (-1063.794) (-1061.149) * (-1070.747) [-1049.995] (-1061.870) (-1069.335) -- 0:00:58
      824500 -- (-1064.094) (-1066.532) [-1055.046] (-1063.354) * [-1057.270] (-1060.776) (-1057.756) (-1068.679) -- 0:00:58
      825000 -- (-1072.715) (-1067.335) [-1052.278] (-1063.915) * [-1059.091] (-1071.383) (-1066.711) (-1068.118) -- 0:00:58

      Average standard deviation of split frequencies: 0.007331

      825500 -- (-1068.488) (-1071.651) [-1056.238] (-1059.196) * (-1062.810) (-1072.169) (-1075.755) [-1057.489] -- 0:00:57
      826000 -- (-1061.297) (-1063.074) [-1047.114] (-1054.923) * (-1059.549) (-1074.627) [-1064.633] (-1066.692) -- 0:00:57
      826500 -- (-1073.037) [-1050.633] (-1067.200) (-1066.012) * (-1067.932) (-1072.489) (-1058.393) [-1060.488] -- 0:00:57
      827000 -- (-1070.482) (-1074.513) (-1067.590) [-1054.067] * (-1061.148) (-1064.584) (-1057.889) [-1052.962] -- 0:00:57
      827500 -- (-1081.625) (-1052.669) [-1059.889] (-1058.917) * (-1053.424) (-1071.203) [-1058.588] (-1064.682) -- 0:00:57
      828000 -- (-1054.515) [-1052.549] (-1056.204) (-1083.187) * [-1060.587] (-1062.932) (-1073.795) (-1059.639) -- 0:00:57
      828500 -- (-1066.451) [-1057.555] (-1056.456) (-1064.533) * (-1051.396) (-1065.915) [-1067.257] (-1064.678) -- 0:00:56
      829000 -- [-1060.033] (-1057.166) (-1056.408) (-1066.359) * [-1051.200] (-1062.854) (-1069.048) (-1058.260) -- 0:00:56
      829500 -- (-1066.862) [-1054.649] (-1059.455) (-1057.607) * (-1069.957) [-1058.544] (-1052.328) (-1066.769) -- 0:00:56
      830000 -- [-1059.458] (-1069.132) (-1058.842) (-1061.809) * [-1065.443] (-1057.360) (-1066.393) (-1069.061) -- 0:00:56

      Average standard deviation of split frequencies: 0.007072

      830500 -- [-1061.418] (-1073.586) (-1062.551) (-1067.841) * (-1064.275) (-1065.445) (-1066.947) [-1059.545] -- 0:00:56
      831000 -- (-1058.232) [-1056.486] (-1055.374) (-1063.763) * (-1059.315) (-1070.806) (-1064.811) [-1067.455] -- 0:00:56
      831500 -- (-1058.756) (-1075.611) (-1065.498) [-1057.430] * [-1049.309] (-1057.624) (-1061.175) (-1059.757) -- 0:00:55
      832000 -- (-1058.850) (-1067.056) [-1059.499] (-1063.310) * [-1049.546] (-1057.240) (-1059.529) (-1078.108) -- 0:00:55
      832500 -- (-1069.749) [-1063.362] (-1072.628) (-1051.851) * [-1057.759] (-1058.655) (-1064.127) (-1058.679) -- 0:00:55
      833000 -- (-1067.193) (-1068.678) (-1053.831) [-1064.330] * (-1064.563) (-1062.250) (-1054.254) [-1059.108] -- 0:00:55
      833500 -- [-1045.684] (-1063.949) (-1062.786) (-1056.826) * (-1061.730) (-1056.929) (-1053.422) [-1063.057] -- 0:00:55
      834000 -- (-1071.929) (-1058.031) [-1057.232] (-1056.115) * (-1055.414) (-1063.684) [-1049.290] (-1077.094) -- 0:00:55
      834500 -- (-1064.704) (-1069.899) (-1065.571) [-1061.990] * (-1063.932) [-1062.900] (-1056.242) (-1073.750) -- 0:00:54
      835000 -- (-1066.031) (-1042.974) [-1065.797] (-1073.568) * (-1065.208) (-1081.525) (-1056.870) [-1057.381] -- 0:00:54

      Average standard deviation of split frequencies: 0.007244

      835500 -- [-1059.457] (-1063.650) (-1076.097) (-1073.046) * (-1064.916) (-1055.764) (-1078.336) [-1059.473] -- 0:00:54
      836000 -- (-1061.107) [-1059.250] (-1066.989) (-1074.899) * [-1066.432] (-1065.434) (-1051.203) (-1067.290) -- 0:00:54
      836500 -- (-1062.296) (-1095.184) (-1064.104) [-1060.944] * (-1064.845) (-1064.009) [-1054.525] (-1069.464) -- 0:00:54
      837000 -- (-1070.677) (-1059.855) [-1054.164] (-1070.847) * (-1070.671) (-1068.150) (-1069.976) [-1055.560] -- 0:00:54
      837500 -- (-1070.861) [-1050.817] (-1068.090) (-1062.146) * (-1068.287) [-1052.782] (-1062.699) (-1049.902) -- 0:00:53
      838000 -- (-1057.642) [-1056.679] (-1056.738) (-1069.876) * (-1063.795) [-1055.204] (-1058.532) (-1067.238) -- 0:00:53
      838500 -- (-1057.927) (-1054.302) [-1061.604] (-1054.516) * (-1060.725) (-1063.488) (-1060.143) [-1051.242] -- 0:00:53
      839000 -- (-1064.040) (-1074.421) [-1059.721] (-1070.934) * [-1061.600] (-1070.898) (-1067.233) (-1055.178) -- 0:00:53
      839500 -- [-1066.426] (-1078.515) (-1059.698) (-1066.787) * (-1053.337) [-1061.141] (-1069.924) (-1071.732) -- 0:00:53
      840000 -- (-1065.915) (-1070.209) [-1054.416] (-1060.203) * (-1066.024) [-1056.099] (-1056.786) (-1061.407) -- 0:00:53

      Average standard deviation of split frequencies: 0.006643

      840500 -- (-1067.314) [-1054.998] (-1061.590) (-1059.814) * (-1063.034) [-1064.617] (-1064.354) (-1059.343) -- 0:00:52
      841000 -- (-1067.819) [-1057.351] (-1068.751) (-1056.333) * [-1056.752] (-1055.330) (-1052.815) (-1073.263) -- 0:00:52
      841500 -- (-1058.582) (-1061.058) (-1067.396) [-1056.193] * [-1058.009] (-1066.260) (-1064.472) (-1065.305) -- 0:00:52
      842000 -- (-1063.605) (-1070.857) (-1079.392) [-1052.095] * (-1059.050) [-1050.442] (-1074.327) (-1082.888) -- 0:00:52
      842500 -- (-1059.431) (-1071.025) [-1059.525] (-1063.277) * (-1079.679) [-1052.465] (-1068.136) (-1071.960) -- 0:00:52
      843000 -- (-1061.183) (-1062.128) (-1078.804) [-1056.105] * [-1061.672] (-1058.895) (-1068.518) (-1079.352) -- 0:00:52
      843500 -- [-1062.703] (-1070.538) (-1066.384) (-1065.545) * (-1061.317) (-1056.978) [-1058.898] (-1090.724) -- 0:00:51
      844000 -- (-1065.808) [-1058.329] (-1055.928) (-1069.467) * (-1061.394) (-1053.883) [-1046.360] (-1075.232) -- 0:00:51
      844500 -- (-1050.190) (-1059.801) (-1065.749) [-1065.233] * [-1059.372] (-1060.546) (-1048.945) (-1090.883) -- 0:00:51
      845000 -- [-1062.685] (-1067.912) (-1073.151) (-1061.952) * [-1052.239] (-1064.142) (-1049.127) (-1077.392) -- 0:00:51

      Average standard deviation of split frequencies: 0.006729

      845500 -- (-1059.088) (-1057.083) [-1066.356] (-1063.121) * [-1062.701] (-1071.811) (-1060.893) (-1066.143) -- 0:00:51
      846000 -- (-1071.749) (-1055.789) [-1064.611] (-1062.516) * (-1066.756) (-1059.110) (-1052.537) [-1062.994] -- 0:00:51
      846500 -- (-1060.255) (-1053.060) (-1059.155) [-1054.942] * (-1071.495) (-1067.656) [-1052.968] (-1078.556) -- 0:00:50
      847000 -- (-1060.863) [-1050.567] (-1062.049) (-1060.737) * (-1065.377) (-1065.045) [-1059.254] (-1070.349) -- 0:00:50
      847500 -- (-1067.836) (-1055.112) (-1076.973) [-1064.817] * (-1060.467) (-1063.741) [-1050.334] (-1056.093) -- 0:00:50
      848000 -- (-1061.001) (-1069.347) (-1075.345) [-1057.131] * [-1052.594] (-1067.513) (-1061.546) (-1066.670) -- 0:00:50
      848500 -- [-1053.581] (-1073.689) (-1057.978) (-1077.274) * [-1062.650] (-1073.880) (-1058.440) (-1069.509) -- 0:00:50
      849000 -- (-1060.706) (-1074.057) [-1053.299] (-1066.960) * (-1074.988) (-1059.673) [-1048.869] (-1088.681) -- 0:00:50
      849500 -- [-1055.441] (-1056.007) (-1063.638) (-1057.232) * (-1065.506) (-1056.058) [-1052.430] (-1076.257) -- 0:00:49
      850000 -- (-1063.868) [-1054.716] (-1075.596) (-1050.182) * [-1056.501] (-1056.594) (-1063.385) (-1080.579) -- 0:00:49

      Average standard deviation of split frequencies: 0.006352

      850500 -- (-1063.279) (-1069.464) (-1050.511) [-1059.170] * (-1077.433) [-1057.213] (-1059.778) (-1064.115) -- 0:00:49
      851000 -- (-1056.393) [-1061.610] (-1064.515) (-1070.111) * (-1072.458) (-1068.772) [-1055.478] (-1061.913) -- 0:00:49
      851500 -- [-1053.948] (-1054.355) (-1060.378) (-1062.710) * (-1066.263) (-1055.023) [-1053.385] (-1058.421) -- 0:00:49
      852000 -- (-1070.704) [-1057.209] (-1057.611) (-1069.991) * (-1070.075) [-1054.395] (-1077.170) (-1062.677) -- 0:00:49
      852500 -- (-1067.095) [-1067.026] (-1067.283) (-1071.148) * (-1054.082) (-1081.086) [-1066.980] (-1067.702) -- 0:00:48
      853000 -- (-1058.596) (-1065.750) (-1074.687) [-1058.459] * (-1067.063) [-1056.268] (-1066.644) (-1079.231) -- 0:00:48
      853500 -- (-1064.498) (-1052.435) (-1059.649) [-1056.016] * [-1055.738] (-1071.656) (-1066.822) (-1064.381) -- 0:00:48
      854000 -- (-1077.810) (-1057.579) (-1053.860) [-1058.162] * (-1057.816) (-1066.502) [-1052.350] (-1060.969) -- 0:00:48
      854500 -- (-1069.455) (-1057.137) [-1054.857] (-1072.362) * (-1063.828) (-1063.284) [-1048.172] (-1055.220) -- 0:00:48
      855000 -- (-1065.278) (-1059.301) [-1057.207] (-1069.024) * (-1075.736) (-1075.918) (-1055.194) [-1061.500] -- 0:00:48

      Average standard deviation of split frequencies: 0.006312

      855500 -- (-1063.423) (-1064.475) (-1067.279) [-1051.846] * (-1065.361) (-1081.435) [-1055.558] (-1067.220) -- 0:00:47
      856000 -- (-1072.551) (-1061.315) (-1072.030) [-1066.193] * (-1065.256) (-1074.880) (-1055.251) [-1064.354] -- 0:00:47
      856500 -- (-1056.148) (-1069.198) (-1068.821) [-1057.865] * [-1066.780] (-1064.965) (-1080.934) (-1060.172) -- 0:00:47
      857000 -- (-1076.304) (-1061.250) [-1071.886] (-1067.038) * (-1068.468) [-1063.956] (-1050.622) (-1066.189) -- 0:00:47
      857500 -- (-1056.821) (-1074.317) (-1060.578) [-1052.682] * (-1054.870) (-1054.633) (-1059.772) [-1046.719] -- 0:00:47
      858000 -- [-1063.757] (-1072.257) (-1059.504) (-1075.796) * (-1066.797) (-1057.567) (-1057.244) [-1050.132] -- 0:00:47
      858500 -- [-1053.498] (-1058.457) (-1057.612) (-1064.476) * (-1059.183) [-1054.136] (-1072.336) (-1058.348) -- 0:00:46
      859000 -- (-1063.869) (-1070.024) (-1061.868) [-1054.075] * (-1055.151) (-1058.659) [-1056.495] (-1085.160) -- 0:00:46
      859500 -- [-1060.862] (-1063.656) (-1066.596) (-1064.672) * (-1073.271) [-1054.981] (-1060.153) (-1072.719) -- 0:00:46
      860000 -- [-1054.801] (-1060.105) (-1067.606) (-1056.191) * [-1061.866] (-1059.552) (-1063.855) (-1073.924) -- 0:00:46

      Average standard deviation of split frequencies: 0.006615

      860500 -- [-1058.462] (-1065.745) (-1063.639) (-1055.691) * (-1072.847) (-1073.722) [-1061.357] (-1065.267) -- 0:00:46
      861000 -- (-1064.245) (-1072.215) (-1060.781) [-1053.695] * (-1065.378) (-1057.213) [-1067.603] (-1080.058) -- 0:00:46
      861500 -- (-1058.118) (-1075.430) (-1066.160) [-1061.659] * (-1072.237) [-1052.282] (-1069.974) (-1064.222) -- 0:00:45
      862000 -- (-1061.746) (-1060.346) [-1059.630] (-1074.294) * (-1058.129) (-1056.845) [-1062.962] (-1071.507) -- 0:00:45
      862500 -- (-1059.864) (-1067.705) (-1062.484) [-1063.434] * [-1059.768] (-1057.309) (-1055.987) (-1071.800) -- 0:00:45
      863000 -- (-1057.771) (-1054.274) (-1076.315) [-1057.384] * [-1055.125] (-1056.907) (-1059.830) (-1067.727) -- 0:00:45
      863500 -- (-1073.197) (-1054.241) [-1052.101] (-1071.087) * (-1066.647) (-1058.196) (-1059.588) [-1063.759] -- 0:00:45
      864000 -- (-1075.471) [-1061.361] (-1059.326) (-1066.594) * (-1064.260) (-1061.463) [-1064.333] (-1066.100) -- 0:00:45
      864500 -- [-1059.148] (-1064.922) (-1059.674) (-1079.236) * (-1065.902) [-1051.570] (-1065.468) (-1069.932) -- 0:00:44
      865000 -- (-1065.294) (-1049.355) [-1052.001] (-1070.702) * (-1068.122) [-1056.401] (-1071.200) (-1067.422) -- 0:00:44

      Average standard deviation of split frequencies: 0.006113

      865500 -- (-1060.845) (-1065.679) [-1064.799] (-1067.078) * (-1064.369) (-1060.550) [-1068.221] (-1051.054) -- 0:00:44
      866000 -- (-1073.392) (-1060.802) (-1063.877) [-1054.271] * (-1063.095) [-1054.566] (-1070.498) (-1061.110) -- 0:00:44
      866500 -- (-1072.526) (-1071.590) (-1067.480) [-1055.851] * (-1064.709) [-1053.310] (-1062.008) (-1057.753) -- 0:00:44
      867000 -- (-1073.889) (-1057.348) [-1062.302] (-1087.120) * (-1068.600) (-1063.212) [-1060.430] (-1067.020) -- 0:00:44
      867500 -- (-1072.482) [-1054.049] (-1062.045) (-1057.340) * (-1058.343) [-1055.674] (-1062.384) (-1071.601) -- 0:00:43
      868000 -- (-1060.271) [-1049.504] (-1078.135) (-1057.691) * (-1074.002) [-1060.217] (-1074.864) (-1059.335) -- 0:00:43
      868500 -- (-1058.192) (-1070.308) (-1060.788) [-1058.801] * (-1060.735) (-1058.853) (-1076.130) [-1058.532] -- 0:00:43
      869000 -- (-1061.216) (-1072.092) (-1062.643) [-1053.973] * (-1066.377) (-1074.839) [-1048.241] (-1066.036) -- 0:00:43
      869500 -- (-1073.118) [-1063.642] (-1063.948) (-1058.644) * [-1065.046] (-1068.598) (-1055.431) (-1068.727) -- 0:00:43
      870000 -- (-1072.574) [-1061.899] (-1062.266) (-1074.617) * (-1066.877) (-1073.942) (-1055.163) [-1061.129] -- 0:00:43

      Average standard deviation of split frequencies: 0.005956

      870500 -- [-1051.947] (-1071.152) (-1071.302) (-1051.850) * (-1056.960) (-1059.742) (-1064.956) [-1058.938] -- 0:00:42
      871000 -- [-1059.094] (-1061.914) (-1051.591) (-1065.736) * (-1057.452) (-1068.507) [-1057.598] (-1053.232) -- 0:00:42
      871500 -- (-1056.638) (-1069.723) [-1058.085] (-1056.586) * (-1056.910) (-1054.918) (-1052.636) [-1051.759] -- 0:00:42
      872000 -- [-1053.056] (-1069.118) (-1055.573) (-1073.349) * (-1051.387) (-1083.097) (-1058.877) [-1058.773] -- 0:00:42
      872500 -- (-1058.350) (-1069.481) [-1049.519] (-1064.800) * [-1055.451] (-1063.952) (-1073.422) (-1068.441) -- 0:00:42
      873000 -- (-1052.495) (-1067.042) [-1044.333] (-1064.294) * (-1065.929) [-1060.341] (-1058.153) (-1067.796) -- 0:00:42
      873500 -- [-1052.969] (-1062.846) (-1055.038) (-1062.639) * (-1060.535) (-1071.751) [-1063.821] (-1082.404) -- 0:00:41
      874000 -- [-1055.162] (-1062.220) (-1064.895) (-1061.822) * (-1064.498) (-1061.705) [-1063.331] (-1062.545) -- 0:00:41
      874500 -- (-1065.642) (-1068.837) (-1061.406) [-1058.374] * [-1060.672] (-1061.992) (-1061.697) (-1067.321) -- 0:00:41
      875000 -- (-1063.156) (-1069.531) [-1056.471] (-1061.789) * (-1066.091) (-1063.389) (-1081.064) [-1050.135] -- 0:00:41

      Average standard deviation of split frequencies: 0.005340

      875500 -- (-1058.111) (-1063.190) [-1070.419] (-1058.663) * (-1058.511) [-1057.209] (-1053.421) (-1063.269) -- 0:00:41
      876000 -- (-1063.321) [-1065.808] (-1057.715) (-1068.656) * (-1059.693) [-1058.716] (-1059.280) (-1070.352) -- 0:00:41
      876500 -- (-1070.561) (-1059.230) (-1061.850) [-1062.154] * (-1055.517) (-1062.046) [-1054.600] (-1060.334) -- 0:00:41
      877000 -- [-1061.972] (-1061.488) (-1064.345) (-1066.015) * [-1055.808] (-1067.246) (-1069.525) (-1056.687) -- 0:00:40
      877500 -- (-1061.626) (-1069.649) (-1078.885) [-1049.326] * (-1057.645) [-1070.301] (-1065.481) (-1059.186) -- 0:00:40
      878000 -- (-1062.621) (-1068.861) (-1049.474) [-1054.248] * [-1058.941] (-1065.533) (-1060.418) (-1051.262) -- 0:00:40
      878500 -- [-1058.555] (-1061.295) (-1073.846) (-1054.757) * (-1064.289) (-1071.854) [-1058.985] (-1063.005) -- 0:00:40
      879000 -- (-1059.203) (-1058.659) (-1067.836) [-1057.567] * (-1053.824) (-1069.980) (-1067.277) [-1065.869] -- 0:00:40
      879500 -- [-1064.612] (-1064.259) (-1069.266) (-1054.015) * (-1057.821) [-1066.274] (-1065.256) (-1068.647) -- 0:00:40
      880000 -- (-1070.343) (-1067.571) (-1061.929) [-1056.856] * (-1055.121) [-1057.316] (-1066.807) (-1057.876) -- 0:00:39

      Average standard deviation of split frequencies: 0.005600

      880500 -- (-1058.211) [-1060.684] (-1078.490) (-1063.112) * [-1060.025] (-1057.679) (-1068.071) (-1056.373) -- 0:00:39
      881000 -- (-1071.598) (-1065.863) (-1060.615) [-1053.779] * (-1052.840) (-1058.834) (-1060.094) [-1048.512] -- 0:00:39
      881500 -- (-1068.561) (-1062.430) [-1054.488] (-1067.888) * (-1075.681) [-1067.215] (-1058.327) (-1055.272) -- 0:00:39
      882000 -- (-1063.856) [-1059.525] (-1061.950) (-1059.448) * (-1071.423) (-1060.294) (-1057.547) [-1071.981] -- 0:00:39
      882500 -- (-1076.799) (-1059.963) [-1060.591] (-1063.715) * (-1061.276) (-1064.047) (-1065.589) [-1061.241] -- 0:00:39
      883000 -- (-1077.364) (-1058.470) (-1058.270) [-1056.839] * (-1068.062) (-1062.144) (-1068.718) [-1053.753] -- 0:00:38
      883500 -- (-1067.788) (-1063.324) [-1051.776] (-1061.835) * [-1064.528] (-1069.402) (-1065.925) (-1061.612) -- 0:00:38
      884000 -- (-1069.667) (-1062.687) (-1051.700) [-1068.188] * (-1065.021) (-1075.251) (-1057.768) [-1056.586] -- 0:00:38
      884500 -- (-1079.890) (-1069.645) [-1057.297] (-1063.118) * (-1068.517) [-1056.188] (-1060.671) (-1059.162) -- 0:00:38
      885000 -- (-1065.896) (-1068.178) [-1056.847] (-1073.240) * (-1067.635) (-1067.483) [-1050.356] (-1060.883) -- 0:00:38

