Back

A_NS2B - Muscle

Download 
--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Nov 06 09:53:10 WET 2017
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS1/ZikaADOPSresults/NS2B/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -904.27          -925.97
2       -903.63          -927.56
--------------------------------------
TOTAL     -903.90          -927.05
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.639004    0.015990    0.419493    0.906505    0.625473   1348.01   1390.82    1.000
r(A<->C){all}   0.018753    0.000276    0.000001    0.052068    0.013718    831.05    882.49    1.000
r(A<->G){all}   0.230001    0.006063    0.089098    0.377989    0.218540    446.76    450.49    1.000
r(A<->T){all}   0.036823    0.000523    0.000011    0.079758    0.032966    665.85    721.72    1.000
r(C<->G){all}   0.009590    0.000093    0.000009    0.029294    0.006596    707.32    805.62    1.000
r(C<->T){all}   0.683478    0.006952    0.508932    0.829203    0.693081    461.91    471.71    1.000
r(G<->T){all}   0.021355    0.000200    0.000300    0.049219    0.018235    635.30    775.41    1.000
pi(A){all}      0.243873    0.000431    0.204210    0.283840    0.243135   1097.04   1176.01    1.000
pi(C){all}      0.216653    0.000377    0.177427    0.254164    0.216464   1185.07   1226.07    1.000
pi(G){all}      0.311179    0.000510    0.267705    0.354263    0.311046   1228.84   1276.25    1.001
pi(T){all}      0.228295    0.000374    0.192951    0.268616    0.227818   1202.69   1289.14    1.000
alpha{1,2}      0.059861    0.001397    0.000124    0.121779    0.058562   1035.93   1208.68    1.003
alpha{3}        2.104398    0.644336    0.770742    3.624669    1.975276   1501.00   1501.00    1.000
pinvar{all}     0.307640    0.010609    0.089628    0.493936    0.314192    880.18    965.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-858.704058
Model 2: PositiveSelection	-858.704058
Model 0: one-ratio	-859.067805
Model 3: discrete	-858.309693
Model 7: beta	-858.363478
Model 8: beta&w>1	-858.363546


Model 0 vs 1	0.7274939999999788

Model 2 vs 1	0.0

Model 8 vs 7	1.3600000011138036E-4
Download 
>C1
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C2
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>C3
SWPPGEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C4
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVTGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>C5
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEITGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C6
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>C7
SWPPSEVLTAVGLICVLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C8
SWPPSEVLTAVGLICALAGGFAKADIGMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C9
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDDSGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C10
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIMLK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C11
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYMVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C12
SWPPSEVLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C13
SWPPSEVLTAVGLICTLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C14
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLTVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=14, Len=130 

C1              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C2              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C3              SWPPGEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C4              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVTGKSVD
C5              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C6              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C7              SWPPSEVLTAVGLICVLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C8              SWPPSEVLTAVGLICALAGGFAKADIGMAGPMAAVGLLIVSYVVSGKSVD
C9              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C10             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C11             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYMVSGKSVD
C12             SWPPSEVLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVD
C13             SWPPSEVLTAVGLICTLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C14             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLTVSYVVSGKSVD
                ****.**********.********** ****:****** ***:*:*****

C1              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C2              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
C3              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C4              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
C5              MYIERAGDITWEKDAEITGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C6              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C7              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C8              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C9              MYIERAGDITWEKDAEVTGNSPRLDVALDDSGDFSLVEDDGPPMREIILK
C10             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIMLK
C11             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C12             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C13             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C14             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
                ****************:************:********:********:**

C1              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C2              VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
C3              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C4              VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
C5              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C6              VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
C7              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C8              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C9              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C10             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C11             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C12             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C13             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C14             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
                ****:*************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 14 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23660]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [23660]--->[23660]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.717 Mb, Max= 31.357 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C2              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C3              SWPPGEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C4              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVTGKSVD
C5              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C6              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C7              SWPPSEVLTAVGLICVLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C8              SWPPSEVLTAVGLICALAGGFAKADIGMAGPMAAVGLLIVSYVVSGKSVD
C9              SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C10             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C11             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYMVSGKSVD
C12             SWPPSEVLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVD
C13             SWPPSEVLTAVGLICTLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
C14             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLTVSYVVSGKSVD
                ****.**********.********** ****:****** ***:*:*****