      Average standard deviation of split frequencies: 0.005566

      885500 -- [-1061.134] (-1067.992) (-1065.619) (-1073.915) * (-1060.058) (-1076.776) [-1063.399] (-1056.710) -- 0:00:38
      886000 -- (-1055.111) (-1056.546) [-1059.796] (-1068.404) * [-1054.976] (-1078.221) (-1060.883) (-1058.321) -- 0:00:37
      886500 -- (-1058.242) (-1067.880) [-1049.529] (-1057.640) * (-1056.326) [-1074.921] (-1066.892) (-1066.325) -- 0:00:37
      887000 -- (-1063.182) (-1059.402) (-1065.131) [-1057.962] * (-1063.681) (-1061.315) [-1060.475] (-1063.853) -- 0:00:37
      887500 -- (-1057.876) (-1064.640) [-1055.328] (-1066.048) * (-1063.144) (-1060.163) [-1055.061] (-1053.521) -- 0:00:37
      888000 -- (-1058.166) (-1075.093) [-1049.600] (-1084.784) * (-1080.639) (-1059.093) (-1054.191) [-1060.140] -- 0:00:37
      888500 -- [-1059.360] (-1060.483) (-1072.892) (-1061.462) * (-1060.039) [-1063.425] (-1063.399) (-1060.869) -- 0:00:37
      889000 -- (-1069.987) [-1061.000] (-1073.803) (-1067.491) * [-1059.589] (-1060.526) (-1062.886) (-1078.032) -- 0:00:36
      889500 -- (-1077.932) (-1069.595) (-1057.483) [-1066.394] * (-1068.605) (-1056.021) [-1051.524] (-1061.609) -- 0:00:36
      890000 -- (-1064.144) [-1051.116] (-1065.059) (-1071.535) * [-1054.779] (-1054.316) (-1066.833) (-1072.379) -- 0:00:36

      Average standard deviation of split frequencies: 0.006066

      890500 -- [-1054.911] (-1061.105) (-1057.713) (-1063.659) * [-1066.339] (-1065.838) (-1066.791) (-1062.837) -- 0:00:36
      891000 -- (-1066.832) [-1052.532] (-1063.411) (-1072.957) * (-1067.918) (-1057.548) (-1066.621) [-1058.809] -- 0:00:36
      891500 -- (-1062.161) [-1067.701] (-1068.345) (-1057.518) * [-1064.963] (-1072.626) (-1060.624) (-1060.245) -- 0:00:36
      892000 -- (-1065.351) (-1069.585) [-1055.364] (-1053.268) * (-1062.856) [-1060.433] (-1070.924) (-1057.424) -- 0:00:35
      892500 -- (-1059.312) [-1066.527] (-1052.455) (-1058.469) * (-1066.802) [-1057.517] (-1065.505) (-1063.813) -- 0:00:35
      893000 -- (-1067.099) [-1054.016] (-1080.237) (-1053.976) * (-1082.191) (-1066.235) (-1054.958) [-1054.536] -- 0:00:35
      893500 -- [-1055.989] (-1062.561) (-1072.433) (-1070.983) * (-1060.449) (-1073.537) (-1061.186) [-1062.850] -- 0:00:35
      894000 -- [-1055.848] (-1073.781) (-1069.612) (-1075.562) * [-1054.217] (-1057.672) (-1063.835) (-1062.747) -- 0:00:35
      894500 -- [-1058.409] (-1064.819) (-1066.621) (-1071.561) * (-1059.544) (-1065.544) (-1059.898) [-1055.581] -- 0:00:35
      895000 -- (-1060.752) [-1059.545] (-1065.215) (-1066.895) * (-1057.195) (-1064.719) (-1065.297) [-1051.733] -- 0:00:34

      Average standard deviation of split frequencies: 0.006192

      895500 -- (-1062.126) [-1061.491] (-1053.753) (-1070.045) * (-1051.480) [-1052.301] (-1072.764) (-1062.341) -- 0:00:34
      896000 -- (-1062.497) (-1077.884) (-1060.244) [-1061.347] * (-1075.021) (-1073.116) [-1065.363] (-1057.046) -- 0:00:34
      896500 -- [-1059.196] (-1055.804) (-1063.844) (-1054.285) * (-1066.001) (-1061.593) (-1062.434) [-1057.807] -- 0:00:34
      897000 -- (-1052.823) (-1073.073) (-1057.692) [-1056.792] * (-1060.614) (-1071.414) [-1068.967] (-1055.389) -- 0:00:34
      897500 -- (-1058.890) (-1060.713) [-1053.694] (-1056.619) * (-1075.782) (-1075.099) [-1053.896] (-1070.222) -- 0:00:34
      898000 -- (-1064.922) (-1058.278) (-1063.828) [-1052.893] * (-1073.566) (-1057.029) (-1056.909) [-1050.197] -- 0:00:33
      898500 -- [-1063.628] (-1065.860) (-1059.923) (-1065.974) * (-1062.534) (-1047.387) [-1051.582] (-1061.507) -- 0:00:33
      899000 -- (-1066.112) (-1066.052) [-1059.603] (-1059.699) * [-1058.049] (-1057.781) (-1064.141) (-1064.032) -- 0:00:33
      899500 -- (-1066.638) (-1056.164) [-1059.283] (-1048.095) * (-1061.898) [-1059.872] (-1060.067) (-1066.211) -- 0:00:33
      900000 -- (-1065.687) [-1058.394] (-1064.798) (-1054.940) * [-1055.187] (-1065.656) (-1071.365) (-1055.916) -- 0:00:33

      Average standard deviation of split frequencies: 0.006563

      900500 -- (-1064.583) (-1057.230) (-1061.603) [-1052.888] * (-1069.923) [-1061.196] (-1055.062) (-1062.553) -- 0:00:33
      901000 -- [-1067.624] (-1060.360) (-1056.521) (-1063.033) * (-1058.038) (-1073.627) [-1059.409] (-1061.513) -- 0:00:32
      901500 -- (-1070.455) [-1061.175] (-1067.536) (-1051.027) * (-1053.924) (-1066.174) (-1066.484) [-1065.899] -- 0:00:32
      902000 -- (-1081.801) [-1056.154] (-1064.579) (-1053.228) * [-1059.354] (-1062.413) (-1058.639) (-1078.463) -- 0:00:32
      902500 -- (-1059.763) [-1053.326] (-1062.704) (-1065.219) * (-1073.513) (-1067.354) [-1059.218] (-1076.637) -- 0:00:32
      903000 -- (-1073.192) (-1053.728) [-1060.674] (-1076.412) * (-1053.064) (-1069.070) (-1061.118) [-1065.159] -- 0:00:32
      903500 -- (-1073.495) (-1060.611) [-1059.853] (-1081.747) * (-1060.354) (-1055.364) (-1070.859) [-1055.149] -- 0:00:32
      904000 -- (-1068.723) (-1059.698) [-1052.028] (-1065.490) * (-1054.836) (-1065.565) (-1076.782) [-1059.209] -- 0:00:31
      904500 -- (-1063.115) (-1070.787) [-1059.115] (-1068.315) * (-1064.920) [-1062.198] (-1057.969) (-1067.297) -- 0:00:31
      905000 -- (-1060.448) (-1056.629) [-1051.246] (-1068.892) * (-1062.875) [-1058.420] (-1067.604) (-1066.084) -- 0:00:31

      Average standard deviation of split frequencies: 0.006284

      905500 -- (-1070.328) (-1069.654) [-1066.339] (-1051.313) * [-1062.225] (-1063.781) (-1059.419) (-1060.856) -- 0:00:31
      906000 -- (-1065.200) (-1072.314) [-1057.904] (-1067.059) * (-1070.838) (-1068.147) [-1062.051] (-1064.538) -- 0:00:31
      906500 -- (-1061.928) [-1056.640] (-1060.495) (-1059.782) * (-1065.706) (-1066.827) (-1058.025) [-1061.239] -- 0:00:31
      907000 -- (-1070.762) [-1058.013] (-1056.948) (-1062.806) * (-1061.581) (-1073.124) [-1052.119] (-1058.151) -- 0:00:30
      907500 -- (-1075.758) (-1055.679) [-1057.963] (-1061.163) * (-1077.048) (-1070.326) (-1061.354) [-1051.368] -- 0:00:30
      908000 -- [-1054.260] (-1071.600) (-1068.365) (-1061.213) * (-1076.421) [-1066.688] (-1068.078) (-1050.132) -- 0:00:30
      908500 -- (-1051.648) [-1055.387] (-1070.135) (-1052.236) * (-1079.506) (-1069.282) [-1061.800] (-1057.055) -- 0:00:30
      909000 -- (-1061.634) [-1052.380] (-1067.161) (-1056.762) * (-1061.571) (-1074.113) [-1064.534] (-1060.456) -- 0:00:30
      909500 -- (-1056.813) [-1066.348] (-1065.051) (-1063.031) * (-1071.124) (-1056.206) (-1063.766) [-1065.908] -- 0:00:30
      910000 -- (-1068.850) (-1061.268) (-1079.208) [-1056.528] * [-1057.838] (-1056.552) (-1053.521) (-1068.559) -- 0:00:29

      Average standard deviation of split frequencies: 0.005973

      910500 -- [-1055.119] (-1090.146) (-1079.264) (-1065.923) * (-1060.614) [-1054.882] (-1067.950) (-1061.859) -- 0:00:29
      911000 -- [-1049.796] (-1073.678) (-1060.758) (-1060.024) * (-1080.438) (-1063.322) (-1090.796) [-1060.103] -- 0:00:29
      911500 -- (-1055.857) (-1057.910) (-1073.933) [-1056.612] * (-1075.922) (-1065.664) (-1066.468) [-1060.709] -- 0:00:29
      912000 -- (-1064.446) (-1068.781) (-1090.577) [-1056.209] * [-1070.828] (-1060.891) (-1055.960) (-1068.116) -- 0:00:29
      912500 -- (-1075.222) [-1068.217] (-1056.355) (-1064.947) * (-1052.782) (-1057.500) [-1059.106] (-1064.915) -- 0:00:29
      913000 -- (-1066.720) (-1063.770) (-1084.794) [-1080.157] * (-1055.757) (-1053.971) [-1059.225] (-1069.424) -- 0:00:28
      913500 -- [-1059.509] (-1072.691) (-1081.750) (-1068.751) * (-1073.836) [-1059.620] (-1063.867) (-1065.974) -- 0:00:28
      914000 -- (-1054.854) [-1065.734] (-1073.562) (-1093.928) * [-1058.395] (-1066.841) (-1064.129) (-1058.708) -- 0:00:28
      914500 -- [-1061.359] (-1062.538) (-1062.528) (-1070.554) * [-1063.719] (-1068.018) (-1065.787) (-1056.706) -- 0:00:28
      915000 -- (-1061.863) (-1053.879) [-1061.059] (-1068.194) * (-1063.314) (-1084.937) (-1062.137) [-1055.689] -- 0:00:28

      Average standard deviation of split frequencies: 0.006136

      915500 -- (-1063.923) [-1051.204] (-1062.315) (-1058.200) * (-1068.848) (-1058.364) (-1058.415) [-1051.202] -- 0:00:28
      916000 -- (-1056.557) [-1053.367] (-1065.869) (-1066.947) * (-1085.445) (-1080.871) (-1066.499) [-1056.885] -- 0:00:27
      916500 -- (-1049.443) (-1056.342) (-1066.556) [-1066.712] * (-1062.590) (-1075.495) (-1056.463) [-1048.742] -- 0:00:27
      917000 -- [-1062.386] (-1068.857) (-1061.248) (-1059.798) * (-1056.654) (-1059.151) (-1064.278) [-1057.081] -- 0:00:27
      917500 -- [-1067.969] (-1052.796) (-1059.708) (-1066.611) * (-1075.141) [-1059.257] (-1062.642) (-1056.654) -- 0:00:27
      918000 -- (-1066.749) [-1054.065] (-1068.941) (-1065.287) * [-1051.367] (-1058.952) (-1056.529) (-1062.001) -- 0:00:27
      918500 -- (-1066.962) (-1057.663) [-1066.382] (-1063.108) * [-1072.177] (-1061.907) (-1065.140) (-1068.636) -- 0:00:27
      919000 -- (-1059.825) (-1066.404) [-1054.695] (-1078.791) * (-1059.638) (-1062.856) (-1064.185) [-1050.928] -- 0:00:26
      919500 -- (-1058.805) (-1066.281) [-1059.714] (-1061.769) * (-1071.956) (-1061.224) [-1063.896] (-1066.012) -- 0:00:26
      920000 -- (-1062.957) (-1066.977) [-1053.294] (-1071.234) * (-1063.140) (-1063.170) (-1070.946) [-1058.234] -- 0:00:26

      Average standard deviation of split frequencies: 0.005317

      920500 -- (-1053.747) (-1064.870) (-1062.742) [-1050.648] * (-1067.257) (-1063.596) [-1061.026] (-1066.319) -- 0:00:26
      921000 -- [-1060.592] (-1057.677) (-1060.478) (-1061.983) * (-1064.826) (-1073.434) (-1066.915) [-1063.333] -- 0:00:26
      921500 -- (-1057.579) [-1055.074] (-1063.002) (-1081.124) * (-1057.305) (-1055.948) [-1062.668] (-1064.367) -- 0:00:26
      922000 -- (-1060.582) (-1051.801) [-1058.070] (-1066.614) * (-1058.072) [-1058.922] (-1063.634) (-1067.278) -- 0:00:25
      922500 -- (-1059.894) (-1059.712) [-1062.294] (-1069.515) * (-1070.840) (-1061.933) (-1057.395) [-1059.038] -- 0:00:25
      923000 -- [-1064.973] (-1068.960) (-1061.467) (-1073.718) * (-1080.209) [-1056.730] (-1067.553) (-1069.261) -- 0:00:25
      923500 -- (-1083.580) (-1064.032) [-1054.409] (-1056.684) * (-1072.304) [-1060.444] (-1069.262) (-1066.008) -- 0:00:25
      924000 -- (-1077.188) [-1052.064] (-1054.016) (-1069.186) * (-1060.790) (-1062.124) [-1068.993] (-1072.143) -- 0:00:25
      924500 -- (-1068.103) (-1068.579) [-1058.325] (-1071.341) * (-1058.683) (-1065.043) [-1067.665] (-1050.292) -- 0:00:25
      925000 -- (-1071.151) [-1051.296] (-1073.636) (-1079.084) * (-1052.409) (-1069.450) (-1058.377) [-1060.614] -- 0:00:24

      Average standard deviation of split frequencies: 0.005326

      925500 -- (-1065.889) [-1055.187] (-1064.389) (-1059.855) * (-1064.409) [-1061.736] (-1065.068) (-1066.142) -- 0:00:24
      926000 -- (-1073.687) [-1052.521] (-1062.792) (-1055.190) * (-1070.278) [-1056.458] (-1061.128) (-1074.259) -- 0:00:24
      926500 -- (-1067.314) (-1068.549) [-1057.996] (-1065.982) * (-1061.209) (-1073.442) [-1059.174] (-1071.616) -- 0:00:24
      927000 -- (-1087.815) (-1058.599) [-1064.613] (-1057.274) * (-1060.212) (-1058.581) [-1056.435] (-1074.492) -- 0:00:24
      927500 -- (-1070.947) (-1059.623) [-1047.322] (-1065.841) * [-1063.050] (-1083.389) (-1064.646) (-1060.285) -- 0:00:24
      928000 -- [-1056.206] (-1066.520) (-1064.567) (-1056.820) * (-1064.321) (-1063.987) (-1057.521) [-1056.634] -- 0:00:23
      928500 -- [-1058.420] (-1065.874) (-1051.478) (-1061.607) * (-1076.431) (-1072.237) (-1051.926) [-1053.669] -- 0:00:23
      929000 -- [-1053.978] (-1075.215) (-1066.770) (-1065.889) * (-1062.028) [-1072.464] (-1053.385) (-1063.526) -- 0:00:23
      929500 -- (-1066.904) (-1072.968) [-1063.202] (-1053.148) * (-1054.507) (-1074.042) [-1060.329] (-1062.169) -- 0:00:23
      930000 -- [-1060.812] (-1063.058) (-1062.599) (-1057.650) * (-1067.323) [-1059.465] (-1067.577) (-1067.395) -- 0:00:23

      Average standard deviation of split frequencies: 0.004948

      930500 -- (-1063.455) (-1059.059) (-1067.392) [-1061.359] * [-1049.919] (-1064.245) (-1056.727) (-1068.223) -- 0:00:23
      931000 -- (-1060.566) (-1053.507) [-1050.302] (-1073.548) * [-1052.909] (-1050.016) (-1065.034) (-1058.637) -- 0:00:22
      931500 -- (-1053.727) [-1057.732] (-1067.205) (-1061.027) * [-1055.345] (-1071.005) (-1064.256) (-1062.378) -- 0:00:22
      932000 -- (-1069.042) (-1053.138) [-1057.209] (-1057.867) * [-1058.259] (-1085.618) (-1051.305) (-1054.456) -- 0:00:22
      932500 -- (-1064.177) [-1058.695] (-1057.789) (-1054.622) * (-1069.977) (-1065.646) [-1059.868] (-1064.947) -- 0:00:22
      933000 -- (-1064.761) [-1054.576] (-1062.285) (-1053.794) * (-1067.287) [-1049.524] (-1062.733) (-1052.088) -- 0:00:22
      933500 -- (-1054.384) (-1058.470) [-1063.815] (-1057.260) * [-1052.089] (-1060.652) (-1069.452) (-1073.035) -- 0:00:22
      934000 -- [-1068.374] (-1064.343) (-1060.782) (-1061.081) * (-1068.853) [-1066.416] (-1057.592) (-1061.862) -- 0:00:21
      934500 -- (-1058.657) [-1066.033] (-1075.562) (-1062.423) * (-1065.969) (-1066.169) (-1069.626) [-1058.018] -- 0:00:21
      935000 -- (-1060.411) [-1054.174] (-1070.832) (-1066.085) * (-1066.194) [-1058.305] (-1070.577) (-1069.055) -- 0:00:21

      Average standard deviation of split frequencies: 0.005308

      935500 -- (-1054.931) (-1067.836) (-1070.602) [-1060.836] * (-1087.504) (-1056.699) (-1065.842) [-1052.513] -- 0:00:21
      936000 -- (-1065.346) (-1068.075) [-1064.138] (-1061.533) * (-1065.387) (-1054.102) (-1065.335) [-1065.574] -- 0:00:21
      936500 -- [-1055.354] (-1061.344) (-1070.119) (-1060.258) * [-1053.801] (-1053.697) (-1068.050) (-1072.365) -- 0:00:21
      937000 -- (-1066.355) [-1060.476] (-1076.025) (-1068.311) * (-1063.980) (-1063.049) [-1063.002] (-1068.014) -- 0:00:20
      937500 -- [-1057.416] (-1066.723) (-1058.067) (-1074.246) * [-1071.507] (-1065.473) (-1077.611) (-1064.613) -- 0:00:20
      938000 -- (-1071.216) (-1071.697) (-1064.007) [-1056.045] * [-1068.512] (-1060.570) (-1067.362) (-1063.921) -- 0:00:20
      938500 -- (-1069.339) [-1057.601] (-1062.023) (-1054.696) * [-1059.262] (-1069.876) (-1057.928) (-1050.930) -- 0:00:20
      939000 -- (-1059.688) (-1055.193) (-1063.985) [-1052.802] * [-1062.812] (-1054.007) (-1062.912) (-1057.880) -- 0:00:20
      939500 -- (-1057.192) (-1064.907) (-1067.680) [-1060.538] * (-1062.855) (-1063.240) [-1062.088] (-1051.777) -- 0:00:20
      940000 -- (-1055.350) (-1071.725) (-1072.287) [-1068.831] * (-1076.493) [-1056.318] (-1063.942) (-1064.683) -- 0:00:19

      Average standard deviation of split frequencies: 0.004934

      940500 -- [-1058.922] (-1063.474) (-1078.234) (-1055.643) * (-1060.485) (-1069.982) (-1064.261) [-1057.150] -- 0:00:19
      941000 -- (-1063.825) [-1065.454] (-1070.414) (-1076.649) * (-1057.882) [-1064.740] (-1067.522) (-1055.223) -- 0:00:19
      941500 -- (-1050.865) (-1060.127) [-1071.720] (-1074.236) * [-1061.413] (-1073.837) (-1060.814) (-1068.011) -- 0:00:19
      942000 -- (-1054.013) [-1054.139] (-1069.692) (-1058.379) * (-1071.519) (-1068.312) (-1068.592) [-1057.374] -- 0:00:19
      942500 -- [-1049.705] (-1054.161) (-1053.757) (-1058.596) * (-1062.072) (-1065.933) (-1064.869) [-1053.855] -- 0:00:19
      943000 -- [-1056.287] (-1065.200) (-1061.681) (-1058.256) * [-1051.870] (-1060.235) (-1060.327) (-1069.548) -- 0:00:18
      943500 -- [-1057.190] (-1084.563) (-1063.068) (-1056.318) * (-1071.167) (-1054.783) [-1056.670] (-1069.529) -- 0:00:18
      944000 -- (-1062.352) (-1070.626) (-1060.110) [-1048.678] * (-1062.693) (-1069.722) (-1065.613) [-1054.672] -- 0:00:18
      944500 -- (-1069.764) [-1057.135] (-1061.729) (-1052.189) * (-1067.588) (-1061.929) [-1053.853] (-1051.499) -- 0:00:18
      945000 -- (-1060.474) (-1054.695) (-1060.601) [-1051.173] * (-1058.018) (-1063.168) (-1068.077) [-1052.903] -- 0:00:18