C1              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C2              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
C3              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C4              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
C5              MYIERAGDITWEKDAEITGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C6              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C7              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C8              MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C9              MYIERAGDITWEKDAEVTGNSPRLDVALDDSGDFSLVEDDGPPMREIILK
C10             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIMLK
C11             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C12             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C13             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
C14             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
                ****************:************:********:********:**

C1              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C2              VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
C3              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C4              VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
C5              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C6              VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
C7              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C8              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C9              VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C10             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C11             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C12             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C13             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
C14             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
                ****:*************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.46  C1	  C2	 98.46
TOP	    1    0	 98.46  C2	  C1	 98.46
BOT	    0    2	 99.23  C1	  C3	 99.23
TOP	    2    0	 99.23  C3	  C1	 99.23
BOT	    0    3	 97.69  C1	  C4	 97.69
TOP	    3    0	 97.69  C4	  C1	 97.69
BOT	    0    4	 99.23  C1	  C5	 99.23
TOP	    4    0	 99.23  C5	  C1	 99.23
BOT	    0    5	 99.23  C1	  C6	 99.23
TOP	    5    0	 99.23  C6	  C1	 99.23
BOT	    0    6	 99.23  C1	  C7	 99.23
TOP	    6    0	 99.23  C7	  C1	 99.23
BOT	    0    7	 99.23  C1	  C8	 99.23
TOP	    7    0	 99.23  C8	  C1	 99.23
BOT	    0    8	 99.23  C1	  C9	 99.23
TOP	    8    0	 99.23  C9	  C1	 99.23
BOT	    0    9	 99.23  C1	 C10	 99.23
TOP	    9    0	 99.23 C10	  C1	 99.23
BOT	    0   10	 99.23  C1	 C11	 99.23
TOP	   10    0	 99.23 C11	  C1	 99.23
BOT	    0   11	 99.23  C1	 C12	 99.23
TOP	   11    0	 99.23 C12	  C1	 99.23
BOT	    0   12	 99.23  C1	 C13	 99.23
TOP	   12    0	 99.23 C13	  C1	 99.23
BOT	    0   13	 99.23  C1	 C14	 99.23
TOP	   13    0	 99.23 C14	  C1	 99.23
BOT	    1    2	 97.69  C2	  C3	 97.69
TOP	    2    1	 97.69  C3	  C2	 97.69
BOT	    1    3	 99.23  C2	  C4	 99.23
TOP	    3    1	 99.23  C4	  C2	 99.23
BOT	    1    4	 97.69  C2	  C5	 97.69
TOP	    4    1	 97.69  C5	  C2	 97.69
BOT	    1    5	 99.23  C2	  C6	 99.23
TOP	    5    1	 99.23  C6	  C2	 99.23
BOT	    1    6	 97.69  C2	  C7	 97.69
TOP	    6    1	 97.69  C7	  C2	 97.69
BOT	    1    7	 97.69  C2	  C8	 97.69
TOP	    7    1	 97.69  C8	  C2	 97.69
BOT	    1    8	 97.69  C2	  C9	 97.69
TOP	    8    1	 97.69  C9	  C2	 97.69
BOT	    1    9	 97.69  C2	 C10	 97.69
TOP	    9    1	 97.69 C10	  C2	 97.69
BOT	    1   10	 97.69  C2	 C11	 97.69
TOP	   10    1	 97.69 C11	  C2	 97.69
BOT	    1   11	 97.69  C2	 C12	 97.69
TOP	   11    1	 97.69 C12	  C2	 97.69
BOT	    1   12	 97.69  C2	 C13	 97.69
TOP	   12    1	 97.69 C13	  C2	 97.69
BOT	    1   13	 97.69  C2	 C14	 97.69
TOP	   13    1	 97.69 C14	  C2	 97.69
BOT	    2    3	 96.92  C3	  C4	 96.92
TOP	    3    2	 96.92  C4	  C3	 96.92
BOT	    2    4	 98.46  C3	  C5	 98.46
TOP	    4    2	 98.46  C5	  C3	 98.46
BOT	    2    5	 98.46  C3	  C6	 98.46
TOP	    5    2	 98.46  C6	  C3	 98.46
BOT	    2    6	 98.46  C3	  C7	 98.46
TOP	    6    2	 98.46  C7	  C3	 98.46
BOT	    2    7	 98.46  C3	  C8	 98.46
TOP	    7    2	 98.46  C8	  C3	 98.46
BOT	    2    8	 98.46  C3	  C9	 98.46
TOP	    8    2	 98.46  C9	  C3	 98.46
BOT	    2    9	 98.46  C3	 C10	 98.46
TOP	    9    2	 98.46 C10	  C3	 98.46
BOT	    2   10	 98.46  C3	 C11	 98.46
TOP	   10    2	 98.46 C11	  C3	 98.46
BOT	    2   11	 98.46  C3	 C12	 98.46
TOP	   11    2	 98.46 C12	  C3	 98.46
BOT	    2   12	 98.46  C3	 C13	 98.46
TOP	   12    2	 98.46 C13	  C3	 98.46
BOT	    2   13	 98.46  C3	 C14	 98.46
TOP	   13    2	 98.46 C14	  C3	 98.46
BOT	    3    4	 96.92  C4	  C5	 96.92
TOP	    4    3	 96.92  C5	  C4	 96.92
BOT	    3    5	 98.46  C4	  C6	 98.46
TOP	    5    3	 98.46  C6	  C4	 98.46
BOT	    3    6	 96.92  C4	  C7	 96.92
TOP	    6    3	 96.92  C7	  C4	 96.92
BOT	    3    7	 96.92  C4	  C8	 96.92
TOP	    7    3	 96.92  C8	  C4	 96.92
BOT	    3    8	 96.92  C4	  C9	 96.92
TOP	    8    3	 96.92  C9	  C4	 96.92
BOT	    3    9	 96.92  C4	 C10	 96.92
TOP	    9    3	 96.92 C10	  C4	 96.92
BOT	    3   10	 96.92  C4	 C11	 96.92
TOP	   10    3	 96.92 C11	  C4	 96.92
BOT	    3   11	 96.92  C4	 C12	 96.92
TOP	   11    3	 96.92 C12	  C4	 96.92
BOT	    3   12	 96.92  C4	 C13	 96.92
TOP	   12    3	 96.92 C13	  C4	 96.92
BOT	    3   13	 96.92  C4	 C14	 96.92
TOP	   13    3	 96.92 C14	  C4	 96.92
BOT	    4    5	 98.46  C5	  C6	 98.46
TOP	    5    4	 98.46  C6	  C5	 98.46
BOT	    4    6	 98.46  C5	  C7	 98.46
TOP	    6    4	 98.46  C7	  C5	 98.46
BOT	    4    7	 98.46  C5	  C8	 98.46
TOP	    7    4	 98.46  C8	  C5	 98.46
BOT	    4    8	 98.46  C5	  C9	 98.46
TOP	    8    4	 98.46  C9	  C5	 98.46
BOT	    4    9	 98.46  C5	 C10	 98.46
TOP	    9    4	 98.46 C10	  C5	 98.46
BOT	    4   10	 98.46  C5	 C11	 98.46
TOP	   10    4	 98.46 C11	  C5	 98.46
BOT	    4   11	 98.46  C5	 C12	 98.46
TOP	   11    4	 98.46 C12	  C5	 98.46
BOT	    4   12	 98.46  C5	 C13	 98.46
TOP	   12    4	 98.46 C13	  C5	 98.46
BOT	    4   13	 98.46  C5	 C14	 98.46
TOP	   13    4	 98.46 C14	  C5	 98.46