      Average standard deviation of split frequencies: 0.005098

      945500 -- (-1067.110) (-1065.156) (-1063.272) [-1050.181] * (-1071.642) [-1054.800] (-1063.780) (-1063.068) -- 0:00:18
      946000 -- [-1053.100] (-1064.956) (-1067.389) (-1050.760) * (-1068.092) (-1052.124) [-1060.151] (-1064.341) -- 0:00:17
      946500 -- (-1066.165) (-1075.752) (-1046.577) [-1056.802] * (-1075.124) (-1062.305) (-1064.107) [-1056.846] -- 0:00:17
      947000 -- (-1060.551) (-1054.446) [-1051.635] (-1066.367) * (-1058.172) (-1059.539) [-1048.731] (-1062.098) -- 0:00:17
      947500 -- (-1075.029) [-1049.955] (-1069.550) (-1057.584) * (-1068.117) (-1059.974) (-1072.573) [-1061.206] -- 0:00:17
      948000 -- (-1059.342) (-1052.277) (-1060.916) [-1055.714] * (-1064.910) (-1061.348) [-1055.358] (-1067.840) -- 0:00:17
      948500 -- (-1071.041) (-1066.499) (-1053.396) [-1054.732] * (-1067.886) (-1084.935) (-1050.954) [-1057.179] -- 0:00:17
      949000 -- [-1060.577] (-1067.098) (-1062.167) (-1082.953) * [-1055.021] (-1068.771) (-1062.255) (-1058.679) -- 0:00:16
      949500 -- (-1050.984) [-1054.015] (-1077.110) (-1069.865) * (-1064.264) (-1055.596) (-1059.365) [-1060.458] -- 0:00:16
      950000 -- (-1054.604) [-1056.119] (-1064.317) (-1056.570) * (-1073.731) [-1066.529] (-1058.967) (-1060.918) -- 0:00:16

      Average standard deviation of split frequencies: 0.005378

      950500 -- (-1050.635) (-1076.277) [-1047.402] (-1073.645) * (-1068.109) (-1058.739) (-1066.963) [-1066.177] -- 0:00:16
      951000 -- (-1058.615) (-1068.761) [-1050.638] (-1078.571) * (-1071.716) (-1069.766) (-1058.706) [-1057.294] -- 0:00:16
      951500 -- (-1062.064) (-1065.859) [-1059.618] (-1073.206) * [-1057.835] (-1061.712) (-1066.737) (-1069.335) -- 0:00:16
      952000 -- [-1068.729] (-1071.567) (-1070.471) (-1068.689) * (-1060.640) (-1062.199) [-1049.192] (-1070.615) -- 0:00:15
      952500 -- (-1058.985) (-1066.857) (-1062.416) [-1052.980] * (-1062.682) (-1058.447) [-1056.702] (-1070.519) -- 0:00:15
      953000 -- (-1064.867) (-1067.283) [-1061.106] (-1059.496) * (-1059.801) (-1057.792) (-1064.781) [-1053.691] -- 0:00:15
      953500 -- (-1077.569) (-1056.021) (-1064.872) [-1058.260] * [-1057.471] (-1060.145) (-1056.391) (-1072.451) -- 0:00:15
      954000 -- (-1073.951) (-1061.165) (-1058.522) [-1051.543] * [-1056.372] (-1060.770) (-1060.211) (-1055.481) -- 0:00:15
      954500 -- (-1071.894) (-1067.208) [-1046.985] (-1075.591) * [-1051.422] (-1069.651) (-1076.362) (-1073.633) -- 0:00:15
      955000 -- (-1064.700) [-1054.762] (-1061.060) (-1064.112) * [-1056.986] (-1056.933) (-1063.836) (-1074.923) -- 0:00:14

      Average standard deviation of split frequencies: 0.005386

      955500 -- (-1073.180) (-1058.888) [-1049.065] (-1072.064) * (-1065.640) (-1059.027) [-1059.613] (-1070.237) -- 0:00:14
      956000 -- (-1069.407) [-1053.186] (-1058.749) (-1068.106) * (-1071.221) (-1064.281) (-1066.875) [-1061.705] -- 0:00:14
      956500 -- (-1066.009) (-1057.440) [-1055.452] (-1067.905) * (-1074.812) (-1064.958) (-1064.624) [-1055.757] -- 0:00:14
      957000 -- (-1064.255) (-1054.556) [-1059.657] (-1060.595) * (-1060.303) (-1070.362) [-1062.579] (-1059.420) -- 0:00:14
      957500 -- (-1058.485) [-1066.915] (-1067.838) (-1060.931) * (-1064.955) (-1060.087) (-1070.227) [-1062.545] -- 0:00:14
      958000 -- (-1061.388) [-1057.499] (-1073.735) (-1073.976) * (-1067.919) (-1063.303) (-1052.707) [-1058.120] -- 0:00:13
      958500 -- (-1058.030) (-1062.758) [-1050.257] (-1060.689) * [-1062.712] (-1060.055) (-1058.293) (-1059.915) -- 0:00:13
      959000 -- (-1067.491) [-1053.034] (-1059.159) (-1062.770) * (-1051.231) (-1061.150) (-1063.002) [-1053.915] -- 0:00:13
      959500 -- (-1063.250) (-1056.574) (-1076.892) [-1063.030] * [-1063.432] (-1063.194) (-1065.650) (-1060.133) -- 0:00:13
      960000 -- (-1071.027) (-1071.207) [-1046.559] (-1068.945) * (-1065.970) (-1070.738) (-1067.398) [-1057.126] -- 0:00:13

      Average standard deviation of split frequencies: 0.005662

      960500 -- [-1063.043] (-1062.038) (-1057.942) (-1072.928) * (-1058.247) (-1069.645) [-1068.647] (-1058.556) -- 0:00:13
      961000 -- (-1061.894) [-1054.143] (-1067.067) (-1068.624) * (-1071.079) [-1047.354] (-1059.583) (-1065.167) -- 0:00:12
      961500 -- (-1070.537) [-1056.427] (-1071.734) (-1059.526) * (-1061.872) (-1054.896) (-1053.075) [-1059.095] -- 0:00:12
      962000 -- [-1065.306] (-1063.067) (-1067.024) (-1061.078) * [-1046.931] (-1071.491) (-1060.928) (-1061.787) -- 0:00:12
      962500 -- (-1058.403) [-1049.791] (-1053.762) (-1062.167) * (-1064.711) (-1066.681) [-1059.752] (-1058.064) -- 0:00:12
      963000 -- (-1070.651) (-1058.214) [-1046.468] (-1074.809) * (-1066.076) (-1075.986) (-1059.150) [-1064.580] -- 0:00:12
      963500 -- (-1068.250) (-1055.600) [-1058.216] (-1055.055) * [-1060.938] (-1076.730) (-1067.015) (-1054.039) -- 0:00:12
      964000 -- (-1057.782) (-1068.213) (-1060.170) [-1057.271] * (-1063.707) (-1081.245) (-1072.261) [-1060.551] -- 0:00:11
      964500 -- [-1062.021] (-1071.928) (-1062.354) (-1065.681) * (-1060.068) [-1051.735] (-1072.077) (-1061.979) -- 0:00:11
      965000 -- [-1062.007] (-1053.917) (-1065.211) (-1060.838) * [-1061.106] (-1061.503) (-1078.368) (-1063.931) -- 0:00:11

      Average standard deviation of split frequencies: 0.005969

      965500 -- (-1067.582) (-1063.691) [-1060.165] (-1057.577) * [-1068.579] (-1061.736) (-1072.372) (-1050.536) -- 0:00:11
      966000 -- (-1058.271) (-1080.385) [-1056.933] (-1061.616) * [-1058.185] (-1064.452) (-1054.858) (-1066.158) -- 0:00:11
      966500 -- [-1062.617] (-1059.736) (-1059.448) (-1063.506) * [-1064.591] (-1052.478) (-1067.466) (-1054.768) -- 0:00:11
      967000 -- (-1055.495) (-1055.343) [-1056.378] (-1070.008) * (-1059.076) (-1055.674) (-1069.576) [-1055.851] -- 0:00:10
      967500 -- (-1077.638) (-1063.136) [-1052.738] (-1076.131) * (-1063.609) (-1055.642) [-1057.534] (-1065.758) -- 0:00:10
      968000 -- (-1056.707) (-1057.544) [-1057.821] (-1056.044) * (-1067.405) (-1069.604) (-1053.225) [-1047.804] -- 0:00:10
      968500 -- [-1057.409] (-1047.920) (-1065.751) (-1063.353) * (-1061.744) (-1077.148) (-1054.193) [-1056.723] -- 0:00:10
      969000 -- (-1074.947) (-1064.662) [-1054.854] (-1049.024) * (-1055.673) (-1078.596) [-1050.719] (-1058.252) -- 0:00:10
      969500 -- [-1058.101] (-1061.952) (-1082.434) (-1070.834) * [-1057.557] (-1076.287) (-1063.917) (-1064.685) -- 0:00:10
      970000 -- (-1057.820) [-1062.700] (-1066.273) (-1058.141) * (-1057.646) [-1056.696] (-1059.451) (-1071.390) -- 0:00:09

      Average standard deviation of split frequencies: 0.006164

      970500 -- (-1066.693) (-1065.755) (-1075.362) [-1055.974] * (-1061.282) [-1055.272] (-1062.984) (-1065.445) -- 0:00:09
      971000 -- [-1053.412] (-1070.519) (-1069.850) (-1058.093) * (-1066.703) (-1061.215) [-1052.314] (-1060.998) -- 0:00:09
      971500 -- (-1077.307) (-1062.674) (-1062.694) [-1060.071] * (-1069.297) [-1054.286] (-1060.170) (-1057.774) -- 0:00:09
      972000 -- [-1063.006] (-1068.326) (-1071.463) (-1077.984) * (-1071.060) [-1053.307] (-1055.434) (-1051.970) -- 0:00:09
      972500 -- [-1051.422] (-1081.344) (-1067.229) (-1077.653) * (-1075.848) [-1050.902] (-1074.125) (-1070.337) -- 0:00:09
      973000 -- [-1054.397] (-1072.816) (-1055.815) (-1067.975) * (-1068.932) [-1066.095] (-1056.828) (-1054.004) -- 0:00:08
      973500 -- [-1064.432] (-1063.538) (-1074.106) (-1067.987) * (-1063.747) (-1067.174) (-1076.554) [-1063.741] -- 0:00:08
      974000 -- [-1056.892] (-1064.131) (-1061.935) (-1072.064) * (-1064.239) (-1068.951) [-1053.778] (-1070.311) -- 0:00:08
      974500 -- (-1068.728) (-1057.727) [-1062.571] (-1064.798) * (-1066.894) [-1050.213] (-1061.131) (-1068.276) -- 0:00:08
      975000 -- (-1069.865) [-1053.364] (-1064.928) (-1062.658) * (-1071.153) (-1070.494) [-1055.524] (-1060.121) -- 0:00:08

      Average standard deviation of split frequencies: 0.006390

      975500 -- (-1061.766) (-1072.083) [-1066.157] (-1067.986) * (-1060.811) (-1062.523) (-1060.442) [-1058.432] -- 0:00:08
      976000 -- (-1054.904) (-1058.622) (-1068.441) [-1063.545] * (-1058.657) (-1067.776) (-1064.387) [-1061.167] -- 0:00:07
      976500 -- (-1058.356) [-1073.938] (-1078.340) (-1060.606) * (-1066.148) (-1073.609) [-1057.974] (-1060.935) -- 0:00:07
      977000 -- [-1052.405] (-1068.420) (-1067.888) (-1064.585) * (-1065.216) (-1070.998) [-1048.554] (-1067.694) -- 0:00:07
      977500 -- (-1051.677) (-1074.629) [-1061.055] (-1074.158) * [-1052.819] (-1075.810) (-1075.896) (-1057.702) -- 0:00:07
      978000 -- [-1058.255] (-1049.554) (-1055.137) (-1062.215) * (-1068.617) (-1069.384) (-1073.711) [-1061.046] -- 0:00:07
      978500 -- (-1067.315) (-1069.885) (-1066.205) [-1055.164] * [-1058.319] (-1062.437) (-1063.570) (-1058.523) -- 0:00:07
      979000 -- (-1073.359) (-1073.972) [-1058.241] (-1074.946) * (-1059.107) (-1062.409) (-1065.859) [-1055.755] -- 0:00:06
      979500 -- (-1080.037) [-1060.107] (-1066.485) (-1077.772) * (-1069.750) [-1057.536] (-1071.635) (-1066.016) -- 0:00:06
      980000 -- (-1076.310) (-1063.200) [-1055.744] (-1085.994) * (-1064.417) (-1071.253) [-1060.175] (-1067.331) -- 0:00:06

      Average standard deviation of split frequencies: 0.006619

      980500 -- (-1067.847) (-1057.638) [-1060.161] (-1072.568) * (-1059.619) (-1071.328) (-1067.896) [-1050.722] -- 0:00:06
      981000 -- (-1074.358) [-1057.341] (-1046.638) (-1075.823) * [-1049.353] (-1071.581) (-1075.506) (-1061.982) -- 0:00:06
      981500 -- [-1056.593] (-1061.979) (-1056.029) (-1071.735) * (-1057.727) (-1054.979) (-1088.148) [-1062.101] -- 0:00:06
      982000 -- [-1051.402] (-1061.781) (-1056.615) (-1067.232) * (-1057.989) (-1070.373) (-1065.512) [-1055.852] -- 0:00:05
      982500 -- [-1059.336] (-1060.486) (-1060.813) (-1063.525) * (-1060.989) (-1076.057) (-1074.392) [-1055.142] -- 0:00:05
      983000 -- [-1048.784] (-1059.353) (-1065.345) (-1081.700) * (-1069.025) (-1067.891) (-1081.473) [-1055.601] -- 0:00:05
      983500 -- (-1072.918) [-1050.154] (-1062.784) (-1075.718) * (-1063.156) [-1063.038] (-1064.526) (-1060.642) -- 0:00:05
      984000 -- [-1054.608] (-1059.548) (-1063.970) (-1062.210) * (-1076.726) (-1077.711) (-1069.699) [-1070.062] -- 0:00:05
      984500 -- [-1062.970] (-1055.798) (-1073.491) (-1067.941) * (-1073.593) (-1072.962) (-1048.817) [-1068.627] -- 0:00:05
      985000 -- (-1057.508) [-1049.922] (-1061.177) (-1063.254) * (-1085.945) (-1065.394) (-1056.010) [-1050.690] -- 0:00:04

      Average standard deviation of split frequencies: 0.006877

      985500 -- (-1063.613) [-1056.311] (-1076.526) (-1066.924) * (-1060.238) (-1057.415) [-1049.739] (-1053.881) -- 0:00:04
      986000 -- (-1060.928) [-1060.061] (-1068.934) (-1064.344) * [-1049.485] (-1065.649) (-1048.026) (-1064.482) -- 0:00:04
      986500 -- [-1054.234] (-1061.094) (-1070.337) (-1062.512) * (-1056.000) (-1061.357) (-1064.547) [-1051.085] -- 0:00:04
      987000 -- (-1077.047) (-1074.328) (-1057.052) [-1065.999] * (-1059.408) (-1053.144) (-1063.942) [-1055.186] -- 0:00:04
      987500 -- [-1051.220] (-1057.731) (-1065.371) (-1067.648) * (-1075.875) [-1051.470] (-1071.878) (-1059.797) -- 0:00:04
      988000 -- (-1050.287) (-1066.729) (-1062.771) [-1063.553] * (-1065.777) (-1057.777) (-1053.507) [-1052.845] -- 0:00:03
      988500 -- (-1061.689) (-1063.612) [-1060.413] (-1072.604) * (-1070.435) (-1072.172) (-1065.251) [-1053.803] -- 0:00:03
      989000 -- [-1050.610] (-1058.936) (-1070.722) (-1064.174) * (-1073.442) (-1051.797) (-1049.249) [-1056.907] -- 0:00:03
      989500 -- (-1062.094) (-1064.932) (-1069.178) [-1058.143] * (-1059.199) (-1061.935) (-1055.957) [-1056.877] -- 0:00:03
      990000 -- (-1055.759) (-1077.647) [-1059.284] (-1063.605) * (-1073.634) [-1066.969] (-1057.495) (-1065.385) -- 0:00:03

      Average standard deviation of split frequencies: 0.006881

      990500 -- (-1087.685) [-1057.162] (-1065.777) (-1055.845) * (-1068.549) (-1065.903) (-1063.843) [-1062.745] -- 0:00:03
      991000 -- (-1070.210) (-1053.236) (-1066.096) [-1068.793] * (-1073.177) (-1062.922) (-1059.344) [-1058.016] -- 0:00:02
      991500 -- (-1065.594) [-1051.325] (-1055.698) (-1071.993) * (-1064.835) (-1076.147) [-1058.396] (-1064.061) -- 0:00:02
      992000 -- (-1049.691) (-1056.829) [-1063.059] (-1069.635) * (-1064.419) (-1069.604) [-1056.217] (-1066.865) -- 0:00:02
      992500 -- (-1066.118) (-1069.313) [-1051.170] (-1070.861) * (-1066.674) (-1060.611) (-1053.698) [-1060.062] -- 0:00:02
      993000 -- (-1055.291) (-1053.032) [-1054.912] (-1068.673) * (-1069.920) (-1052.881) [-1053.977] (-1060.286) -- 0:00:02
      993500 -- (-1059.072) (-1070.386) [-1050.252] (-1068.208) * (-1064.174) (-1057.282) (-1063.866) [-1049.462] -- 0:00:02
      994000 -- (-1058.747) [-1065.050] (-1059.821) (-1065.580) * (-1069.870) (-1051.502) (-1060.489) [-1053.606] -- 0:00:01
      994500 -- [-1060.773] (-1060.552) (-1069.406) (-1062.007) * (-1067.876) [-1051.927] (-1054.845) (-1067.058) -- 0:00:01
      995000 -- [-1057.072] (-1068.638) (-1058.871) (-1069.977) * (-1056.759) [-1064.992] (-1059.529) (-1052.943) -- 0:00:01

      Average standard deviation of split frequencies: 0.006699

      995500 -- (-1069.232) [-1056.795] (-1072.347) (-1061.440) * [-1062.708] (-1069.784) (-1057.349) (-1050.353) -- 0:00:01
      996000 -- (-1065.204) (-1070.366) (-1066.190) [-1051.040] * [-1053.683] (-1072.492) (-1055.797) (-1075.761) -- 0:00:01
      996500 -- (-1069.386) [-1055.912] (-1064.047) (-1058.774) * (-1081.012) [-1065.735] (-1062.334) (-1066.000) -- 0:00:01
      997000 -- (-1082.170) [-1057.517] (-1063.030) (-1053.874) * (-1080.241) [-1054.576] (-1066.115) (-1063.822) -- 0:00:00
      997500 -- (-1074.314) [-1059.246] (-1068.188) (-1055.491) * (-1060.255) [-1056.180] (-1058.618) (-1055.793) -- 0:00:00
      998000 -- (-1070.343) (-1077.985) (-1060.739) [-1060.457] * (-1063.495) [-1051.943] (-1059.201) (-1062.967) -- 0:00:00
      998500 -- (-1063.370) (-1088.305) [-1059.577] (-1055.829) * (-1064.588) (-1070.286) (-1051.837) [-1054.730] -- 0:00:00
      999000 -- [-1060.755] (-1066.792) (-1049.727) (-1068.044) * (-1064.487) (-1059.464) [-1048.219] (-1077.341) -- 0:00:00
      999500 -- (-1058.579) [-1061.788] (-1064.442) (-1063.754) * (-1061.099) [-1053.709] (-1060.657) (-1072.181) -- 0:00:00
      1000000 -- (-1068.214) (-1056.060) (-1076.373) [-1053.925] * (-1078.097) (-1066.169) (-1066.764) [-1057.382] -- 0:00:00

      Average standard deviation of split frequencies: 0.006632
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -1068.214093 -- 29.310489
         Chain 1 -- -1068.214092 -- 29.310489
         Chain 2 -- -1056.059716 -- 25.986488
         Chain 2 -- -1056.059718 -- 25.986488
         Chain 3 -- -1076.373454 -- 25.500307
         Chain 3 -- -1076.373460 -- 25.500307
         Chain 4 -- -1053.925311 -- 25.031564
         Chain 4 -- -1053.925311 -- 25.031564
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -1078.096568 -- 23.238237
         Chain 1 -- -1078.096592 -- 23.238237
         Chain 2 -- -1066.168713 -- 23.607614
         Chain 2 -- -1066.168712 -- 23.607614
         Chain 3 -- -1066.763909 -- 27.711265
         Chain 3 -- -1066.763913 -- 27.711265
         Chain 4 -- -1057.381895 -- 23.537288
         Chain 4 -- -1057.381889 -- 23.537288

      Analysis completed in 5 mins 32 seconds
      Analysis used 331.95 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1040.38
      Likelihood of best state for "cold" chain of run 2 was -1040.39

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            46.6 %     ( 34 %)     Dirichlet(Revmat{all})
            67.3 %     ( 63 %)     Slider(Revmat{all})
            31.3 %     ( 27 %)     Dirichlet(Pi{all})
            32.5 %     ( 27 %)     Slider(Pi{all})
            35.2 %     ( 25 %)     Multiplier(Alpha{1,2})
            47.8 %     ( 28 %)     Multiplier(Alpha{3})
            60.4 %     ( 23 %)     Slider(Pinvar{all})
            51.4 %     ( 50 %)     ExtSPR(Tau{all},V{all})
            18.0 %     ( 16 %)     ExtTBR(Tau{all},V{all})
            52.9 %     ( 48 %)     NNI(Tau{all},V{all})
            46.9 %     ( 44 %)     ParsSPR(Tau{all},V{all})
            27.2 %     ( 30 %)     Multiplier(V{all})
            55.2 %     ( 56 %)     Nodeslider(V{all})
            25.9 %     ( 26 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            45.4 %     ( 32 %)     Dirichlet(Revmat{all})
            67.4 %     ( 51 %)     Slider(Revmat{all})
            31.9 %     ( 24 %)     Dirichlet(Pi{all})
            32.7 %     ( 28 %)     Slider(Pi{all})
            34.5 %     ( 33 %)     Multiplier(Alpha{1,2})
            47.2 %     ( 27 %)     Multiplier(Alpha{3})
            60.6 %     ( 27 %)     Slider(Pinvar{all})
            51.6 %     ( 31 %)     ExtSPR(Tau{all},V{all})
            18.0 %     ( 24 %)     ExtTBR(Tau{all},V{all})
            53.4 %     ( 58 %)     NNI(Tau{all},V{all})
            46.7 %     ( 59 %)     ParsSPR(Tau{all},V{all})
            27.1 %     ( 23 %)     Multiplier(V{all})
            55.4 %     ( 61 %)     Nodeslider(V{all})
            26.0 %     ( 25 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.68    0.42    0.25 
         2 |  166839            0.70    0.45 
         3 |  165801  166828            0.71 
         4 |  166867  167164  166501         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.68    0.42    0.24 
         2 |  166652            0.70    0.45 
         3 |  166487  166704            0.71 
         4 |  167067  166630  166460         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -1055.54
      |             1     1                                        |
      |   2                            1              2 1      1   |
      |        1                          1       2           1  22|
      |        2               2           21   2                  |
      |       1   1       2 2      2  2   2   1 111  1     1    2  |
      |    1    1  1 21          1  2            2 1   2        1 1|
      |2  1 1     2      2    21            2  *          *    2 1 |
      |1     1   2 2   *     2  *   12 2 2   2        11     *2    |
      | 2  2 2          21 21 1    1 1  11          22  21         |
      |         21  21       1        1       2                    |
      |  1    2         1  1     22        1                2      |
      |     2         2                 2           1    2         |
      |                           1                2        1      |
      | 1                                                  2       |
      |  2                                   1                     |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1061.13
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -1050.21         -1075.91
        2      -1050.05         -1072.20
      --------------------------------------
      TOTAL    -1050.13         -1075.25
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.913767    0.026454    0.624029    1.226554    0.898020    940.90   1062.67    1.000
      r(A<->C){all}   0.057728    0.000642    0.013258    0.106729    0.054569    529.66    678.22    1.003
      r(A<->G){all}   0.207911    0.003861    0.102718    0.335829    0.199671    428.35    503.76    1.000
      r(A<->T){all}   0.032969    0.000552    0.000435    0.078369    0.028455    713.64    807.09    1.000
      r(C<->G){all}   0.011547    0.000074    0.000027    0.028464    0.009543   1049.23   1081.38    1.000
      r(C<->T){all}   0.674395    0.005487    0.529492    0.809976    0.680316    407.14    448.06    1.001
      r(G<->T){all}   0.015451    0.000132    0.000007    0.036776    0.012971    644.23    754.25    1.000
      pi(A){all}      0.233651    0.000408    0.195184    0.273377    0.233196   1023.61   1052.37    1.000
      pi(C){all}      0.244033    0.000392    0.204434    0.280834    0.244127   1315.36   1393.43    1.000
      pi(G){all}      0.303099    0.000506    0.259430    0.346529    0.302280   1292.48   1319.86    1.000
      pi(T){all}      0.219217    0.000371    0.181349    0.256908    0.218607   1218.61   1327.43    1.000
      alpha{1,2}      0.120002    0.000877    0.071618    0.186986    0.117182    996.51   1177.06    1.000
      alpha{3}        2.150370    0.632498    0.830984    3.726351    2.011461   1276.47   1299.67    1.000
      pinvar{all}     0.344839    0.007672    0.175451    0.510316    0.349935    941.49   1131.98    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8
      9 -- C9
     10 -- C10
     11 -- C11
     12 -- C12
     13 -- C13
     14 -- C14
     15 -- C15

   Key to taxon bipartitions (saved to file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ---------------------
    1 -- .**************
    2 -- .*.............
    3 -- ..*............
    4 -- ...*...........
    5 -- ....*..........
    6 -- .....*.........
    7 -- ......*........
    8 -- .......*.......
    9 -- ........*......
   10 -- .........*.....
   11 -- ..........*....
   12 -- ...........*...
   13 -- ............*..
   14 -- .............*.
   15 -- ..............*
   16 -- .*......****...
   17 -- ..........**...
   18 -- .*.......*.....
   19 -- ......**.......
   20 -- .*.......***...
   21 -- .*......**.....
   22 -- .....*.......*.
   23 -- ..*...........*
   24 -- ....**.........
   25 -- .*....******...
   26 -- ....*........*.
   27 -- .*......****..*
   28 -- .*......****.*.
   ---------------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
   16  3002    1.000000    0.000000    1.000000    1.000000    2
   17  3002    1.000000    0.000000    1.000000    1.000000    2
   18  2506    0.834777    0.010364    0.827448    0.842105    2
   19  2414    0.804131    0.001884    0.802798    0.805463    2
   20  1962    0.653564    0.016017    0.642239    0.664890    2
   21   781    0.260160    0.000471    0.259827    0.260493    2
   22   722    0.240506    0.001884    0.239174    0.241839    2
   23   719    0.239507    0.006124    0.235177    0.243837    2
   24   643    0.214191    0.007066    0.209194    0.219187    2
   25   619    0.206196    0.020257    0.191872    0.220520    2
   26   531    0.176882    0.006124    0.172552    0.181213    2
   27   376    0.125250    0.013191    0.115923    0.134577    2
   28   326    0.108594    0.002827    0.106596    0.110593    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.009694    0.000053    0.000072    0.023702    0.007854    1.000    2
   length{all}[2]     0.032213    0.000359    0.002264    0.069233    0.028697    1.001    2
   length{all}[3]     0.012894    0.000079    0.000000    0.029624    0.010836    1.000    2
   length{all}[4]     0.015473    0.000088    0.000834    0.032609    0.013625    1.000    2
   length{all}[5]     0.017289    0.000118    0.001006    0.038042    0.014991    1.000    2
   length{all}[6]     0.022711    0.000156    0.003164    0.046309    0.020359    1.000    2
   length{all}[7]     0.015636    0.000104    0.000300    0.035525    0.013494    1.000    2
   length{all}[8]     0.010529    0.000071    0.000007    0.027152    0.008249    1.000    2
   length{all}[9]     0.093316    0.002008    0.012961    0.178396    0.087141    1.000    2
   length{all}[10]    0.053704    0.000533    0.014727    0.098609    0.050070    1.000    2
   length{all}[11]    0.006028    0.000037    0.000008    0.018278    0.004190    1.000    2
   length{all}[12]    0.008760    0.000052    0.000012    0.022918    0.006977    1.000    2
   length{all}[13]    0.021908    0.000142    0.002872    0.044640    0.019692    1.002    2
   length{all}[14]    0.034159    0.000244    0.008157    0.065487    0.031834    1.000    2
   length{all}[15]    0.022466    0.000151    0.000845    0.045808    0.020324    1.000    2
   length{all}[16]    0.259969    0.006530    0.125067    0.429066    0.248791    1.000    2
   length{all}[17]    0.133276    0.002536    0.047444    0.234628    0.126726    1.000    2
   length{all}[18]    0.040412    0.000763    0.000073    0.092727    0.035312    1.000    2
   length{all}[19]    0.014877    0.000099    0.000014    0.033817    0.012835    1.000    2
   length{all}[20]    0.054577    0.001329    0.000082    0.123793    0.047459    1.001    2
   length{all}[21]    0.043272    0.000947    0.000093    0.100824    0.036165    0.999    2
   length{all}[22]    0.010056    0.000070    0.000046    0.026416    0.007818    1.001    2
   length{all}[23]    0.008981    0.000059    0.000031    0.024700    0.006762    0.999    2
   length{all}[24]    0.010334    0.000070    0.000010    0.026765    0.008496    1.001    2
   length{all}[25]    0.011898    0.000090    0.000046    0.029353    0.010136    1.002    2
   length{all}[26]    0.009730    0.000057    0.000086    0.024702    0.008121    0.999    2
   length{all}[27]    0.012191    0.000090    0.000026    0.030813    0.010732    0.997    2
   length{all}[28]    0.015196    0.000181    0.000095    0.044592    0.011511    0.997    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.006632
       Maximum standard deviation of split frequencies = 0.020257
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.002


   Clade credibility values:

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |---------------------------------------------------------------------- C3 (3)
   |                                                                               
   |---------------------------------------------------------------------- C4 (4)
   |                                                                               
   |---------------------------------------------------------------------- C5 (5)
   |                                                                               
   |---------------------------------------------------------------------- C6 (6)
   |                                                                               
   |---------------------------------------------------------------------- C13 (13)
   |                                                                               
   |---------------------------------------------------------------------- C14 (14)
   |                                                                               
   +---------------------------------------------------------------------- C15 (15)
   |                                                                               
   |                                                    /----------------- C2 (2)
   |                                  /--------83-------+                          
   |                                  |                 \----------------- C10 (10)
   |                 /-------65-------+                                            
   |                 |                |                 /----------------- C11 (11)
   |                 |                \-------100-------+                          
   |-------100-------+                                  \----------------- C12 (12)
   |                 |                                                             
   |                 \---------------------------------------------------- C9 (9)
   |                                                                               
   |                                                    /----------------- C7 (7)
   \-------------------------80-------------------------+                          
                                                        \----------------- C8 (8)
                                                                                   

   Phylogram (based on average branch lengths):

   /- C1 (1)
   |                                                                               
   |-- C3 (3)
   |                                                                               
   |-- C4 (4)
   |                                                                               
   |-- C5 (5)
   |                                                                               
   |--- C6 (6)
   |                                                                               
   |--- C13 (13)
   |                                                                               
   |----- C14 (14)
   |                                                                               
   +--- C15 (15)
   |                                                                               
   |                                                     /----- C2 (2)
   |                                               /-----+                         
   |                                               |     \-------- C10 (10)
   |                                        /------+                               
   |                                        |      |                    /- C11 (11)
   |                                        |      \--------------------+          
   |----------------------------------------+                           \- C12 (12)
   |                                        |                                      
   |                                        \-------------- C9 (9)
   |                                                                               
   | /-- C7 (7)
   \-+                                                                             
     \- C8 (8)
                                                                                   
   |---------------| 0.100 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3000 trees sampled):
      50 % credible set contains 1499 trees
      90 % credible set contains 2700 trees
      95 % credible set contains 2850 trees
      99 % credible set contains 2970 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 15  	ls = 381
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Reading seq # 9: C9     
Reading seq #10: C10     
Reading seq #11: C11     
Reading seq #12: C12     
Reading seq #13: C13     
Reading seq #14: C14     
Reading seq #15: C15     
Sequences read..
Counting site patterns..  0:00

          98 patterns at      127 /      127 sites (100.0%),  0:00
Counting codons..
NG distances for seqs.:
   1   2   3   4   5   6   7   8   9  10  11  12  13  14  15

      840 bytes for distance
    95648 bytes for conP
    13328 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
   286944 bytes for conP, adjusted

    0.013484    0.017347    0.035131    0.020812    0.039507    0.043253    0.045962    0.037599    0.211276    0.000000    0.094627    0.042108    0.052697    0.093983    0.005424    0.024081    0.118318    0.016208    0.025255    0.017843    0.300000    1.300000

ntime & nrate & np:    20     2    22

Bounds (np=22):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    22
lnL0 = -1230.477623

Iterating by ming2
Initial: fx=  1230.477623
x=  0.01348  0.01735  0.03513  0.02081  0.03951  0.04325  0.04596  0.03760  0.21128  0.00000  0.09463  0.04211  0.05270  0.09398  0.00542  0.02408  0.11832  0.01621  0.02526  0.01784  0.30000  1.30000

  1 h-m-p  0.0000 0.0000 2547.8325 +YCYCCC  1219.797226  5 0.0000    36 | 0/22
  2 h-m-p  0.0000 0.0000 310.2670 ++     1217.867783  m 0.0000    61 | 1/22
  3 h-m-p  0.0000 0.0005 377.7623 ++CYCCCC  1201.065750  5 0.0004    98 | 1/22
  4 h-m-p  0.0000 0.0001 1978.3257 +YYCCC  1192.939015  4 0.0001   130 | 1/22
  5 h-m-p  0.0001 0.0003 1140.1173 +YCCC  1184.685867  3 0.0002   161 | 1/22
  6 h-m-p  0.0001 0.0007 246.6666 +YCCCC  1180.052812  4 0.0004   194 | 1/22
  7 h-m-p  0.0005 0.0023 110.3794 YCCC   1176.888864  3 0.0011   224 | 1/22
  8 h-m-p  0.0004 0.0019 285.9373 +YYYCCCCC  1154.724788  7 0.0016   261 | 1/22
  9 h-m-p  0.0000 0.0001 2143.6624 +CYYYCCCC  1148.791618  7 0.0001   298 | 1/22
 10 h-m-p  0.0000 0.0001 4462.3030 +CYCCC  1139.893281  4 0.0000   331 | 1/22
 11 h-m-p  0.0000 0.0001 589.1312 ++     1137.175820  m 0.0001   356 | 1/22
 12 h-m-p  0.0001 0.0005 116.0216 YCYCCC  1136.447286  5 0.0002   389 | 1/22
 13 h-m-p  0.0003 0.0015  69.2099 +YCCCC  1135.019095  4 0.0009   422 | 1/22
 14 h-m-p  0.0001 0.0006  67.4750 ++     1133.761002  m 0.0006   447 | 1/22
 15 h-m-p  0.0000 0.0000 116.2966 
h-m-p:      8.86352002e-21      4.43176001e-20      1.16296635e+02  1133.761002
..  | 1/22
 16 h-m-p  0.0000 0.0006 6259.0172 YYYYCCC  1117.047099  6 0.0000   502 | 1/22
 17 h-m-p  0.0001 0.0006 358.3813 +YYCYYCCC  1083.346313  7 0.0005   538 | 1/22
 18 h-m-p  0.0000 0.0001 772.7241 +YYYYCC  1073.017944  5 0.0001   570 | 1/22
 19 h-m-p  0.0000 0.0000 1399.8112 +YYYCCC  1069.490597  5 0.0000   603 | 1/22
 20 h-m-p  0.0000 0.0001 323.7658 +YYYYYCCCCC  1065.172522  9 0.0001   642 | 1/22
 21 h-m-p  0.0001 0.0005 292.5950 ++     1051.168907  m 0.0005   667 | 1/22
 22 h-m-p  0.0000 0.0000 1660.0419 
h-m-p:      1.22945366e-21      6.14726830e-21      1.66004188e+03  1051.168907
..  | 1/22
 23 h-m-p  0.0000 0.0004 530.3246 +YYCCC  1047.918754  4 0.0001   721 | 1/22
 24 h-m-p  0.0001 0.0004 183.4613 +YYYYCC  1042.699825  5 0.0003   753 | 1/22
 25 h-m-p  0.0000 0.0001 217.1110 YCCCC  1042.155222  4 0.0001   785 | 1/22
 26 h-m-p  0.0001 0.0004 178.5849 +YCYCC  1040.804743  4 0.0002   817 | 1/22
 27 h-m-p  0.0001 0.0006 127.6941 +YCYCCC  1039.247075  5 0.0004   851 | 1/22
 28 h-m-p  0.0001 0.0006 299.0817 YCCCC  1036.805044  4 0.0003   883 | 1/22
 29 h-m-p  0.0005 0.0024 137.6459 YCCCC  1033.859605  4 0.0010   915 | 1/22
 30 h-m-p  0.0002 0.0012 165.0533 +YYCYCC  1030.583712  5 0.0008   948 | 1/22
 31 h-m-p  0.0002 0.0010 628.7760 YCCCC  1025.054949  4 0.0005   980 | 1/22
 32 h-m-p  0.0002 0.0010 375.7366 +YCCCC  1021.255829  4 0.0006  1013 | 1/22
 33 h-m-p  0.0001 0.0007 364.1903 +YYC   1018.106706  2 0.0006  1041 | 1/22
 34 h-m-p  0.0000 0.0002 258.5843 ++     1016.867222  m 0.0002  1066 | 1/22
 35 h-m-p  0.0000 0.0000 112.9648 
h-m-p:      2.50682063e-19      1.25341031e-18      1.12964821e+02  1016.867222
..  | 1/22
 36 h-m-p  0.0000 0.0003 107.2137 ++YCYCCC  1015.455260  5 0.0002  1123 | 1/22
 37 h-m-p  0.0001 0.0005  62.1041 YCYCCC  1015.090316  5 0.0002  1156 | 1/22
 38 h-m-p  0.0001 0.0018  90.4740 YC     1014.579790  1 0.0003  1182 | 1/22
 39 h-m-p  0.0002 0.0008 104.6994 YCCCC  1014.032216  4 0.0003  1214 | 1/22
 40 h-m-p  0.0003 0.0022 108.3538 CCCC   1013.339341  3 0.0005  1245 | 1/22
 41 h-m-p  0.0002 0.0008  77.6258 CCCC   1013.078940  3 0.0003  1276 | 1/22
 42 h-m-p  0.0002 0.0016 107.3153 YCCC   1012.959735  3 0.0001  1306 | 1/22
 43 h-m-p  0.0003 0.0026  44.3532 YCCC   1012.693849  3 0.0007  1336 | 1/22
 44 h-m-p  0.0003 0.0035 108.8466 CCC    1012.348530  2 0.0004  1365 | 1/22
 45 h-m-p  0.0007 0.0036  48.3866 CCCC   1012.111668  3 0.0007  1396 | 1/22
 46 h-m-p  0.0005 0.0041  68.9213 CC     1011.834821  1 0.0007  1423 | 1/22
 47 h-m-p  0.0005 0.0035 105.5483 +YCCC  1011.053329  3 0.0013  1454 | 1/22
 48 h-m-p  0.0003 0.0034 483.8049 +CYCCC  1007.023578  4 0.0015  1487 | 1/22
 49 h-m-p  0.0003 0.0013 1007.9044 YCCC   1004.005667  3 0.0006  1517 | 1/22
 50 h-m-p  0.0002 0.0010 591.7932 YCCC   1002.503965  3 0.0005  1547 | 1/22
 51 h-m-p  0.0001 0.0004 519.4945 +CCC   1001.550066  2 0.0003  1577 | 1/22
 52 h-m-p  0.0034 0.0171  35.9831 CCC    1001.442970  2 0.0007  1606 | 1/22
 53 h-m-p  0.0019 0.0127  12.5586 YCC    1001.399391  2 0.0011  1634 | 1/22
 54 h-m-p  0.0010 0.0107  13.6088 CC     1001.389259  1 0.0003  1661 | 1/22
 55 h-m-p  0.0020 0.1306   2.0709 YC     1001.386902  1 0.0009  1687 | 1/22
 56 h-m-p  0.0015 0.6376   1.1869 +++YCCCC  1000.908788  4 0.2056  1722 | 1/22
 57 h-m-p  0.0004 0.0048 581.6322 +YYCYCCC   998.677207  6 0.0021  1757 | 1/22
 58 h-m-p  1.5342 8.0000   0.7899 CCCC    997.672756  3 1.4499  1788 | 1/22
 59 h-m-p  1.6000 8.0000   0.6260 CYC     997.237726  2 1.5351  1837 | 1/22
 60 h-m-p  1.6000 8.0000   0.3935 CCC     997.128245  2 1.2801  1887 | 1/22
 61 h-m-p  1.6000 8.0000   0.1967 CC      997.110944  1 1.2961  1935 | 1/22
 62 h-m-p  1.6000 8.0000   0.0905 YC      997.108684  1 0.8095  1982 | 1/22
 63 h-m-p  1.6000 8.0000   0.0247 YC      997.108454  1 1.0681  2029 | 1/22
 64 h-m-p  1.6000 8.0000   0.0013 Y       997.108451  0 1.0209  2075 | 1/22
 65 h-m-p  1.6000 8.0000   0.0002 Y       997.108451  0 1.1002  2121 | 1/22
 66 h-m-p  1.6000 8.0000   0.0001 Y       997.108451  0 1.1671  2167 | 1/22
 67 h-m-p  1.6000 8.0000   0.0000 C       997.108451  0 1.2847  2213 | 1/22
 68 h-m-p  0.8492 8.0000   0.0000 C       997.108451  0 0.8492  2259 | 1/22
 69 h-m-p  1.6000 8.0000   0.0000 -C      997.108451  0 0.0938  2306
Out..
lnL  =  -997.108451
2307 lfun, 2307 eigenQcodon, 46140 P(t)

Time used:  0:10


Model 1: NearlyNeutral

TREE #  1
(1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
    0.014641    0.016542    0.022440    0.019061    0.024415    0.029684    0.045330    0.032704    0.238466    0.000000    0.099243    0.043320    0.057257    0.110764    0.000000    0.008283    0.127281    0.011031    0.014004    0.010377    8.766677    0.500545    0.139499

ntime & nrate & np:    20     2    23

Bounds (np=23):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 2.132534

np =    23
lnL0 = -1036.070874

Iterating by ming2
Initial: fx=  1036.070874
x=  0.01464  0.01654  0.02244  0.01906  0.02441  0.02968  0.04533  0.03270  0.23847  0.00000  0.09924  0.04332  0.05726  0.11076  0.00000  0.00828  0.12728  0.01103  0.01400  0.01038  8.76668  0.50054  0.13950