BOT	    5    6	 98.46  C6	  C7	 98.46
TOP	    6    5	 98.46  C7	  C6	 98.46
BOT	    5    7	 98.46  C6	  C8	 98.46
TOP	    7    5	 98.46  C8	  C6	 98.46
BOT	    5    8	 98.46  C6	  C9	 98.46
TOP	    8    5	 98.46  C9	  C6	 98.46
BOT	    5    9	 98.46  C6	 C10	 98.46
TOP	    9    5	 98.46 C10	  C6	 98.46
BOT	    5   10	 98.46  C6	 C11	 98.46
TOP	   10    5	 98.46 C11	  C6	 98.46
BOT	    5   11	 98.46  C6	 C12	 98.46
TOP	   11    5	 98.46 C12	  C6	 98.46
BOT	    5   12	 98.46  C6	 C13	 98.46
TOP	   12    5	 98.46 C13	  C6	 98.46
BOT	    5   13	 98.46  C6	 C14	 98.46
TOP	   13    5	 98.46 C14	  C6	 98.46
BOT	    6    7	 98.46  C7	  C8	 98.46
TOP	    7    6	 98.46  C8	  C7	 98.46
BOT	    6    8	 98.46  C7	  C9	 98.46
TOP	    8    6	 98.46  C9	  C7	 98.46
BOT	    6    9	 98.46  C7	 C10	 98.46
TOP	    9    6	 98.46 C10	  C7	 98.46
BOT	    6   10	 98.46  C7	 C11	 98.46
TOP	   10    6	 98.46 C11	  C7	 98.46
BOT	    6   11	 98.46  C7	 C12	 98.46
TOP	   11    6	 98.46 C12	  C7	 98.46
BOT	    6   12	 99.23  C7	 C13	 99.23
TOP	   12    6	 99.23 C13	  C7	 99.23
BOT	    6   13	 98.46  C7	 C14	 98.46
TOP	   13    6	 98.46 C14	  C7	 98.46
BOT	    7    8	 98.46  C8	  C9	 98.46
TOP	    8    7	 98.46  C9	  C8	 98.46
BOT	    7    9	 98.46  C8	 C10	 98.46
TOP	    9    7	 98.46 C10	  C8	 98.46
BOT	    7   10	 98.46  C8	 C11	 98.46
TOP	   10    7	 98.46 C11	  C8	 98.46
BOT	    7   11	 98.46  C8	 C12	 98.46
TOP	   11    7	 98.46 C12	  C8	 98.46
BOT	    7   12	 98.46  C8	 C13	 98.46
TOP	   12    7	 98.46 C13	  C8	 98.46
BOT	    7   13	 98.46  C8	 C14	 98.46
TOP	   13    7	 98.46 C14	  C8	 98.46
BOT	    8    9	 98.46  C9	 C10	 98.46
TOP	    9    8	 98.46 C10	  C9	 98.46
BOT	    8   10	 98.46  C9	 C11	 98.46
TOP	   10    8	 98.46 C11	  C9	 98.46
BOT	    8   11	 98.46  C9	 C12	 98.46
TOP	   11    8	 98.46 C12	  C9	 98.46
BOT	    8   12	 98.46  C9	 C13	 98.46
TOP	   12    8	 98.46 C13	  C9	 98.46
BOT	    8   13	 98.46  C9	 C14	 98.46
TOP	   13    8	 98.46 C14	  C9	 98.46
BOT	    9   10	 98.46 C10	 C11	 98.46
TOP	   10    9	 98.46 C11	 C10	 98.46
BOT	    9   11	 98.46 C10	 C12	 98.46
TOP	   11    9	 98.46 C12	 C10	 98.46
BOT	    9   12	 98.46 C10	 C13	 98.46
TOP	   12    9	 98.46 C13	 C10	 98.46
BOT	    9   13	 98.46 C10	 C14	 98.46
TOP	   13    9	 98.46 C14	 C10	 98.46
BOT	   10   11	 98.46 C11	 C12	 98.46
TOP	   11   10	 98.46 C12	 C11	 98.46
BOT	   10   12	 98.46 C11	 C13	 98.46
TOP	   12   10	 98.46 C13	 C11	 98.46
BOT	   10   13	 98.46 C11	 C14	 98.46
TOP	   13   10	 98.46 C14	 C11	 98.46
BOT	   11   12	 98.46 C12	 C13	 98.46
TOP	   12   11	 98.46 C13	 C12	 98.46
BOT	   11   13	 98.46 C12	 C14	 98.46
TOP	   13   11	 98.46 C14	 C12	 98.46
BOT	   12   13	 98.46 C13	 C14	 98.46
TOP	   13   12	 98.46 C14	 C13	 98.46
AVG	 0	  C1	   *	 99.05
AVG	 1	  C2	   *	 97.99
AVG	 2	  C3	   *	 98.34
AVG	 3	  C4	   *	 97.28
AVG	 4	  C5	   *	 98.34
AVG	 5	  C6	   *	 98.58
AVG	 6	  C7	   *	 98.40
AVG	 7	  C8	   *	 98.34
AVG	 8	  C9	   *	 98.34
AVG	 9	 C10	   *	 98.34
AVG	 10	 C11	   *	 98.34
AVG	 11	 C12	   *	 98.34
AVG	 12	 C13	   *	 98.40
AVG	 13	 C14	   *	 98.34
TOT	 TOT	   *	 98.32
CLUSTAL W (1.83) multiple sequence alignment