  1 h-m-p  0.0000 0.0000 252.7316 ++     1036.070379  m 0.0000    28 | 1/23
  2 h-m-p  0.0000 0.0000 170.2477 ++     1036.068436  m 0.0000    54 | 1/23
  3 h-m-p -0.0000 -0.0000 470.5452 
h-m-p:     -0.00000000e+00     -0.00000000e+00      4.70545168e+02  1036.068436
..  | 1/23
  4 h-m-p  0.0000 0.0004 230.6758 ++CYYCC  1030.886989  4 0.0003   112 | 1/23
  5 h-m-p  0.0002 0.0009 211.2205 +YYYYCYCCC  1024.606283  8 0.0008   150 | 1/23
  6 h-m-p  0.0000 0.0001 1429.5291 +YYC   1021.922609  2 0.0000   179 | 1/23
  7 h-m-p  0.0000 0.0001 216.8533 ++     1020.352948  m 0.0001   205 | 1/23
  8 h-m-p  0.0001 0.0007 169.1951 +YCYCCC  1015.365439  5 0.0006   240 | 1/23
  9 h-m-p  0.0000 0.0002 998.3688 +YYCCCC  1012.056349  5 0.0001   275 | 1/23
 10 h-m-p  0.0001 0.0003 611.2865 YCCC   1010.095792  3 0.0001   306 | 1/23
 11 h-m-p  0.0002 0.0011 116.7078 CYC    1009.458998  2 0.0002   335 | 1/23
 12 h-m-p  0.0004 0.0018  34.5407 CCCC   1009.257056  3 0.0004   367 | 1/23
 13 h-m-p  0.0006 0.0081  26.4741 CCC    1009.112583  2 0.0007   397 | 1/23
 14 h-m-p  0.0004 0.0022  19.1548 YYC    1009.073654  2 0.0003   425 | 1/23
 15 h-m-p  0.0004 0.0085  17.0713 YCC    1009.017713  2 0.0007   454 | 1/23
 16 h-m-p  0.0010 0.0131  11.8823 YC     1008.999361  1 0.0004   481 | 1/23
 17 h-m-p  0.0011 0.0288   4.6548 CC     1008.970047  1 0.0017   509 | 1/23
 18 h-m-p  0.0014 0.0251   5.4779 CCC    1008.912601  2 0.0018   539 | 1/23
 19 h-m-p  0.0005 0.0032  20.4090 CCCC   1008.820591  3 0.0006   571 | 1/23
 20 h-m-p  0.0007 0.0102  17.8381 +CCCCC  1008.122053  4 0.0035   606 | 1/23
 21 h-m-p  0.0009 0.0047  16.9953 +YCYCC  1006.920383  4 0.0030   639 | 1/23
 22 h-m-p  0.0005 0.0025  58.4367 +YYYYCYCCC  1002.115194  8 0.0021   677 | 1/23
 23 h-m-p  0.0003 0.0014  34.3355 YCYCCC  1001.598265  5 0.0007   711 | 1/23
 24 h-m-p  0.0031 0.0411   7.6828 CC     1001.403813  1 0.0038   739 | 1/23
 25 h-m-p  0.0095 0.0485   3.0938 CCC    1000.886201  2 0.0115   769 | 1/23
 26 h-m-p  0.0009 0.0044  18.9705 +YYYCCC   998.629446  5 0.0032   803 | 1/23
 27 h-m-p  0.2048 1.0239   0.1405 CCC     997.794648  2 0.2861   833 | 1/23
 28 h-m-p  0.1831 0.9917   0.2196 YCC     996.750472  2 0.2897   884 | 1/23
 29 h-m-p  0.4316 2.1581   0.0449 +YCCC   996.122320  3 1.2077   938 | 1/23
 30 h-m-p  0.3651 1.8253   0.0266 YCCC    995.935048  3 0.6657   991 | 1/23
 31 h-m-p  1.6000 8.0000   0.0100 CC      995.843142  1 1.3321  1041 | 1/23
 32 h-m-p  1.4526 8.0000   0.0091 CCC     995.733357  2 1.7577  1093 | 1/23
 33 h-m-p  1.0669 8.0000   0.0151 CC      995.632376  1 1.1846  1143 | 1/23
 34 h-m-p  1.1963 8.0000   0.0149 YCCC    995.538757  3 2.1534  1196 | 1/23
 35 h-m-p  1.6000 8.0000   0.0177 CYC     995.484440  2 1.6443  1247 | 1/23
 36 h-m-p  1.6000 8.0000   0.0051 YC      995.472011  1 1.0825  1296 | 1/23
 37 h-m-p  1.6000 8.0000   0.0026 YC      995.469775  1 0.8208  1345 | 1/23
 38 h-m-p  0.3954 8.0000   0.0053 YC      995.469301  1 0.9658  1394 | 1/23
 39 h-m-p  0.9352 8.0000   0.0055 C       995.469229  0 1.1340  1442 | 1/23
 40 h-m-p  1.1035 8.0000   0.0057 Y       995.469195  0 1.9868  1490 | 1/23
 41 h-m-p  1.6000 8.0000   0.0063 C       995.469172  0 1.8138  1538 | 1/23
 42 h-m-p  1.6000 8.0000   0.0014 Y       995.469170  0 1.2726  1586 | 1/23
 43 h-m-p  1.6000 8.0000   0.0005 C       995.469169  0 1.6600  1634 | 1/23
 44 h-m-p  1.6000 8.0000   0.0002 Y       995.469169  0 1.1602  1682 | 1/23
 45 h-m-p  1.6000 8.0000   0.0000 C       995.469169  0 1.3777  1730 | 1/23
 46 h-m-p  1.6000 8.0000   0.0000 C       995.469169  0 0.5816  1778 | 1/23
 47 h-m-p  1.4815 8.0000   0.0000 C       995.469169  0 0.3704  1826 | 1/23
 48 h-m-p  1.6000 8.0000   0.0000 C       995.469169  0 0.3550  1874
Out..
lnL  =  -995.469169
1875 lfun, 5625 eigenQcodon, 75000 P(t)

Time used:  0:27


Model 2: PositiveSelection

TREE #  1
(1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
initial w for M2:NSpselection reset.

    0.016123    0.017368    0.024865    0.020525    0.028690    0.031146    0.046511    0.036268    0.226799    0.000000    0.099761    0.046682    0.060144    0.107237    0.001659    0.010781    0.120197    0.011164    0.013584    0.013726    9.028394    1.302842    0.509198    0.419451    2.107983

ntime & nrate & np:    20     3    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 1.650272

np =    25
lnL0 = -1055.989892

Iterating by ming2
Initial: fx=  1055.989892
x=  0.01612  0.01737  0.02487  0.02053  0.02869  0.03115  0.04651  0.03627  0.22680  0.00000  0.09976  0.04668  0.06014  0.10724  0.00166  0.01078  0.12020  0.01116  0.01358  0.01373  9.02839  1.30284  0.50920  0.41945  2.10798

  1 h-m-p  0.0000 0.0000 299.5411 ++     1054.768237  m 0.0000    30 | 1/25
  2 h-m-p  0.0000 0.0003 119.8392 ++     1053.323685  m 0.0003    58 | 1/25
  3 h-m-p -0.0000 -0.0000 175.7685 
h-m-p:     -9.24489504e-21     -4.62244752e-20      1.75768544e+02  1053.323685
..  | 1/25
  4 h-m-p  0.0000 0.0029 263.6708 ++CYCCC  1050.619178  4 0.0001   120 | 1/25
  5 h-m-p  0.0001 0.0005  92.7572 +YYCYCC  1048.928337  5 0.0003   156 | 1/25
  6 h-m-p  0.0002 0.0010 204.5234 +YYCYCCCC  1039.334281  7 0.0009   197 | 1/25
  7 h-m-p  0.0000 0.0000 26769.6223 +YCYCCC  1030.764868  5 0.0000   234 | 1/25
  8 h-m-p  0.0000 0.0001 1553.2105 ++     1026.324019  m 0.0001   262 | 2/25
  9 h-m-p  0.0017 0.0086  18.8496 CCYC   1025.255238  3 0.0018   295 | 2/25
 10 h-m-p  0.0002 0.0022 187.5119 +CCCC  1023.253378  3 0.0008   330 | 2/25
 11 h-m-p  0.0008 0.0040  65.1798 YCYCCC  1020.828765  5 0.0020   366 | 1/25
 12 h-m-p  0.0002 0.0010 266.9933 CCCC   1019.763011  3 0.0002   400 | 1/25
 13 h-m-p  0.0003 0.0014 160.1352 YCCCC  1018.442775  4 0.0006   435 | 1/25
 14 h-m-p  0.0004 0.0022 170.1845 YCCCCC  1015.994150  5 0.0009   472 | 1/25
 15 h-m-p  0.0006 0.0030 275.0623 YCCCCC  1011.315634  5 0.0012   509 | 1/25
 16 h-m-p  0.0003 0.0013 259.0793 CCCC   1010.047087  3 0.0004   543 | 1/25
 17 h-m-p  0.0006 0.0031  85.9188 CCCCC  1008.967380  4 0.0011   579 | 1/25
 18 h-m-p  0.0003 0.0017 158.0288 +YYCCCC  1006.785449  5 0.0012   616 | 1/25
 19 h-m-p  0.0001 0.0007 393.5924 +YCYCCC  1004.853525  5 0.0004   653 | 1/25
 20 h-m-p  0.0003 0.0016  47.0421 CCCC   1004.671143  3 0.0004   687 | 1/25
 21 h-m-p  0.0002 0.0019 110.9045 +YCCC  1004.239005  3 0.0005   721 | 1/25
 22 h-m-p  0.0001 0.0006 110.9332 CCC    1004.139416  2 0.0001   753 | 1/25
 23 h-m-p  0.0006 0.0035  21.8989 YYC    1004.076342  2 0.0005   783 | 1/25
 24 h-m-p  0.0010 0.0279  10.0872 YCCC   1003.963281  3 0.0019   816 | 1/25
 25 h-m-p  0.0002 0.0107 100.1135 ++YYYCC  1002.077617  4 0.0029   851 | 1/25
 26 h-m-p  0.0004 0.0022  58.4557 YYC    1001.972094  2 0.0003   881 | 1/25
 27 h-m-p  0.0222 1.6410   0.8533 ++YCCC   998.765828  3 0.6866   916 | 1/25
 28 h-m-p  0.1794 0.8970   0.9562 ++      997.049653  m 0.8970   968 | 2/25
 29 h-m-p  0.6362 3.1812   0.2789 CYC     996.415635  2 0.7841  1023 | 2/25
 30 h-m-p  0.5889 2.9444   0.2083 YCCCC   995.927108  4 1.3129  1081 | 2/25
 31 h-m-p  1.4219 7.1096   0.1556 YCC     995.773299  2 1.0036  1135 | 2/25
 32 h-m-p  1.2103 8.0000   0.1290 CC      995.699989  1 1.0283  1188 | 2/25
 33 h-m-p  0.7805 8.0000   0.1700 YC      995.631648  1 1.5250  1240 | 2/25
 34 h-m-p  0.9850 8.0000   0.2631 YCCC    995.541169  3 2.0909  1296 | 2/25
 35 h-m-p  1.6000 8.0000   0.3045 YYC     995.491999  2 1.1655  1349 | 2/25
 36 h-m-p  1.6000 8.0000   0.0493 CC      995.475151  1 1.3575  1402 | 2/25
 37 h-m-p  1.6000 8.0000   0.0215 CC      995.472296  1 1.3449  1455 | 2/25
 38 h-m-p  1.4460 8.0000   0.0200 YC      995.470826  1 2.3999  1507 | 2/25
 39 h-m-p  1.6000 8.0000   0.0226 C       995.470133  0 1.5730  1558 | 2/25
 40 h-m-p  1.6000 8.0000   0.0141 C       995.469830  0 1.5620  1609 | 2/25
 41 h-m-p  1.6000 8.0000   0.0057 YC      995.469372  1 3.4047  1661 | 2/25
 42 h-m-p  1.6000 8.0000   0.0078 YC      995.469254  1 1.1262  1713 | 2/25
 43 h-m-p  1.2574 8.0000   0.0070 C       995.469212  0 1.7839  1764 | 2/25
 44 h-m-p  1.6000 8.0000   0.0051 C       995.469179  0 2.4480  1815 | 2/25
 45 h-m-p  1.6000 8.0000   0.0029 C       995.469169  0 1.6606  1866 | 2/25
 46 h-m-p  1.6000 8.0000   0.0003 Y       995.469169  0 1.0638  1917 | 2/25
 47 h-m-p  1.6000 8.0000   0.0000 C       995.469169  0 1.9474  1968 | 2/25
 48 h-m-p  1.6000 8.0000   0.0000 ++      995.469169  m 8.0000  2019 | 2/25
 49 h-m-p  1.6000 8.0000   0.0000 C       995.469169  0 2.1903  2070 | 2/25
 50 h-m-p  0.6306 8.0000   0.0001 Y       995.469169  0 1.5294  2121 | 2/25
 51 h-m-p  1.6000 8.0000   0.0000 Y       995.469169  0 0.9536  2172 | 2/25
 52 h-m-p  1.6000 8.0000   0.0000 C       995.469169  0 1.7378  2223 | 2/25
 53 h-m-p  1.6000 8.0000   0.0000 -C      995.469169  0 0.1000  2275 | 2/25
 54 h-m-p  0.1217 8.0000   0.0000 Y       995.469169  0 0.1217  2326 | 2/25
 55 h-m-p  0.1397 8.0000   0.0000 ------Y   995.469169  0 0.0000  2383
Out..
lnL  =  -995.469169
2384 lfun, 9536 eigenQcodon, 143040 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1005.014438  S =  -968.608225   -27.943287
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  98 patterns   1:00
	did  20 /  98 patterns   1:00
	did  30 /  98 patterns   1:00
	did  40 /  98 patterns   1:00
	did  50 /  98 patterns   1:00
	did  60 /  98 patterns   1:00
	did  70 /  98 patterns   1:00
	did  80 /  98 patterns   1:00
	did  90 /  98 patterns   1:00
	did  98 /  98 patterns   1:00
Time used:  1:00


Model 3: discrete

TREE #  1
(1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
    0.017012    0.019163    0.030358    0.028016    0.032681    0.034092    0.046391    0.038883    0.218661    0.000000    0.098132    0.040579    0.061666    0.100976    0.001011    0.012283    0.118550    0.019663    0.022950    0.019815    9.028393    0.446685    0.067456    0.034133    0.087859    0.121068

ntime & nrate & np:    20     4    26

Bounds (np=26):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 4.006299

np =    26
lnL0 = -1001.047497

Iterating by ming2
Initial: fx=  1001.047497
x=  0.01701  0.01916  0.03036  0.02802  0.03268  0.03409  0.04639  0.03888  0.21866  0.00000  0.09813  0.04058  0.06167  0.10098  0.00101  0.01228  0.11855  0.01966  0.02295  0.01981  9.02839  0.44668  0.06746  0.03413  0.08786  0.12107

  1 h-m-p  0.0000 0.0000 190.0913 ++     1000.751168  m 0.0000    31 | 1/26
  2 h-m-p  0.0000 0.0000  87.8931 ++     1000.659879  m 0.0000    60 | 1/26
  3 h-m-p -0.0000 -0.0000  56.6390 
h-m-p:     -2.41406880e-21     -1.20703440e-20      5.66389760e+01  1000.659879
..  | 1/26
  4 h-m-p  0.0000 0.0003 141.7282 ++YYYCCCCC   998.594855  7 0.0002   128 | 1/26
  5 h-m-p  0.0001 0.0004 114.7671 CCC     998.126683  2 0.0001   161 | 1/26
  6 h-m-p  0.0001 0.0006 114.8477 CCC     997.695615  2 0.0002   194 | 1/26
  7 h-m-p  0.0001 0.0005 111.5030 ++      996.783426  m 0.0005   223 | 2/26
  8 h-m-p  0.0003 0.0016  73.1880 CCCC    996.314135  3 0.0004   258 | 2/26
  9 h-m-p  0.0002 0.0011  42.0292 CCC     996.189829  2 0.0003   291 | 2/26
 10 h-m-p  0.0003 0.0014  29.8555 CCC     996.114050  2 0.0003   324 | 2/26
 11 h-m-p  0.0004 0.0107  23.3727 YCCC    996.007990  3 0.0008   358 | 2/26
 12 h-m-p  0.0013 0.0226  15.3327 CCC     995.979161  2 0.0005   391 | 2/26
 13 h-m-p  0.0004 0.0076  18.3540 YC      995.929025  1 0.0008   421 | 2/26
 14 h-m-p  0.0004 0.0036  39.3258 YCCC    995.821185  3 0.0009   455 | 2/26
 15 h-m-p  0.0004 0.0021  40.5087 YCCC    995.706045  3 0.0009   489 | 2/26
 16 h-m-p  0.0001 0.0007  66.3715 YCCC    995.650683  3 0.0003   523 | 2/26
 17 h-m-p  0.0002 0.0011  24.7457 YC      995.621769  1 0.0005   553 | 2/26
 18 h-m-p  0.0013 0.0063   6.6661 YC      995.615793  1 0.0005   583 | 1/26
 19 h-m-p  0.0004 0.0294  10.0273 YC      995.599919  1 0.0008   613 | 1/26
 20 h-m-p  0.0018 0.0214   4.1266 CC      995.598017  1 0.0004   644 | 1/26
 21 h-m-p  0.0004 0.0023   4.1318 +YC     995.594892  1 0.0010   675 | 1/26
 22 h-m-p  0.0004 0.0018   2.8707 YC      995.593801  1 0.0006   705 | 1/26
 23 h-m-p  0.0012 0.0114   1.3129 +CC     995.586890  1 0.0059   737 | 1/26
 24 h-m-p  0.0007 0.0684  11.7910 ++YYC   995.487560  2 0.0087   770 | 1/26
 25 h-m-p  0.0005 0.0023  45.2485 ++      995.354609  m 0.0023   799 | 1/26
 26 h-m-p -0.0000 -0.0000 104.0632 
h-m-p:     -3.55367110e-21     -1.77683555e-20      1.04063229e+02   995.354609
..  | 1/26
 27 h-m-p  0.0000 0.0005  34.5707 ++YCCC   995.288027  3 0.0001   861 | 1/26
 28 h-m-p  0.0001 0.0007  17.7670 YC      995.253936  1 0.0003   891 | 1/26
 29 h-m-p  0.0000 0.0001  20.6523 ++      995.239635  m 0.0001   920 | 2/26
 30 h-m-p  0.0001 0.0019  26.7877 +YC     995.222294  1 0.0002   951 | 2/26
 31 h-m-p  0.0003 0.0038  13.8594 YC      995.190442  1 0.0007   981 | 2/26
 32 h-m-p  0.0007 0.0035  14.9286 CY      995.183607  1 0.0002  1012 | 2/26
 33 h-m-p  0.0002 0.0038  16.2090 CC      995.176615  1 0.0002  1043 | 2/26
 34 h-m-p  0.0005 0.0277   6.0514 CC      995.168794  1 0.0008  1074 | 2/26
 35 h-m-p  0.0008 0.0220   6.2874 YC      995.165114  1 0.0005  1104 | 2/26
 36 h-m-p  0.0006 0.0164   5.4877 YC      995.163366  1 0.0003  1134 | 2/26
 37 h-m-p  0.0004 0.0282   4.2362 CC      995.161269  1 0.0006  1165 | 2/26
 38 h-m-p  0.0023 0.0584   1.1664 CC      995.160918  1 0.0007  1196 | 2/26
 39 h-m-p  0.0008 0.0517   1.0137 YC      995.160816  1 0.0003  1226 | 2/26
 40 h-m-p  0.0003 0.0428   1.0105 +YC     995.160586  1 0.0009  1257 | 2/26
 41 h-m-p  0.0004 0.0184   2.2283 CC      995.160244  1 0.0007  1288 | 2/26
 42 h-m-p  0.0008 0.0233   1.8084 C       995.159892  0 0.0009  1317 | 2/26
 43 h-m-p  0.0028 0.1144   0.6060 YC      995.159848  1 0.0004  1347 | 1/26
 44 h-m-p  0.0008 0.4230   0.5198 YC      995.159784  1 0.0005  1401 | 1/26
 45 h-m-p  0.0005 0.1304   0.4838 C       995.159731  0 0.0005  1455 | 1/26
 46 h-m-p  0.0006 0.0704   0.3744 +YC     995.159338  1 0.0044  1511 | 1/26
 47 h-m-p  0.0029 0.0373   0.5727 +YC     995.156250  1 0.0183  1567 | 1/26
 48 h-m-p  0.0004 0.0018   6.3793 YC      995.154696  1 0.0008  1622 | 1/26
 49 h-m-p  0.0179 0.1238   0.2850 +YC     995.142813  1 0.0925  1653 | 1/26
 50 h-m-p  0.9609 8.0000   0.0274 YC      995.141829  1 1.7672  1708 | 1/26
 51 h-m-p  0.5704 8.0000   0.0850 +YC     995.139356  1 1.9024  1764 | 1/26
 52 h-m-p  1.6000 8.0000   0.0511 C       995.138223  0 1.6661  1818 | 1/26
 53 h-m-p  1.6000 8.0000   0.0256 ++      995.135906  m 8.0000  1872 | 1/26
 54 h-m-p  1.4700 8.0000   0.1394 YC      995.135331  1 0.8858  1927 | 1/26
 55 h-m-p  1.6000 8.0000   0.0166 C       995.135163  0 1.2949  1981 | 1/26
 56 h-m-p  0.8277 8.0000   0.0260 C       995.135095  0 0.8360  2035 | 1/26
 57 h-m-p  0.9040 8.0000   0.0241 C       995.135051  0 1.1187  2089 | 1/26
 58 h-m-p  1.6000 8.0000   0.0014 Y       995.135041  0 2.7461  2143 | 1/26
 59 h-m-p  1.6000 8.0000   0.0012 +Y      995.135011  0 4.7237  2198 | 1/26
 60 h-m-p  1.6000 8.0000   0.0015 Y       995.135008  0 1.1720  2252 | 1/26
 61 h-m-p  1.1439 8.0000   0.0015 Y       995.135008  0 0.8877  2306 | 1/26
 62 h-m-p  1.6000 8.0000   0.0001 Y       995.135008  0 0.9312  2360 | 1/26
 63 h-m-p  1.6000 8.0000   0.0000 Y       995.135008  0 0.6509  2414 | 1/26
 64 h-m-p  1.1624 8.0000   0.0000 Y       995.135008  0 0.1806  2468 | 1/26
 65 h-m-p  0.2123 8.0000   0.0000 -----Y   995.135008  0 0.0001  2527
Out..
lnL  =  -995.135008
2528 lfun, 10112 eigenQcodon, 151680 P(t)