C1              AGTTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C2              AGCTGGCCTCCTAGTGAAGTGCTTACAGCTGTTGGCCTGATATGTGCACT
C3              AGCTGGCCCCCTGGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C4              AGCTGGCCCCCTAGTGAAGTGCTTACAGCTGTCGGCCTGATATGTGCACT
C5              AGCTGGCCCCCTAGTGAAGTACTCACAGCTGTTGGCCTGATATGCGCGTT
C6              AGCTGGCCCCCTAGTGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C7              AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGTATT
C8              AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C9              AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C10             AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C11             AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C12             AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
C13             AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCACATT
C14             AGCTGGCCCCCCAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
                ** ***** ** .* *****.** ******** *********** . . *

C1              GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C2              GGCCGGAGGGTTTGCCAAGGCAGACATAGAGATGGCTGGGCCCATGGCTG
C3              GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C4              GGCCGGAGGGTTTGCCAAGGCAGACATAGAGATGGCTGGGCCCATGGCTG
C5              GGCCGGAGGGTTCGCCAAGGCGGATATAGAGATGGCTGGGCCCATGGCCG
C6              GGCTGGAGGGTTCGCCAAGGCGGATATAGAGATGGCTGGGCCCATGGCCG
C7              GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C8              GGCTGGAGGGTTCGCCAAGGCAGATATAGGGATGGCTGGGCCCATGGCCG
C9              GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C10             GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C11             GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C12             GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATAGCCG
C13             GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
C14             GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
                *** ******** ********.** ****.***************.** *

C1              CGGTTGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C2              CAGTGGGCCTGCTAATTGTCAGTTATGTGGTCTCGGGAAAGAGTGTGGAC
C3              CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C4              CAGTAGGCCTGCTAATTGTCAGTTATGTGGTCACGGGAAAGAGTGTGGAC
C5              CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C6              CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C7              CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C8              CGGTTGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C9              CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C10             CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C11             CGGTCGGTCTGCTAATTGTCAGTTACATGGTCTCAGGAAAGAGTGTGGAC
C12             CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C13             CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
C14             CGGTCGGTCTGCTAACTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
                *.** ** ******* ********* .*****:*.***************

C1              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C2              ATGTACATCGAAAGAGCAGGTGATATCACATGGGAAAAAGACGCGGAAGT
C3              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C4              ATGTACATCGAAAGAGCAGGTGATATTACATGGGAAAAAGACGCGGAAGT
C5              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAAT
C6              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C7              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C8              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C9              ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C10             ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C11             ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C12             ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C13             ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
C14             ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
                ******** ************** ** ************** ******.*

C1              CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
C2              CACTGGAAACAGTCCTCGGCTTGACGTGGCACTAGATGAGAGTGGTGATT
C3              CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
C4              CACTGGAAACAGTCCTCGGCTTGACGTGGCACTAGATGAGAGTGGTGATT
C5              CACTGGAAACAGTCCTCGGCTCGATGTGGCACTAGATGAGAGTGGTGACT
C6              CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
C7              CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
C8              CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
C9              CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGATAGTGGTGATT
C10             CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
C11             CACTGGAAACAGTCCCCGGCTTGATGTGGCGCTAGATGAGAGTGGTGATT
C12             CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
C13             CACTGGAAACAGTCCCCGGCTCGACGTGGCGCTAGATGAGAGTGGTGATT
C14             CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
                *************** ***** ** *****.******** ******** *

C1              TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTTAAA
C2              TCTCCTTGGTAGAGGAGGATGGCCCACCCATGAGAGAGATCATACTCAAG
C3              TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C4              TCTCTTTGGTAGAGGAGGATGGCCCACCCATGAGAGAGATCATACTCAAG
C5              TCTCCCTAGTGGAGGATGATGGTCCCCCTATGAGAGAGATCATACTCAAA
C6              TCTCCCTAGTGGAGGATGATGGTCCCCCCATGAGAGAGATCATACTCAAA
C7              TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C8              TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C9              TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C10             TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATGCTCAAG
C11             TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C12             TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C13             TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
C14             TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAA
                ****  *.**.***** ** ** **.** **************.** **.

C1              GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C2              GTGGTTCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTCGC
C3              GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C4              GTGGTCCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTCGC
C5              GTGGTCCTGATGACCATCTGCGGCATGAACCCAATAGCCATACCCTTTGC
C6              GTGGTCCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C7              GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C8              GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C9              GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C10             GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C11             GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C12             GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCTTTTGC
C13             GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
C14             GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
                ***** ******.******* *********************** ** **

C1              AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C2              TGCAGGAGCGTGGTATGTGTATGTAAAGACTGGAAAAAGG
C3              AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C4              TGCAGGAGCGTGGTATGTGTATGTAAAGACTGGGAAAAGG
C5              AGCTGGAGCGTGGTACGTGTATGTGAAGACTGGGAAAAGG
C6              AGCTGGAGCGTGGTACGTGTATGTGAAGACTGGAAAAAGG
C7              AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C8              AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C9              AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C10             AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C11             AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C12             AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C13             AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
C14             AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
                :**:*********** **.** **.********.******



>C1
AGTTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTTGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTTAAA
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C2
AGCTGGCCTCCTAGTGAAGTGCTTACAGCTGTTGGCCTGATATGTGCACT
GGCCGGAGGGTTTGCCAAGGCAGACATAGAGATGGCTGGGCCCATGGCTG
CAGTGGGCCTGCTAATTGTCAGTTATGTGGTCTCGGGAAAGAGTGTGGAC
ATGTACATCGAAAGAGCAGGTGATATCACATGGGAAAAAGACGCGGAAGT
CACTGGAAACAGTCCTCGGCTTGACGTGGCACTAGATGAGAGTGGTGATT
TCTCCTTGGTAGAGGAGGATGGCCCACCCATGAGAGAGATCATACTCAAG
GTGGTTCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTCGC
TGCAGGAGCGTGGTATGTGTATGTAAAGACTGGAAAAAGG
>C3
AGCTGGCCCCCTGGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C4
AGCTGGCCCCCTAGTGAAGTGCTTACAGCTGTCGGCCTGATATGTGCACT
GGCCGGAGGGTTTGCCAAGGCAGACATAGAGATGGCTGGGCCCATGGCTG
CAGTAGGCCTGCTAATTGTCAGTTATGTGGTCACGGGAAAGAGTGTGGAC
ATGTACATCGAAAGAGCAGGTGATATTACATGGGAAAAAGACGCGGAAGT
CACTGGAAACAGTCCTCGGCTTGACGTGGCACTAGATGAGAGTGGTGATT
TCTCTTTGGTAGAGGAGGATGGCCCACCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTCGC
TGCAGGAGCGTGGTATGTGTATGTAAAGACTGGGAAAAGG
>C5
AGCTGGCCCCCTAGTGAAGTACTCACAGCTGTTGGCCTGATATGCGCGTT
GGCCGGAGGGTTCGCCAAGGCGGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAAT
CACTGGAAACAGTCCTCGGCTCGATGTGGCACTAGATGAGAGTGGTGACT
TCTCCCTAGTGGAGGATGATGGTCCCCCTATGAGAGAGATCATACTCAAA
GTGGTCCTGATGACCATCTGCGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTGTATGTGAAGACTGGGAAAAGG
>C6
AGCTGGCCCCCTAGTGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCGGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
TCTCCCTAGTGGAGGATGATGGTCCCCCCATGAGAGAGATCATACTCAAA
GTGGTCCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTGTATGTGAAGACTGGAAAAAGG
>C7
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGTATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C8
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGGGATGGCTGGGCCCATGGCCG
CGGTTGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C9
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGATAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C10
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATGCTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C11
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACATGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTTGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C12
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATAGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCTTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C13
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCACATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGACGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C14
AGCTGGCCCCCCAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAACTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAA
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>C1
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C2
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>C3
SWPPGEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C4
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVTGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>C5
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEITGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C6
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>C7
SWPPSEVLTAVGLICVLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C8
SWPPSEVLTAVGLICALAGGFAKADIGMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C9
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDDSGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C10
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIMLK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C11
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYMVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C12
SWPPSEVLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C13
SWPPSEVLTAVGLICTLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>C14
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLTVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 14 taxa and 390 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Taxon 13 -> C13
      Taxon 14 -> C14
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1509961429
      Setting output file names to "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1690079677
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5506189968
      Seed = 1851808276
      Swapseed = 1509961429
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 12 unique site patterns
      Division 2 has 7 unique site patterns
      Division 3 has 36 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1782.224315 -- -25.949576
         Chain 2 -- -1798.969353 -- -25.949576
         Chain 3 -- -1826.973015 -- -25.949576
         Chain 4 -- -1832.954677 -- -25.949576