Time used:  1:35


Model 7: beta

TREE #  1
(1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
    0.026990    0.018160    0.026516    0.032033    0.030907    0.028187    0.045240    0.044150    0.207771    0.000000    0.093083    0.048541    0.053483    0.096353    0.006708    0.014943    0.113534    0.014837    0.014934    0.021443    8.881153    1.051152    1.246982

ntime & nrate & np:    20     1    23

Bounds (np=23):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 2.367414

np =    23
lnL0 = -1033.198490

Iterating by ming2
Initial: fx=  1033.198490
x=  0.02699  0.01816  0.02652  0.03203  0.03091  0.02819  0.04524  0.04415  0.20777  0.00000  0.09308  0.04854  0.05348  0.09635  0.00671  0.01494  0.11353  0.01484  0.01493  0.02144  8.88115  1.05115  1.24698

  1 h-m-p  0.0000 0.0001 258.1417 ++     1030.140631  m 0.0001    28 | 1/23
  2 h-m-p  0.0001 0.0003 138.0561 +YYCCCC  1028.537541  5 0.0002    63 | 1/23
  3 h-m-p  0.0001 0.0004  83.6806 YCCCC  1028.015419  4 0.0002    96 | 1/23
  4 h-m-p  0.0001 0.0005 228.8334 +YCCC  1026.983855  3 0.0002   128 | 1/23
  5 h-m-p  0.0001 0.0005 177.0825 +CCC   1025.895826  2 0.0003   159 | 1/23
  6 h-m-p  0.0001 0.0004  98.9505 ++     1024.893708  m 0.0004   185 | 1/23
  7 h-m-p  0.0000 0.0000 151.8214 
h-m-p:      5.88751534e-21      2.94375767e-20      1.51821404e+02  1024.893708
..  | 1/23
  8 h-m-p  0.0000 0.0004 134.6522 ++YYCCCC  1023.506739  5 0.0002   244 | 1/23
  9 h-m-p  0.0003 0.0020  68.8321 YCCC   1023.249240  3 0.0002   275 | 1/23
 10 h-m-p  0.0002 0.0052  52.1613 ++YCCCC  1021.014896  4 0.0024   310 | 1/23
 11 h-m-p  0.0001 0.0005 491.1508 YCCCC  1019.113550  4 0.0002   343 | 1/23
 12 h-m-p  0.0001 0.0005 506.3867 +YYCCC  1016.184726  4 0.0004   376 | 1/23
 13 h-m-p  0.0001 0.0005 816.2604 +YYYCCC  1010.782416  5 0.0004   410 | 1/23
 14 h-m-p  0.0001 0.0003 1243.8602 YCYCCC  1006.258455  5 0.0002   444 | 1/23
 15 h-m-p  0.0001 0.0004 260.9462 CCCC   1005.885416  3 0.0001   476 | 1/23
 16 h-m-p  0.0002 0.0012  33.0621 YYYC   1005.809859  3 0.0002   505 | 1/23
 17 h-m-p  0.0004 0.0156  20.8336 +CC    1005.572820  1 0.0017   534 | 1/23
 18 h-m-p  0.0004 0.0047  85.8253 +YYYYYC  1004.627575  5 0.0016   566 | 1/23
 19 h-m-p  0.0001 0.0007 738.1408 CCCCC  1003.524563  4 0.0002   600 | 1/23
 20 h-m-p  0.0007 0.0035 240.9120 CCCCC  1002.025833  4 0.0010   634 | 1/23
 21 h-m-p  0.0002 0.0009 409.8811 YCYCCC  1000.787995  5 0.0005   668 | 1/23
 22 h-m-p  0.0002 0.0011 779.7795 YCCC    999.298991  3 0.0004   699 | 1/23
 23 h-m-p  0.0003 0.0014 152.8564 CCCCC   998.905432  4 0.0004   733 | 1/23
 24 h-m-p  0.0018 0.0091  12.0372 CC      998.877829  1 0.0006   761 | 1/23
 25 h-m-p  0.0011 0.0217   6.5220 CC      998.859935  1 0.0010   789 | 1/23
 26 h-m-p  0.0007 0.0333   9.9834 +YCC    998.804246  2 0.0021   819 | 1/23
 27 h-m-p  0.0034 0.0170   5.7564 C       998.791307  0 0.0008   845 | 1/23
 28 h-m-p  0.0034 0.3878   1.3457 ++YCCC   997.448816  3 0.1179   878 | 1/23
 29 h-m-p  0.0005 0.0026 168.6928 YCC     996.369723  2 0.0008   907 | 1/23
 30 h-m-p  0.5809 8.0000   0.2428 YCCC    995.679610  3 1.1356   938 | 1/23
 31 h-m-p  1.2910 6.4550   0.1751 CCCC    995.308635  3 1.4401   992 | 1/23
 32 h-m-p  1.3370 6.6848   0.0285 YCC     995.247346  2 0.9354  1043 | 1/23
 33 h-m-p  1.6000 8.0000   0.0072 YC      995.238864  1 1.0725  1092 | 1/23
 34 h-m-p  0.8230 8.0000   0.0094 YC      995.235333  1 1.9903  1141 | 1/23
 35 h-m-p  0.7914 8.0000   0.0236 +YC     995.228612  1 4.3743  1191 | 1/23
 36 h-m-p  1.3000 8.0000   0.0793 +CC     995.206818  1 5.5529  1242 | 1/23
 37 h-m-p  1.6000 8.0000   0.2651 CYCCC   995.156247  4 3.1925  1297 | 1/23
 38 h-m-p  1.6000 8.0000   0.0118 YC      995.142143  1 1.1214  1346 | 1/23
 39 h-m-p  0.2399 8.0000   0.0550 +YC     995.140630  1 0.7191  1396 | 1/23
 40 h-m-p  1.6000 8.0000   0.0151 CC      995.140130  1 1.3301  1446 | 1/23
 41 h-m-p  0.8400 8.0000   0.0239 C       995.140052  0 0.9099  1494 | 1/23
 42 h-m-p  1.6000 8.0000   0.0101 C       995.140011  0 1.5140  1542 | 1/23
 43 h-m-p  1.6000 8.0000   0.0073 C       995.139984  0 1.8138  1590 | 1/23
 44 h-m-p  1.6000 8.0000   0.0035 Y       995.139978  0 1.2103  1638 | 1/23
 45 h-m-p  1.6000 8.0000   0.0006 C       995.139977  0 1.4023  1686 | 1/23
 46 h-m-p  1.6000 8.0000   0.0002 C       995.139976  0 1.3775  1734 | 1/23
 47 h-m-p  1.6000 8.0000   0.0000 Y       995.139976  0 1.1635  1782 | 1/23
 48 h-m-p  1.6000 8.0000   0.0000 Y       995.139976  0 1.1337  1830 | 1/23
 49 h-m-p  1.6000 8.0000   0.0000 C       995.139976  0 2.1918  1878 | 1/23
 50 h-m-p  1.6000 8.0000   0.0000 --Y     995.139976  0 0.0250  1928
Out..
lnL  =  -995.139976
1929 lfun, 21219 eigenQcodon, 385800 P(t)

Time used:  3:04


Model 8: beta&w>1

TREE #  1
(1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
initial w for M8:NSbetaw>1 reset.

    0.022117    0.016380    0.028785    0.018884    0.024411    0.031013    0.051411    0.039430    0.220393    0.000000    0.100072    0.048174    0.055384    0.106355    0.005519    0.011813    0.124136    0.011676    0.022749    0.013796    8.885934    0.900000    0.607855    1.105757    2.513519

ntime & nrate & np:    20     2    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 2.107453

np =    25
lnL0 = -1032.973683

Iterating by ming2
Initial: fx=  1032.973683
x=  0.02212  0.01638  0.02878  0.01888  0.02441  0.03101  0.05141  0.03943  0.22039  0.00000  0.10007  0.04817  0.05538  0.10636  0.00552  0.01181  0.12414  0.01168  0.02275  0.01380  8.88593  0.90000  0.60785  1.10576  2.51352

  1 h-m-p  0.0000 0.0001 292.1482 ++     1029.087070  m 0.0001    30 | 1/25
  2 h-m-p  0.0001 0.0003 207.0516 +YYYCYYCCC  1022.445184  8 0.0003    71 | 1/25
  3 h-m-p  0.0000 0.0000 969.6859 ++     1021.080914  m 0.0000    99 | 1/25
  4 h-m-p  0.0000 0.0000 638.6030 
h-m-p:      1.11027521e-21      5.55137603e-21      6.38602971e+02  1021.080914
..  | 1/25
  5 h-m-p  0.0000 0.0003 263.4620 ++CYCCC  1018.632877  4 0.0001   161 | 1/25
  6 h-m-p  0.0000 0.0002 145.1921 ++     1016.112942  m 0.0002   189 | 2/25
  7 h-m-p  0.0001 0.0005 174.3748 +YYYCCCCC  1014.218496  7 0.0003   229 | 2/25
  8 h-m-p  0.0000 0.0002 652.7123 YCYC   1013.244692  3 0.0001   261 | 2/25
  9 h-m-p  0.0001 0.0005 287.6034 +YYCCC  1010.544844  4 0.0003   296 | 2/25
 10 h-m-p  0.0001 0.0004 377.9415 +YYCCC  1007.169746  4 0.0003   331 | 2/25
 11 h-m-p  0.0000 0.0002 822.7748 +YYYYCC  1003.836938  5 0.0001   366 | 2/25
 12 h-m-p  0.0000 0.0001 701.4109 +YCYCCC  1002.402504  5 0.0001   403 | 2/25
 13 h-m-p  0.0001 0.0005 260.4380 CCCC   1001.607954  3 0.0002   437 | 2/25
 14 h-m-p  0.0000 0.0001 639.0582 +CC    1000.811644  1 0.0001   468 | 2/25
 15 h-m-p  0.0003 0.0017  68.0306 YCCC   1000.629122  3 0.0002   501 | 2/25
 16 h-m-p  0.0004 0.0026  27.0574 CYC    1000.520544  2 0.0004   532 | 2/25
 17 h-m-p  0.0003 0.0045  29.5412 CCC    1000.428259  2 0.0004   564 | 2/25
 18 h-m-p  0.0002 0.0031  49.6721 CCC    1000.304066  2 0.0004   596 | 2/25
 19 h-m-p  0.0005 0.0071  34.8872 CC     1000.175625  1 0.0006   626 | 2/25
 20 h-m-p  0.0003 0.0069  63.9004 YC      999.882242  1 0.0009   655 | 2/25
 21 h-m-p  0.0008 0.0118  67.9827 YCCC    999.389309  3 0.0015   688 | 2/25
 22 h-m-p  0.0009 0.0046  58.6370 CYC     999.160945  2 0.0008   719 | 2/25
 23 h-m-p  0.0004 0.0041 130.0664 YCCC    998.691553  3 0.0008   752 | 2/25
 24 h-m-p  0.0006 0.0049 178.8357 CCC     998.050981  2 0.0008   784 | 2/25
 25 h-m-p  0.0009 0.0044  35.9672 YCC     997.971208  2 0.0006   815 | 2/25
 26 h-m-p  0.0005 0.0162  38.9661 +CCCCC   997.554656  4 0.0026   852 | 2/25
 27 h-m-p  0.4598 3.4238   0.2230 YCCC    996.122191  3 1.0496   885 | 2/25
 28 h-m-p  1.0237 6.6050   0.2286 CYC     995.665384  2 0.9933   939 | 2/25
 29 h-m-p  0.4999 2.4996   0.1113 CCC     995.441384  2 0.6681   994 | 2/25
 30 h-m-p  1.4371 8.0000   0.0517 YCCC    995.299368  3 2.3321  1050 | 2/25
 31 h-m-p  1.6000 8.0000   0.0521 CCC     995.230996  2 2.1529  1105 | 2/25
 32 h-m-p  1.6000 8.0000   0.0273 CCC     995.196909  2 1.7512  1160 | 2/25
 33 h-m-p  1.6000 8.0000   0.0108 CC      995.175950  1 2.3118  1213 | 2/25
 34 h-m-p  1.6000 8.0000   0.0076 YC      995.157904  1 2.8554  1265 | 2/25
 35 h-m-p  1.4747 8.0000   0.0146 YC      995.146283  1 2.8636  1317 | 2/25
 36 h-m-p  1.6000 8.0000   0.0087 CC      995.143625  1 1.4879  1370 | 2/25
 37 h-m-p  1.6000 8.0000   0.0063 CC      995.142933  1 1.9152  1423 | 2/25
 38 h-m-p  1.6000 8.0000   0.0065 CC      995.142657  1 2.3887  1476 | 2/25
 39 h-m-p  1.6000 8.0000   0.0064 +C      995.142145  0 6.1797  1528 | 2/25
 40 h-m-p  1.6000 8.0000   0.0188 +YC     995.140846  1 4.9699  1581 | 2/25
 41 h-m-p  1.6000 8.0000   0.0140 CC      995.140466  1 2.2913  1634 | 2/25
 42 h-m-p  1.6000 8.0000   0.0066 C       995.140363  0 1.7347  1685 | 2/25
 43 h-m-p  1.6000 8.0000   0.0012 C       995.140358  0 1.5488  1736 | 2/25
 44 h-m-p  1.6000 8.0000   0.0009 Y       995.140356  0 3.1183  1787 | 2/25
 45 h-m-p  1.6000 8.0000   0.0009 C       995.140355  0 2.5170  1838 | 2/25
 46 h-m-p  1.6000 8.0000   0.0004 C       995.140355  0 2.5119  1889 | 2/25
 47 h-m-p  1.6000 8.0000   0.0004 ++      995.140354  m 8.0000  1940 | 2/25
 48 h-m-p  0.3395 8.0000   0.0091 ++Y     995.140350  0 3.7191  1993 | 2/25
 49 h-m-p  1.6000 8.0000   0.0207 ++      995.140304  m 8.0000  2044 | 2/25
 50 h-m-p  0.0109 0.0885  15.1864 ++      995.140014  m 0.0885  2095 | 3/25
 51 h-m-p  0.1026 8.0000   0.0017 +Y      995.140004  0 1.0019  2124 | 3/25
 52 h-m-p  1.6000 8.0000   0.0004 Y       995.140004  0 1.0267  2174 | 3/25
 53 h-m-p  1.6000 8.0000   0.0000 Y       995.140004  0 1.1385  2224 | 3/25
 54 h-m-p  1.6000 8.0000   0.0000 C       995.140004  0 2.3691  2274 | 3/25
 55 h-m-p  1.6000 8.0000   0.0000 -C      995.140004  0 0.1000  2325 | 3/25
 56 h-m-p  0.1051 8.0000   0.0000 C       995.140004  0 0.1051  2375 | 3/25
 57 h-m-p  0.1175 8.0000   0.0000 ------Y   995.140004  0 0.0000  2431
Out..
lnL  =  -995.140004
2432 lfun, 29184 eigenQcodon, 535040 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1005.648655  S =  -968.725178   -29.258674
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  98 patterns   5:07
	did  20 /  98 patterns   5:08
	did  30 /  98 patterns   5:08
	did  40 /  98 patterns   5:08
	did  50 /  98 patterns   5:08
	did  60 /  98 patterns   5:08
	did  70 /  98 patterns   5:09
	did  80 /  98 patterns   5:09
	did  90 /  98 patterns   5:09
	did  98 /  98 patterns   5:09
Time used:  5:09
CodeML output code: -1
Download 
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=15, Len=127 

gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                                 GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                          GVALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              GAVFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                         GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A   GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKVAAAQLPE
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              GAAFRVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                           GAALGVMDALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                           GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAPLPE
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                     GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPE
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A         GAAFGVIEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            GATFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
                                                                                                                                                       *..: *::**********************************.*** :**

gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                                 TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                          TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                         TLETIMLLGLLGTVSLGIFFLLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A   TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                              TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              TLETIMLLGLLGTVSLGVFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                           TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                           TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFEMVTLGASAWLMWLSEI
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                     TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A         TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
                                                                                                                                                       *****************:**:******:***** ****************

gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                                 EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                          EPARIACVLIVVFLLLVVLIPEPEKQR
gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                         EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A   EPARIACVLIVVFLLLVVLIPEPEKQR
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                              EPARIACVLIVVFLLLVVLIPEPEKQR
gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A              EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                           EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                           EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            EPARIACVLIVVFLLLVVLIPEPEKQR
gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                     EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A         EPARIACVLIVVFLLLVVLIPEPEKQR
gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                                            EPARIACVLIVVFLLLVVLIPEPEKQR
                                                                                                                                                       ***************************
Download 
>gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGGGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGTGGCTTTAGGAGTAATGGAGGCCCTGGGAACATTGCCAGGACACAT
GACAGAGAGGTTTCAGGAGGCCATTGACAATCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGCAGGCCTTACAAGGCAGCGGCAGCCCAACTGCCGGAG
ACCCTAGAGACCATCATGCTCTTAGGCTTGTTGGGAACAGTTTCGTTGGG
GATCTTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGTTTTG
GAATGGTAACTCTTGGGGCCAGTGCATGGCTCATGTGGCTTTCGGAAATT
GAACCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCTTGTTACTGGT
GGTACTCATACCCGAGCCAGAGAAGCAAAGA
>gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGTTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGTTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTTGGAGTGATGGAAGCCTTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCCTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGTCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATCATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTTATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACTATCATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATGGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGAGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AGTCTTCTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACCCTTGGGGCCAGTGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTTAGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACCCTTGGGGCCAGTGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTGGGAGTGATGGATGCCCTGGGAACATTGCCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGACAATCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGTAGGCCCTACAAAGCAGCGGCAGCTCAACTGCCGGAG
ACCCTAGAGACCATCATGCTTTTGGGCTTATTGGGAACAGTTTCGCTAGG
AATCTTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGCTTCG
GAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTTTCGGAAATT
GAACCAGCCAGAATCGCATGTGTCCTCATTGTCGTGTTTTTGTTACTGGT
GGTGCTCATACCCGAGCCAGAGAAGCAAAGA
>gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTGCCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGACAATCTCGCTGTGCTTATGCGAG
CAGAAACTGGAAGCAGGCCTTACAAGGCAGCGGCAGCCCCACTGCCGGAG
ACCCTAGAGACCATCATGCTCTTAGGTTTGCTGGGAACAGTTTCGTTGGG
GATATTCTTTGTCTTGATGCGGAACAAGGGCATCGGGAAGATGGGGTTTG
GAATGGTAACTCTTGGGGCCAGTGCATGGCTCATGTGGCTTTCGGAAATT
GAACCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTTTTGTTACTGGT
GGTACTCATACCTGAGCCAGAGAAGCAAAGA
>gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTACCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGATAACCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGCAGGCCCTACAAGGCAGCGGCAGCCCAATTGCCGGAG
ACCCTAGAGACCATCATGCTTTTAGGCCTGCTGGGAACAGTATCGCTGGG
GATCTTTTTTGTCTTGATGAGGAACAAGGGCATCGGGAAGATGGGCTTTG
GAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCAGAAATC
GAACCAGCCAGAATTGCATGTGTCCTTATTGTTGTGTTTTTATTACTGGT
GGTGCTAATACCAGAGCCAGAGAAGCAAAGA
>gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTTTGGGAGTAATGGAGGCCCTGGGAACATTACCAGGACACAT
GACAGAGAGGTTTCAGGAAGCCATTGATAACCTCGCTGTGCTCATGCGAG
CAGAGACTGGAAGCAGGCCCTACAAGGCAGCGGCAGCCCAATTGCCGGAG
ACCCTAGAGACCATCATGCTTTTAGGCCTGCTGGGAACAGTATCGCTGGG
GATCTTTTTTGTCTTGATGAGGAACAAGGGCATCGGGAAGATGGGCTTTG
AAATGGTAACCCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCAGAAATC
GAACCAGCCAGAATTGCATGTGTCCTTATTGTTGTGTTTTTATTACTGGT
GGTGCTAATACCAGAGCCAGAGAAGCAAAGA
>gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCTCTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAAATGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTAGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGGCCTTTGGAGTGATAGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCCTAGAGACCATTATGCTTTTGGGGTTGCTGGGAACAGTCTCGCTGGG
AATCTTTTTCGTCTTGATGCGGAACAAGGGCATGGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTTATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTCGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
>gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GGAGCGACTTTTGGAGTGATGGAAGCCCTGGGAACACTGCCAGGACACAT
GACAGAGAGATTCCAGGAAGCCATTGACAACCTCGCTGTGCTCATGCGGG
CAGAGACTGGAAGCAGGCCTTACAAAGCCGCGGCGGCCCAATTGCCGGAG
ACCTTAGAGACCATTATGCTTTTGGGATTGCTGGGAACAGTCTCGTTGGG
AATCTTTTTCGTCTTGATGAGGAACAAGGGCATAGGGAAGATGGGCTTTG
GAATGGTGACTCTTGGGGCCAGCGCATGGCTCATGTGGCTCTCGGAAATT
GAGCCAGCCAGAATTGCATGTGTCCTCATTGTTGTGTTCCTATTGCTGGT
GGTGCTCATACCTGAGCCAGAAAAGCAAAGA
Download 
>gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GVALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAVFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFLLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKVAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGVFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFRVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAALGVMDALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAPLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFEMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAALGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQMPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GAAFGVIEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGMGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
>gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A
GATFGVMEALGTLPGHMTERFQEAIDNLAVLMRAETGSRPYKAAAAQLPE
TLETIMLLGLLGTVSLGIFFVLMRNKGIGKMGFGMVTLGASAWLMWLSEI
EPARIACVLIVVFLLLVVLIPEPEKQR
Download 
Reading sequence file aligned.fasta
Allocating space for 15 taxa and 381 sites
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig):  5.9%
Found 46 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to:      Phi.inf.list
Using a window size of 100 with k as 12