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1821.187988 -- -25.949576
         Chain 2 -- -1829.754601 -- -25.949576
         Chain 3 -- -1816.626915 -- -25.949576
         Chain 4 -- -1807.177893 -- -25.949576


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1782.224] (-1798.969) (-1826.973) (-1832.955) * [-1821.188] (-1829.755) (-1816.627) (-1807.178) 
        500 -- [-984.995] (-999.829) (-1018.734) (-1021.839) * (-1020.000) (-1000.870) (-1006.015) [-995.048] -- 0:00:00
       1000 -- (-957.014) [-971.122] (-968.026) (-982.122) * (-985.366) (-963.433) [-968.060] (-992.453) -- 0:00:00
       1500 -- [-954.273] (-955.823) (-969.184) (-979.496) * (-968.289) (-948.966) [-950.888] (-947.631) -- 0:00:00
       2000 -- (-954.438) [-931.958] (-962.135) (-976.593) * (-964.710) (-954.851) [-947.106] (-947.219) -- 0:00:00
       2500 -- (-953.441) [-925.395] (-941.721) (-945.434) * (-957.841) (-941.472) [-936.876] (-944.165) -- 0:00:00
       3000 -- (-938.862) [-923.545] (-943.045) (-945.590) * (-952.023) (-937.874) [-919.253] (-949.101) -- 0:05:32
       3500 -- (-929.196) (-918.874) (-953.487) [-923.258] * (-937.434) (-934.105) [-921.098] (-945.847) -- 0:04:44
       4000 -- [-920.049] (-919.232) (-963.824) (-923.224) * (-931.194) (-914.871) [-917.871] (-931.392) -- 0:04:09
       4500 -- (-920.195) (-914.810) (-949.286) [-922.008] * (-939.030) (-934.472) [-915.102] (-940.214) -- 0:03:41
       5000 -- [-915.880] (-934.300) (-937.082) (-923.256) * (-944.306) [-920.155] (-917.584) (-923.698) -- 0:03:19