Calculating analytical mean and variance

Doing permutation test for PHI

Doing permutation test for NSS

Doing Permutation test for MAXCHI

 Writing  alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 50 polymorphic sites

       p-Value(s)
       ----------

NSS:                 4.89e-01  (1000 permutations)
Max Chi^2:           4.02e-01  (1000 permutations)
PHI (Permutation):   7.80e-01  (1000 permutations)
PHI (Normal):        7.45e-01
Download 
#NEXUS

[ID: 5648014110]
begin taxa;
	dimensions ntax=15;
	taxlabels
		gb_KX197205|Organism_Zika_virus|Strain_Name_9|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KF268948|Organism_Zika_virus|Strain_Name_ARB13565|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_MF574563|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KY967711|Organism_Zika_virus|Strain_Name_SY01_2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KY014301|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_LC219720|Organism_Zika_virus|Strain_Name_ZIKV/Hu/NIID123/2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_MF434518|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KY765323|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KF383116|Organism_Zika_virus|Strain_Name_ArD7117|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KF383115|Organism_Zika_virus|Strain_Name_ArB1362|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KY288905|Organism_Zika_virus|Strain_Name_MP1751|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_DQ859059|Organism_Zika_virus|Strain_Name_MR_766|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KX520666|Organism_Zika_virus|Strain_Name_HS-2015-BA-01|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KU681082|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		gb_KU926310|Organism_Zika_virus|Strain_Name_Rio-S1|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		;
end;
begin trees;
	translate
		1	gb_KX197205|Organism_Zika_virus|Strain_Name_9|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		2	gb_KF268948|Organism_Zika_virus|Strain_Name_ARB13565|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		3	gb_MF574563|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		4	gb_KY967711|Organism_Zika_virus|Strain_Name_SY01_2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		5	gb_KY014301|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		6	gb_LC219720|Organism_Zika_virus|Strain_Name_ZIKV/Hu/NIID123/2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		7	gb_MF434518|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		8	gb_KY765323|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		9	gb_KF383116|Organism_Zika_virus|Strain_Name_ArD7117|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		10	gb_KF383115|Organism_Zika_virus|Strain_Name_ArB1362|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		11	gb_KY288905|Organism_Zika_virus|Strain_Name_MP1751|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		12	gb_DQ859059|Organism_Zika_virus|Strain_Name_MR_766|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		13	gb_KX520666|Organism_Zika_virus|Strain_Name_HS-2015-BA-01|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		14	gb_KU681082|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A,
		15	gb_KU926310|Organism_Zika_virus|Strain_Name_Rio-S1|Protein_Name_nonstructural_protein_NS4A|Gene_Symbol_NS4A
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.00785351,3:0.0108358,4:0.01362514,5:0.01499126,6:0.02035929,13:0.01969159,14:0.0318342,15:0.02032372,(((2:0.02869702,10:0.05006983)0.835:0.03531156,(11:0.004190296,12:0.006976689)1.000:0.1267264)0.654:0.04745938,9:0.08714089)1.000:0.2487915,(7:0.013494,8:0.008249222)0.804:0.01283524);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.00785351,3:0.0108358,4:0.01362514,5:0.01499126,6:0.02035929,13:0.01969159,14:0.0318342,15:0.02032372,(((2:0.02869702,10:0.05006983):0.03531156,(11:0.004190296,12:0.006976689):0.1267264):0.04745938,9:0.08714089):0.2487915,(7:0.013494,8:0.008249222):0.01283524);
end;
Download 
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1050.21         -1075.91
2      -1050.05         -1072.20
--------------------------------------
TOTAL    -1050.13         -1075.25
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.913767    0.026454    0.624029    1.226554    0.898020    940.90   1062.67    1.000
r(A<->C){all}   0.057728    0.000642    0.013258    0.106729    0.054569    529.66    678.22    1.003
r(A<->G){all}   0.207911    0.003861    0.102718    0.335829    0.199671    428.35    503.76    1.000
r(A<->T){all}   0.032969    0.000552    0.000435    0.078369    0.028455    713.64    807.09    1.000
r(C<->G){all}   0.011547    0.000074    0.000027    0.028464    0.009543   1049.23   1081.38    1.000
r(C<->T){all}   0.674395    0.005487    0.529492    0.809976    0.680316    407.14    448.06    1.001
r(G<->T){all}   0.015451    0.000132    0.000007    0.036776    0.012971    644.23    754.25    1.000
pi(A){all}      0.233651    0.000408    0.195184    0.273377    0.233196   1023.61   1052.37    1.000
pi(C){all}      0.244033    0.000392    0.204434    0.280834    0.244127   1315.36   1393.43    1.000
pi(G){all}      0.303099    0.000506    0.259430    0.346529    0.302280   1292.48   1319.86    1.000
pi(T){all}      0.219217    0.000371    0.181349    0.256908    0.218607   1218.61   1327.43    1.000
alpha{1,2}      0.120002    0.000877    0.071618    0.186986    0.117182    996.51   1177.06    1.000
alpha{3}        2.150370    0.632498    0.830984    3.726351    2.011461   1276.47   1299.67    1.000
pinvar{all}     0.344839    0.007672    0.175451    0.510316    0.349935    941.49   1131.98    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
Download 
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS1/ZikaADOPSresults/NS4A/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =  15  ls = 127

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   3   3   3   3   3   3 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   1   1   1   1   1   1
    TTC   3   2   3   3   3   3 |     TCC   0   0   0   0   0   0 |     TAC   1   1   1   1   1   1 |     TGC   0   0   0   0   0   0
Leu TTA   0   3   0   0   0   0 |     TCA   0   0   0   0   0   0 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   5   6   6   6   5   5 |     TCG   2   2   2   2   2   2 |     TAG   0   0   0   0   0   0 | Trp TGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   2   2   2   2   3   2 | Pro CCT   2   1   2   2   2   2 | His CAT   0   0   0   0   0   0 | Arg CGT   0   0   0   0   0   0
    CTC   6   6   6   7   5   6 |     CCC   0   1   0   0   0   0 |     CAC   1   1   1   1   1   1 |     CGC   0   0   0   0   0   0
    CTA   2   1   2   2   2   2 |     CCA   3   3   3   3   3   3 | Gln CAA   2   2   2   2   2   2 |     CGA   0   1   0   0   0   0
    CTG   5   3   4   4   5   5 |     CCG   1   1   1   1   1   1 |     CAG   1   1   1   1   1   1 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   5   4   5   5   4   4 | Thr ACT   2   2   2   2   2   3 | Asn AAT   0   1   0   0   0   0 | Ser AGT   0   1   0   0   0   0
    ATC   1   3   1   1   2   2 |     ACC   2   2   2   2   2   1 |     AAC   2   1   2   2   2   2 |     AGC   2   1   2   2   2   2
    ATA   2   1   2   2   2   1 |     ACA   3   3   3   3   3   3 | Lys AAA   1   0   1   1   1   1 | Arg AGA   3   2   3   3   3   3
Met ATG   8   8   8   8   8   9 |     ACG   0   0   0   0   0   0 |     AAG   3   4   3   3   3   3 |     AGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   2   2   1   1   1 | Ala GCT   2   2   1   2   2   2 | Asp GAT   0   0   0   0   0   0 | Gly GGT   0   1   0   0   0   0
    GTC   3   2   3   2   4   3 |     GCC   6   5   6   6   5   6 |     GAC   1   1   1   1   1   1 |     GGC   2   2   2   2   2   2
    GTA   0   3   0   0   0   0 |     GCA   3   5   3   3   3   3 | Glu GAA   4   2   4   4   4   4 |     GGA   7   7   8   8   8   9
    GTG   6   4   6   6   6   6 |     GCG   3   1   3   3   3   3 |     GAG   6   8   6   6   6   6 |     GGG   4   3   3   3   3   2
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   2   3   3   4   5   5 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   1   1   1   1   1   1
    TTC   4   3   2   1   0   0 |     TCC   0   0   0   0   0   0 |     TAC   1   1   1   1   1   1 |     TGC   0   0   0   0   0   0
Leu TTA   0   0   2   2   4   4 |     TCA   0   0   0   0   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   5   5   6   6   3   3 |     TCG   2   2   2   2   1   1 |     TAG   0   0   0   0   0   0 | Trp TGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   2   2   3   3   3   3 | Pro CCT   2   2   0   2   0   0 | His CAT   0   0   0   0   0   0 | Arg CGT   0   0   0   0   0   0
    CTC   6   6   5   5   4   4 |     CCC   0   0   2   0   1   1 |     CAC   1   1   1   1   1   1 |     CGC   0   0   0   0   0   0
    CTA   2   2   2   1   2   2 |     CCA   3   3   3   4   4   4 | Gln CAA   2   2   2   1   2   2 |     CGA   0   0   1   1   1   1
    CTG   5   5   3   4   5   5 |     CCG   1   1   1   1   1   1 |     CAG   1   1   1   1   1   1 |     CGG   1   1   1   1   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   5   5   3   4   3   3 | Thr ACT   1   1   1   2   1   1 | Asn AAT   0   0   1   1   0   0 | Ser AGT   1   1   1   1   0   0
    ATC   0   1   4   2   4   4 |     ACC   3   3   3   2   3   3 |     AAC   2   2   1   1   2   2 |     AGC   1   1   1   1   2   2
    ATA   2   2   1   2   1   1 |     ACA   3   3   3   3   3   3 | Lys AAA   1   1   1   0   0   0 | Arg AGA   3   4   2   2   2   2
Met ATG   8   8   8   8   8   8 |     ACG   0   0   0   0   0   0 |     AAG   3   3   3   4   4   4 |     AGG   2   2   2   2   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   1   1   2   1   1 | Ala GCT   2   2   3   2   2   2 | Asp GAT   0   0   1   0   1   1 | Gly GGT   0   0   0   1   0   0
    GTC   4   3   3   2   2   2 |     GCC   6   6   4   5   5   5 |     GAC   1   1   1   1   0   0 |     GGC   2   2   3   1   3   3
    GTA   0   0   1   3   3   3 |     GCA   3   3   5   5   5   5 | Glu GAA   4   4   3   4   3   4 |     GGA   8   7   8   7   7   6
    GTG   6   6   5   3   4   4 |     GCG   3   3   2   2   2   2 |     GAG   6   6   6   6   7   7 |     GGG   3   3   2   4   3   3
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------
Phe TTT   2   3   3 | Ser TCT   0   0   0 | Tyr TAT   0   0   0 | Cys TGT   1   1   1
    TTC   3   3   3 |     TCC   0   0   0 |     TAC   1   1   1 |     TGC   0   0   0
Leu TTA   0   0   1 |     TCA   0   0   0 | *** TAA   0   0   0 | *** TGA   0   0   0
    TTG   4   5   6 |     TCG   2   2   2 |     TAG   0   0   0 | Trp TGG   2   2   2
--------------------------------------------------------------------------------------
Leu CTT   3   3   2 | Pro CCT   2   2   2 | His CAT   0   0   0 | Arg CGT   0   0   0
    CTC   6   5   6 |     CCC   0   0   0 |     CAC   1   1   1 |     CGC   0   0   0
    CTA   3   2   1 |     CCA   3   3   3 | Gln CAA   2   2   2 |     CGA   0   0   0
    CTG   4   5   4 |     CCG   1   1   1 |     CAG   1   1   1 |     CGG   1   2   1
--------------------------------------------------------------------------------------
Ile ATT   5   5   5 | Thr ACT   2   2   3 | Asn AAT   0   0   0 | Ser AGT   0   0   0
    ATC   1   1   1 |     ACC   2   2   2 |     AAC   2   2   2 |     AGC   2   2   2
    ATA   2   2   2 |     ACA   3   3   3 | Lys AAA   1   1   1 | Arg AGA   3   3   3
Met ATG   9   8   8 |     ACG   0   0   0 |     AAG   3   3   3 |     AGG   2   1   2
--------------------------------------------------------------------------------------
Val GTT   1   0   1 | Ala GCT   2   1   1 | Asp GAT   0   0   0 | Gly GGT   0   0   0
    GTC   3   4   3 |     GCC   6   7   6 |     GAC   1   1   1 |     GGC   2   2   2
    GTA   0   0   0 |     GCA   3   3   3 | Glu GAA   4   4   4 |     GGA   8   8   9
    GTG   6   6   6 |     GCG   3   3   3 |     GAG   6   6   6 |     GGG   3   3   2
--------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.13386    C:0.20472    A:0.28346    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.23622    G:0.38583
Average         T:0.22835    C:0.22310    A:0.23097    G:0.31759

#2: gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.15748    C:0.18898    A:0.27559    G:0.37795
position  2:    T:0.41732    C:0.22047    A:0.17323    G:0.18898
position  3:    T:0.15748    C:0.22047    A:0.25984    G:0.36220
Average         T:0.24409    C:0.20997    A:0.23622    G:0.30971

#3: gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.14173    C:0.19685    A:0.28346    G:0.37795
position  2:    T:0.41732    C:0.22047    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.24409    G:0.37795
Average         T:0.23360    C:0.21785    A:0.23360    G:0.31496

#4: gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.14173    C:0.20472    A:0.28346    G:0.37008
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.24409    G:0.37795
Average         T:0.23097    C:0.22310    A:0.23360    G:0.31234

#5: gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.13386    C:0.20472    A:0.28346    G:0.37795
position  2:    T:0.41732    C:0.22047    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.24409    G:0.37795
Average         T:0.23097    C:0.22047    A:0.23360    G:0.31496

#6: gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.13386    C:0.20472    A:0.28346    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.24409    G:0.37795
Average         T:0.22835    C:0.22310    A:0.23360    G:0.31496

#7: gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.13386    C:0.20472    A:0.27559    G:0.38583
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.13386    C:0.24409    A:0.24409    G:0.37795
Average         T:0.22572    C:0.22572    A:0.23097    G:0.31759

#8: gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.13386    C:0.20472    A:0.29134    G:0.37008
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.24409    G:0.37795
Average         T:0.22835    C:0.22310    A:0.23622    G:0.31234

#9: gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A             
position  1:    T:0.14961    C:0.19685    A:0.27559    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.24409    A:0.26772    G:0.34646
Average         T:0.23360    C:0.22310    A:0.23885    G:0.30446

#10: gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A            
position  1:    T:0.14961    C:0.19685    A:0.27559    G:0.37795
position  2:    T:0.40945    C:0.23622    A:0.16535    G:0.18898
position  3:    T:0.18110    C:0.18110    A:0.27559    G:0.36220
Average         T:0.24672    C:0.20472    A:0.23885    G:0.30971

#11: gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A            
position  1:    T:0.14173    C:0.19685    A:0.28346    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.13386    C:0.22047    A:0.29921    G:0.34646
Average         T:0.22835    C:0.21522    A:0.25197    G:0.30446

#12: gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A            
position  1:    T:0.14173    C:0.19685    A:0.28346    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.18110    G:0.18110
position  3:    T:0.13386    C:0.22047    A:0.29921    G:0.34646
Average         T:0.22835    C:0.21522    A:0.25459    G:0.30184

#13: gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A            
position  1:    T:0.11811    C:0.21260    A:0.29134    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.25197    G:0.37008
Average         T:0.22310    C:0.22572    A:0.23885    G:0.31234

#14: gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A            
position  1:    T:0.13386    C:0.21260    A:0.27559    G:0.37795
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.13386    C:0.24409    A:0.24409    G:0.37795
Average         T:0.22572    C:0.22835    A:0.23097    G:0.31496

#15: gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A            
position  1:    T:0.14961    C:0.18898    A:0.29134    G:0.37008
position  2:    T:0.40945    C:0.22835    A:0.17323    G:0.18898
position  3:    T:0.14173    C:0.23622    A:0.25197    G:0.37008
Average         T:0.23360    C:0.21785    A:0.23885    G:0.30971

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      48 | Ser S TCT       0 | Tyr Y TAT       0 | Cys C TGT      15
      TTC      36 |       TCC       0 |       TAC      15 |       TGC       0
Leu L TTA      16 |       TCA       2 | *** * TAA       0 | *** * TGA       0
      TTG      76 |       TCG      28 |       TAG       0 | Trp W TGG      30
------------------------------------------------------------------------------
Leu L CTT      37 | Pro P CCT      23 | His H CAT       0 | Arg R CGT       0
      CTC      83 |       CCC       5 |       CAC      15 |       CGC       0
      CTA      28 |       CCA      48 | Gln Q CAA      29 |       CGA       5
      CTG      66 |       CCG      15 |       CAG      15 |       CGG      14
------------------------------------------------------------------------------
Ile I ATT      65 | Thr T ACT      27 | Asn N AAT       3 | Ser S AGT       5
      ATC      28 |       ACC      34 |       AAC      27 |       AGC      25
      ATA      25 |       ACA      45 | Lys K AAA      11 | Arg R AGA      41
Met M ATG     122 |       ACG       0 |       AAG      49 |       AGG      31
------------------------------------------------------------------------------
Val V GTT      17 | Ala A GCT      28 | Asp D GAT       3 | Gly G GGT       2
      GTC      43 |       GCC      84 |       GAC      13 |       GGC      32
      GTA      13 |       GCA      55 | Glu E GAA      56 |       GGA     115
      GTG      80 |       GCG      39 |       GAG      94 |       GGG      44
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.13963    C:0.20105    A:0.28241    G:0.37690
position  2:    T:0.41102    C:0.22730    A:0.17323    G:0.18845
position  3:    T:0.14331    C:0.23097    A:0.25669    G:0.36903
Average         T:0.23132    C:0.21977    A:0.23745    G:0.31146


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.0136 (0.0071 0.5179)
gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.1669 (0.0035 0.0211) 0.0221 (0.0106 0.4794)
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.1669 (0.0035 0.0211) 0.0204 (0.0106 0.5200) 0.3334 (0.0070 0.0211)
gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.1110 (0.0035 0.0317) 0.0213 (0.0106 0.4972) 0.2217 (0.0071 0.0318) 0.2217 (0.0071 0.0318)
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.0823 (0.0035 0.0428) 0.0212 (0.0106 0.4994) 0.1643 (0.0070 0.0429) 0.1643 (0.0070 0.0429) 0.2217 (0.0071 0.0318)
gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.0828 (0.0035 0.0426) 0.0223 (0.0106 0.4761) 0.1655 (0.0071 0.0427) 0.1655 (0.0071 0.0427) 0.1320 (0.0071 0.0536) 0.1087 (0.0071 0.0650)
gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.1107 (0.0035 0.0318) 0.0213 (0.0106 0.4984) 0.2211 (0.0071 0.0319) 0.2211 (0.0071 0.0319) 0.1653 (0.0071 0.0427) 0.1307 (0.0071 0.0539) 0.6773 (0.0071 0.0104)
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                   0.0143 (0.0071 0.4956) 0.0274 (0.0071 0.2577) 0.0213 (0.0106 0.4975) 0.0213 (0.0106 0.4975) 0.0223 (0.0106 0.4755) 0.0222 (0.0106 0.4776) 0.0234 (0.0106 0.4551) 0.0223 (0.0106 0.4767)
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  0.0132 (0.0071 0.5344) 0.0634 (0.0071 0.1114) 0.0214 (0.0106 0.4953) 0.0198 (0.0106 0.5365) 0.0207 (0.0106 0.5133) 0.0206 (0.0106 0.5156) 0.0216 (0.0106 0.4918) 0.0206 (0.0106 0.5146) 0.0235 (0.0071 0.3008)
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  0.0078 (0.0035 0.4548) 0.0106 (0.0035 0.3336) 0.0155 (0.0071 0.4565) 0.0155 (0.0071 0.4565) 0.0162 (0.0071 0.4358) 0.0161 (0.0071 0.4377) 0.0156 (0.0071 0.4534) 0.0162 (0.0071 0.4369) 0.0101 (0.0035 0.3487) 0.0107 (0.0035 0.3312)
gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  0.0154 (0.0071 0.4571) 0.0211 (0.0071 0.3351) 0.0231 (0.0106 0.4588) 0.0231 (0.0106 0.4588) 0.0242 (0.0106 0.4380) 0.0241 (0.0106 0.4398) 0.0233 (0.0106 0.4557) 0.0242 (0.0106 0.4390) 0.0202 (0.0071 0.3503) 0.0213 (0.0071 0.3327)-1.0000 (0.0035 0.0000)
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  0.3359 (0.0071 0.0210) 0.0205 (0.0106 0.5179) 0.5032 (0.0106 0.0211) 0.5032 (0.0106 0.0211) 0.3345 (0.0106 0.0317) 0.2480 (0.0106 0.0428) 0.2497 (0.0106 0.0426) 0.3337 (0.0106 0.0318) 0.0214 (0.0106 0.4956) 0.0199 (0.0106 0.5344) 0.0149 (0.0071 0.4740) 0.0223 (0.0106 0.4764)
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  0.1322 (0.0071 0.0535) 0.0276 (0.0142 0.5149) 0.1981 (0.0106 0.0536) 0.1981 (0.0106 0.0536) 0.2504 (0.0106 0.0425) 0.0462 (0.0035 0.0762) 0.1403 (0.0106 0.0758) 0.1641 (0.0106 0.0648) 0.0313 (0.0142 0.4540) 0.0268 (0.0142 0.5313) 0.0217 (0.0106 0.4909) 0.0288 (0.0142 0.4934) 0.2657 (0.0142 0.0535)
gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A                  0.0820 (0.0035 0.0429) 0.0211 (0.0106 0.5010) 0.3324 (0.0070 0.0212) 0.1638 (0.0070 0.0430) 0.1307 (0.0071 0.0540) 0.1076 (0.0070 0.0655) 0.1084 (0.0071 0.0651) 0.1303 (0.0070 0.0541) 0.0204 (0.0106 0.5196) 0.0205 (0.0106 0.5173) 0.0148 (0.0071 0.4773) 0.0221 (0.0106 0.4797) 0.2472 (0.0106 0.0429) 0.1390 (0.0106 0.0764)


Model 0: one-ratio


TREE #  1:  (1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
lnL(ntime: 20  np: 22):   -997.108451      +0.000000
  16..1    16..3    16..4    16..5    16..6    16..13   16..14   16..15   16..17   17..18   18..19   19..2    19..10   18..20   20..11   20..12   17..9    16..21   21..7    21..8  
 0.008468 0.016963 0.017071 0.025632 0.034458 0.025919 0.052467 0.034476 0.292468 0.012546 0.055472 0.046254 0.063217 0.159887 0.000004 0.008144 0.122678 0.017002 0.017047 0.008548 8.766677 0.068265

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.01872

(1: 0.008468, 3: 0.016963, 4: 0.017071, 5: 0.025632, 6: 0.034458, 13: 0.025919, 14: 0.052467, 15: 0.034476, (((2: 0.046254, 10: 0.063217): 0.055472, (11: 0.000004, 12: 0.008144): 0.159887): 0.012546, 9: 0.122678): 0.292468, (7: 0.017047, 8: 0.008548): 0.017002);

(gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008468, gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.016963, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017071, gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025632, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034458, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025919, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.052467, gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034476, (((gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.046254, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.063217): 0.055472, (gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.000004, gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008144): 0.159887): 0.012546, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.122678): 0.292468, (gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017047, gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008548): 0.017002);

Detailed output identifying parameters

kappa (ts/tv) =  8.76668

omega (dN/dS) =  0.06827

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1      0.008   260.8   120.2  0.0683  0.0005  0.0078   0.1   0.9
  16..3      0.017   260.8   120.2  0.0683  0.0011  0.0156   0.3   1.9
  16..4      0.017   260.8   120.2  0.0683  0.0011  0.0157   0.3   1.9
  16..5      0.026   260.8   120.2  0.0683  0.0016  0.0236   0.4   2.8
  16..6      0.034   260.8   120.2  0.0683  0.0022  0.0317   0.6   3.8
  16..13     0.026   260.8   120.2  0.0683  0.0016  0.0239   0.4   2.9
  16..14     0.052   260.8   120.2  0.0683  0.0033  0.0483   0.9   5.8
  16..15     0.034   260.8   120.2  0.0683  0.0022  0.0317   0.6   3.8
  16..17     0.292   260.8   120.2  0.0683  0.0184  0.2692   4.8  32.4
  17..18     0.013   260.8   120.2  0.0683  0.0008  0.0115   0.2   1.4
  18..19     0.055   260.8   120.2  0.0683  0.0035  0.0511   0.9   6.1
  19..2      0.046   260.8   120.2  0.0683  0.0029  0.0426   0.8   5.1
  19..10     0.063   260.8   120.2  0.0683  0.0040  0.0582   1.0   7.0
  18..20     0.160   260.8   120.2  0.0683  0.0100  0.1472   2.6  17.7
  20..11     0.000   260.8   120.2  0.0683  0.0000  0.0000   0.0   0.0
  20..12     0.008   260.8   120.2  0.0683  0.0005  0.0075   0.1   0.9
  17..9      0.123   260.8   120.2  0.0683  0.0077  0.1129   2.0  13.6
  16..21     0.017   260.8   120.2  0.0683  0.0011  0.0156   0.3   1.9
  21..7      0.017   260.8   120.2  0.0683  0.0011  0.0157   0.3   1.9
  21..8      0.009   260.8   120.2  0.0683  0.0005  0.0079   0.1   0.9

tree length for dN:       0.0640
tree length for dS:       0.9377


Time used:  0:10


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
lnL(ntime: 20  np: 23):   -995.469169      +0.000000
  16..1    16..3    16..4    16..5    16..6    16..13   16..14   16..15   16..17   17..18   18..19   19..2    19..10   18..20   20..11   20..12   17..9    16..21   21..7    21..8  
 0.008535 0.017104 0.017228 0.025847 0.034681 0.026109 0.052688 0.034780 0.300918 0.012638 0.056304 0.046909 0.064374 0.163153 0.000004 0.008267 0.124978 0.017183 0.017219 0.008583 9.028394 0.956867 0.041406

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.03750

(1: 0.008535, 3: 0.017104, 4: 0.017228, 5: 0.025847, 6: 0.034681, 13: 0.026109, 14: 0.052688, 15: 0.034780, (((2: 0.046909, 10: 0.064374): 0.056304, (11: 0.000004, 12: 0.008267): 0.163153): 0.012638, 9: 0.124978): 0.300918, (7: 0.017219, 8: 0.008583): 0.017183);

(gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008535, gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017104, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017228, gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025847, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034681, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.026109, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.052688, gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034780, (((gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.046909, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.064374): 0.056304, (gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.000004, gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008267): 0.163153): 0.012638, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.124978): 0.300918, (gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017219, gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008583): 0.017183);

Detailed output identifying parameters

kappa (ts/tv) =  9.02839


dN/dS (w) for site classes (K=2)

p:   0.95687  0.04313
w:   0.04141  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.009    260.7    120.3   0.0828   0.0006   0.0076    0.2    0.9
  16..3       0.017    260.7    120.3   0.0828   0.0013   0.0153    0.3    1.8
  16..4       0.017    260.7    120.3   0.0828   0.0013   0.0154    0.3    1.9
  16..5       0.026    260.7    120.3   0.0828   0.0019   0.0231    0.5    2.8
  16..6       0.035    260.7    120.3   0.0828   0.0026   0.0311    0.7    3.7
  16..13      0.026    260.7    120.3   0.0828   0.0019   0.0234    0.5    2.8
  16..14      0.053    260.7    120.3   0.0828   0.0039   0.0472    1.0    5.7
  16..15      0.035    260.7    120.3   0.0828   0.0026   0.0311    0.7    3.7
  16..17      0.301    260.7    120.3   0.0828   0.0223   0.2694    5.8   32.4
  17..18      0.013    260.7    120.3   0.0828   0.0009   0.0113    0.2    1.4
  18..19      0.056    260.7    120.3   0.0828   0.0042   0.0504    1.1    6.1
  19..2       0.047    260.7    120.3   0.0828   0.0035   0.0420    0.9    5.1
  19..10      0.064    260.7    120.3   0.0828   0.0048   0.0576    1.2    6.9
  18..20      0.163    260.7    120.3   0.0828   0.0121   0.1461    3.2   17.6
  20..11      0.000    260.7    120.3   0.0828   0.0000   0.0000    0.0    0.0
  20..12      0.008    260.7    120.3   0.0828   0.0006   0.0074    0.2    0.9
  17..9       0.125    260.7    120.3   0.0828   0.0093   0.1119    2.4   13.5
  16..21      0.017    260.7    120.3   0.0828   0.0013   0.0154    0.3    1.9
  21..7       0.017    260.7    120.3   0.0828   0.0013   0.0154    0.3    1.9
  21..8       0.009    260.7    120.3   0.0828   0.0006   0.0077    0.2    0.9


Time used:  0:27


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
lnL(ntime: 20  np: 25):   -995.469169      +0.000000
  16..1    16..3    16..4    16..5    16..6    16..13   16..14   16..15   16..17   17..18   18..19   19..2    19..10   18..20   20..11   20..12   17..9    16..21   21..7    21..8  
 0.008535 0.017104 0.017228 0.025847 0.034681 0.026109 0.052688 0.034780 0.300919 0.012638 0.056304 0.046909 0.064374 0.163153 0.000004 0.008267 0.124978 0.017183 0.017219 0.008583 9.028393 0.956867 0.010408 0.041406 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.03750

(1: 0.008535, 3: 0.017104, 4: 0.017228, 5: 0.025847, 6: 0.034681, 13: 0.026109, 14: 0.052688, 15: 0.034780, (((2: 0.046909, 10: 0.064374): 0.056304, (11: 0.000004, 12: 0.008267): 0.163153): 0.012638, 9: 0.124978): 0.300919, (7: 0.017219, 8: 0.008583): 0.017183);

(gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008535, gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017104, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017228, gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025847, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034681, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.026109, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.052688, gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034780, (((gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.046909, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.064374): 0.056304, (gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.000004, gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008267): 0.163153): 0.012638, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.124978): 0.300919, (gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017219, gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008583): 0.017183);

Detailed output identifying parameters

kappa (ts/tv) =  9.02839


dN/dS (w) for site classes (K=3)

p:   0.95687  0.01041  0.03272
w:   0.04141  1.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.009    260.7    120.3   0.0828   0.0006   0.0076    0.2    0.9
  16..3       0.017    260.7    120.3   0.0828   0.0013   0.0153    0.3    1.8
  16..4       0.017    260.7    120.3   0.0828   0.0013   0.0154    0.3    1.9
  16..5       0.026    260.7    120.3   0.0828   0.0019   0.0231    0.5    2.8
  16..6       0.035    260.7    120.3   0.0828   0.0026   0.0311    0.7    3.7
  16..13      0.026    260.7    120.3   0.0828   0.0019   0.0234    0.5    2.8
  16..14      0.053    260.7    120.3   0.0828   0.0039   0.0472    1.0    5.7
  16..15      0.035    260.7    120.3   0.0828   0.0026   0.0311    0.7    3.7
  16..17      0.301    260.7    120.3   0.0828   0.0223   0.2694    5.8   32.4
  17..18      0.013    260.7    120.3   0.0828   0.0009   0.0113    0.2    1.4
  18..19      0.056    260.7    120.3   0.0828   0.0042   0.0504    1.1    6.1
  19..2       0.047    260.7    120.3   0.0828   0.0035   0.0420    0.9    5.1
  19..10      0.064    260.7    120.3   0.0828   0.0048   0.0576    1.2    6.9
  18..20      0.163    260.7    120.3   0.0828   0.0121   0.1461    3.2   17.6
  20..11      0.000    260.7    120.3   0.0828   0.0000   0.0000    0.0    0.0
  20..12      0.008    260.7    120.3   0.0828   0.0006   0.0074    0.2    0.9
  17..9       0.125    260.7    120.3   0.0828   0.0093   0.1119    2.4   13.5
  16..21      0.017    260.7    120.3   0.0828   0.0013   0.0154    0.3    1.9
  21..7       0.017    260.7    120.3   0.0828   0.0013   0.0154    0.3    1.9
  21..8       0.009    260.7    120.3   0.0828   0.0006   0.0077    0.2    0.9


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.490  0.196  0.097  0.058  0.040  0.031  0.026  0.023  0.021  0.020

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.017 0.973

sum of density on p0-p1 =   1.000000

Time used:  1:00


Model 3: discrete (3 categories)


TREE #  1:  (1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
lnL(ntime: 20  np: 26):   -995.135008      +0.000000
  16..1    16..3    16..4    16..5    16..6    16..13   16..14   16..15   16..17   17..18   18..19   19..2    19..10   18..20   20..11   20..12   17..9    16..21   21..7    21..8  
 0.008508 0.017045 0.017181 0.025761 0.034606 0.026018 0.052686 0.034653 0.296987 0.012445 0.056033 0.046347 0.063804 0.161508 0.000004 0.008194 0.123879 0.017132 0.017158 0.008563 8.881153 0.231259 0.582748 0.015105 0.015110 0.326437

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.02851

(1: 0.008508, 3: 0.017045, 4: 0.017181, 5: 0.025761, 6: 0.034606, 13: 0.026018, 14: 0.052686, 15: 0.034653, (((2: 0.046347, 10: 0.063804): 0.056033, (11: 0.000004, 12: 0.008194): 0.161508): 0.012445, 9: 0.123879): 0.296987, (7: 0.017158, 8: 0.008563): 0.017132);

(gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008508, gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017045, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017181, gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025761, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034606, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.026018, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.052686, gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034653, (((gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.046347, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.063804): 0.056033, (gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.000004, gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008194): 0.161508): 0.012445, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.123879): 0.296987, (gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017158, gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008563): 0.017132);

Detailed output identifying parameters

kappa (ts/tv) =  8.88115


dN/dS (w) for site classes (K=3)

p:   0.23126  0.58275  0.18599
w:   0.01510  0.01511  0.32644

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.009    260.8    120.2   0.0730   0.0006   0.0078    0.1    0.9
  16..3       0.017    260.8    120.2   0.0730   0.0011   0.0155    0.3    1.9
  16..4       0.017    260.8    120.2   0.0730   0.0011   0.0157    0.3    1.9
  16..5       0.026    260.8    120.2   0.0730   0.0017   0.0235    0.4    2.8
  16..6       0.035    260.8    120.2   0.0730   0.0023   0.0316    0.6    3.8
  16..13      0.026    260.8    120.2   0.0730   0.0017   0.0237    0.5    2.9
  16..14      0.053    260.8    120.2   0.0730   0.0035   0.0480    0.9    5.8
  16..15      0.035    260.8    120.2   0.0730   0.0023   0.0316    0.6    3.8
  16..17      0.297    260.8    120.2   0.0730   0.0198   0.2709    5.2   32.6
  17..18      0.012    260.8    120.2   0.0730   0.0008   0.0113    0.2    1.4
  18..19      0.056    260.8    120.2   0.0730   0.0037   0.0511    1.0    6.1
  19..2       0.046    260.8    120.2   0.0730   0.0031   0.0423    0.8    5.1
  19..10      0.064    260.8    120.2   0.0730   0.0042   0.0582    1.1    7.0
  18..20      0.162    260.8    120.2   0.0730   0.0108   0.1473    2.8   17.7
  20..11      0.000    260.8    120.2   0.0730   0.0000   0.0000    0.0    0.0
  20..12      0.008    260.8    120.2   0.0730   0.0005   0.0075    0.1    0.9
  17..9       0.124    260.8    120.2   0.0730   0.0082   0.1130    2.2   13.6
  16..21      0.017    260.8    120.2   0.0730   0.0011   0.0156    0.3    1.9
  21..7       0.017    260.8    120.2   0.0730   0.0011   0.0156    0.3    1.9
  21..8       0.009    260.8    120.2   0.0730   0.0006   0.0078    0.1    0.9


Naive Empirical Bayes (NEB) analysis
Time used:  1:35


Model 7: beta (10 categories)


TREE #  1:  (1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
lnL(ntime: 20  np: 23):   -995.139976      +0.000000
  16..1    16..3    16..4    16..5    16..6    16..13   16..14   16..15   16..17   17..18   18..19   19..2    19..10   18..20   20..11   20..12   17..9    16..21   21..7    21..8  
 0.008509 0.017049 0.017184 0.025767 0.034613 0.026025 0.052694 0.034661 0.297131 0.012443 0.056039 0.046363 0.063821 0.161558 0.000004 0.008196 0.123915 0.017136 0.017161 0.008565 8.885934 0.193923 2.293294

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.02884

(1: 0.008509, 3: 0.017049, 4: 0.017184, 5: 0.025767, 6: 0.034613, 13: 0.026025, 14: 0.052694, 15: 0.034661, (((2: 0.046363, 10: 0.063821): 0.056039, (11: 0.000004, 12: 0.008196): 0.161558): 0.012443, 9: 0.123915): 0.297131, (7: 0.017161, 8: 0.008565): 0.017136);

(gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008509, gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017049, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017184, gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025767, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034613, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.026025, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.052694, gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034661, (((gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.046363, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.063821): 0.056039, (gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.000004, gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008196): 0.161558): 0.012443, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.123915): 0.297131, (gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017161, gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008565): 0.017136);

Detailed output identifying parameters

kappa (ts/tv) =  8.88593

Parameters in M7 (beta):
 p =   0.19392  q =   2.29329


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00002  0.00027  0.00152  0.00557  0.01586  0.03846  0.08457  0.17866  0.40697

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.009    260.8    120.2   0.0732   0.0006   0.0078    0.1    0.9
  16..3       0.017    260.8    120.2   0.0732   0.0011   0.0155    0.3    1.9
  16..4       0.017    260.8    120.2   0.0732   0.0011   0.0157    0.3    1.9
  16..5       0.026    260.8    120.2   0.0732   0.0017   0.0235    0.4    2.8
  16..6       0.035    260.8    120.2   0.0732   0.0023   0.0316    0.6    3.8
  16..13      0.026    260.8    120.2   0.0732   0.0017   0.0237    0.5    2.9
  16..14      0.053    260.8    120.2   0.0732   0.0035   0.0480    0.9    5.8
  16..15      0.035    260.8    120.2   0.0732   0.0023   0.0316    0.6    3.8
  16..17      0.297    260.8    120.2   0.0732   0.0198   0.2709    5.2   32.6
  17..18      0.012    260.8    120.2   0.0732   0.0008   0.0113    0.2    1.4
  18..19      0.056    260.8    120.2   0.0732   0.0037   0.0511    1.0    6.1
  19..2       0.046    260.8    120.2   0.0732   0.0031   0.0423    0.8    5.1
  19..10      0.064    260.8    120.2   0.0732   0.0043   0.0582    1.1    7.0
  18..20      0.162    260.8    120.2   0.0732   0.0108   0.1473    2.8   17.7
  20..11      0.000    260.8    120.2   0.0732   0.0000   0.0000    0.0    0.0
  20..12      0.008    260.8    120.2   0.0732   0.0005   0.0075    0.1    0.9
  17..9       0.124    260.8    120.2   0.0732   0.0083   0.1130    2.2   13.6
  16..21      0.017    260.8    120.2   0.0732   0.0011   0.0156    0.3    1.9
  21..7       0.017    260.8    120.2   0.0732   0.0011   0.0156    0.3    1.9
  21..8       0.009    260.8    120.2   0.0732   0.0006   0.0078    0.1    0.9


Time used:  3:04


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 3, 4, 5, 6, 13, 14, 15, (((2, 10), (11, 12)), 9), (7, 8));   MP score: 105
lnL(ntime: 20  np: 25):   -995.140004      +0.000000
  16..1    16..3    16..4    16..5    16..6    16..13   16..14   16..15   16..17   17..18   18..19   19..2    19..10   18..20   20..11   20..12   17..9    16..21   21..7    21..8  
 0.008509 0.017049 0.017184 0.025767 0.034613 0.026025 0.052694 0.034661 0.297132 0.012443 0.056040 0.046364 0.063821 0.161559 0.000004 0.008196 0.123916 0.017136 0.017161 0.008565 8.885966 0.999990 0.193945 2.293796 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.02884

(1: 0.008509, 3: 0.017049, 4: 0.017184, 5: 0.025767, 6: 0.034613, 13: 0.026025, 14: 0.052694, 15: 0.034661, (((2: 0.046364, 10: 0.063821): 0.056040, (11: 0.000004, 12: 0.008196): 0.161559): 0.012443, 9: 0.123916): 0.297132, (7: 0.017161, 8: 0.008565): 0.017136);

(gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008509, gb:MF574563|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00025/2015|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017049, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017184, gb:KY014301|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ107D1-URI|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.025767, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034613, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.026025, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.052694, gb:KU926310|Organism:Zika_virus|Strain_Name:Rio-S1|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.034661, (((gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.046364, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.063821): 0.056040, (gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.000004, gb:DQ859059|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008196): 0.161559): 0.012443, gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.123916): 0.297132, (gb:MF434518|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/5256_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.017161, gb:KY765323|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/6188_13A1/2016|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A: 0.008565): 0.017136);

Detailed output identifying parameters

kappa (ts/tv) =  8.88597

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =   0.19395 q =   2.29380
 (p1 =   0.00001) w =   1.00000


dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.00000  0.00002  0.00027  0.00152  0.00557  0.01586  0.03846  0.08456  0.17864  0.40691  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.009    260.8    120.2   0.0732   0.0006   0.0078    0.1    0.9
  16..3       0.017    260.8    120.2   0.0732   0.0011   0.0155    0.3    1.9
  16..4       0.017    260.8    120.2   0.0732   0.0011   0.0157    0.3    1.9
  16..5       0.026    260.8    120.2   0.0732   0.0017   0.0235    0.4    2.8
  16..6       0.035    260.8    120.2   0.0732   0.0023   0.0316    0.6    3.8
  16..13      0.026    260.8    120.2   0.0732   0.0017   0.0237    0.5    2.9
  16..14      0.053    260.8    120.2   0.0732   0.0035   0.0480    0.9    5.8
  16..15      0.035    260.8    120.2   0.0732   0.0023   0.0316    0.6    3.8
  16..17      0.297    260.8    120.2   0.0732   0.0198   0.2709    5.2   32.6
  17..18      0.012    260.8    120.2   0.0732   0.0008   0.0113    0.2    1.4
  18..19      0.056    260.8    120.2   0.0732   0.0037   0.0511    1.0    6.1
  19..2       0.046    260.8    120.2   0.0732   0.0031   0.0423    0.8    5.1
  19..10      0.064    260.8    120.2   0.0732   0.0043   0.0582    1.1    7.0
  18..20      0.162    260.8    120.2   0.0732   0.0108   0.1473    2.8   17.7
  20..11      0.000    260.8    120.2   0.0732   0.0000   0.0000    0.0    0.0
  20..12      0.008    260.8    120.2   0.0732   0.0005   0.0075    0.1    0.9
  17..9       0.124    260.8    120.2   0.0732   0.0083   0.1130    2.2   13.6
  16..21      0.017    260.8    120.2   0.0732   0.0011   0.0156    0.3    1.9
  21..7       0.017    260.8    120.2   0.0732   0.0011   0.0156    0.3    1.9
  21..8       0.009    260.8    120.2   0.0732   0.0006   0.0078    0.1    0.9


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX197205|Organism:Zika_virus|Strain_Name:9|Protein_Name:nonstructural_protein_NS4A|Gene_Symbol:NS4A)

            Pr(w>1)     post mean +- SE for w

     4 F      0.604         1.530 +- 1.328



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   0.998  0.002  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.000  0.004  0.021  0.058  0.115  0.187  0.266  0.348
ws:   0.592  0.185  0.080  0.043  0.027  0.020  0.016  0.013  0.012  0.011

Time used:  5:09
Download 
Model 1: NearlyNeutral	-995.469169
Model 2: PositiveSelection	-995.469169
Model 0: one-ratio	-997.108451
Model 3: discrete	-995.135008
Model 7: beta	-995.139976
Model 8: beta&w>1	-995.140004


Model 0 vs 1	3.2785639999999603

Model 2 vs 1	0.0

Model 8 vs 7	5.599999985861359E-5

i3S

Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal

If you use B+, please cite us:

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3

IBMC INEB IPATIMUP UPORTO