      Average standard deviation of split frequencies: 0.075151

       5500 -- [-912.106] (-925.323) (-950.340) (-927.029) * [-923.076] (-914.388) (-928.913) (-913.052) -- 0:03:00
       6000 -- [-915.817] (-916.426) (-939.940) (-923.352) * (-920.717) [-914.674] (-914.407) (-925.614) -- 0:02:45
       6500 -- (-920.811) (-941.722) (-936.440) [-918.112] * (-927.635) [-914.179] (-917.313) (-933.834) -- 0:02:32
       7000 -- (-916.667) (-910.886) (-932.689) [-913.573] * (-926.773) [-912.714] (-921.608) (-923.250) -- 0:04:43
       7500 -- (-909.912) [-917.608] (-921.287) (-914.528) * (-914.069) [-912.957] (-928.037) (-917.745) -- 0:04:24
       8000 -- [-911.419] (-917.530) (-923.929) (-920.200) * [-910.176] (-923.452) (-926.515) (-918.129) -- 0:04:08
       8500 -- (-928.262) (-919.405) (-944.044) [-911.087] * (-923.089) (-919.101) [-906.947] (-926.250) -- 0:03:53
       9000 -- (-914.710) [-915.389] (-932.131) (-922.459) * [-904.050] (-924.800) (-909.311) (-932.544) -- 0:03:40
       9500 -- [-906.186] (-922.218) (-922.470) (-913.090) * [-908.908] (-915.125) (-913.835) (-931.502) -- 0:03:28
      10000 -- [-906.535] (-913.323) (-922.831) (-913.186) * (-907.847) (-926.442) [-909.319] (-924.064) -- 0:03:18

      Average standard deviation of split frequencies: 0.069780

      10500 -- [-912.912] (-918.646) (-934.994) (-914.826) * (-912.003) (-923.087) [-908.340] (-932.120) -- 0:04:42
      11000 -- (-911.615) [-907.619] (-937.283) (-926.478) * [-906.923] (-931.755) (-906.220) (-928.249) -- 0:04:29
      11500 -- (-911.380) (-914.612) (-951.208) [-911.167] * (-922.275) [-909.304] (-911.523) (-918.275) -- 0:04:17
      12000 -- (-917.449) [-915.020] (-931.414) (-917.016) * (-914.671) (-927.258) (-913.060) [-914.600] -- 0:04:07
      12500 -- (-912.948) [-915.597] (-912.944) (-914.720) * [-915.480] (-926.489) (-914.923) (-914.454) -- 0:03:57
      13000 -- (-913.651) [-916.551] (-918.133) (-906.884) * (-918.594) (-910.986) [-903.312] (-915.322) -- 0:03:47
      13500 -- (-912.588) (-910.747) [-914.899] (-914.944) * (-924.107) (-924.232) [-907.198] (-924.464) -- 0:03:39
      14000 -- (-914.872) (-917.127) (-911.300) [-911.397] * (-916.313) (-917.294) (-905.737) [-907.695] -- 0:03:31
      14500 -- (-915.155) [-915.780] (-913.434) (-911.975) * (-925.622) (-918.545) [-909.945] (-908.275) -- 0:04:31
      15000 -- (-923.667) [-912.713] (-913.462) (-923.558) * (-935.475) (-921.275) [-909.590] (-918.850) -- 0:04:22

      Average standard deviation of split frequencies: 0.063640

      15500 -- [-912.571] (-911.471) (-918.966) (-921.886) * (-924.709) [-913.976] (-912.147) (-918.148) -- 0:04:14
      16000 -- [-913.356] (-918.037) (-923.958) (-915.275) * (-930.723) (-925.236) (-908.063) [-915.165] -- 0:04:06
      16500 -- (-917.433) (-918.205) (-916.791) [-913.208] * (-924.664) [-923.479] (-908.657) (-929.993) -- 0:03:58
      17000 -- (-909.573) [-903.224] (-926.854) (-915.319) * [-912.614] (-923.774) (-919.839) (-921.965) -- 0:03:51
      17500 -- (-923.921) (-912.259) (-906.793) [-907.508] * (-918.447) (-941.846) [-909.849] (-921.391) -- 0:03:44
      18000 -- (-907.344) [-905.852] (-916.748) (-930.132) * [-913.063] (-917.737) (-907.289) (-917.484) -- 0:04:32
      18500 -- (-935.298) (-920.534) [-914.874] (-913.847) * (-925.954) [-908.606] (-911.935) (-920.652) -- 0:04:25
      19000 -- (-911.048) (-923.930) (-925.515) [-909.257] * [-918.544] (-918.184) (-915.707) (-919.630) -- 0:04:18
      19500 -- (-927.694) (-915.292) (-914.657) [-915.330] * (-912.830) [-903.500] (-908.807) (-913.512) -- 0:04:11
      20000 -- (-931.736) (-919.077) [-906.268] (-903.352) * (-919.750) (-914.087) [-914.610] (-920.872) -- 0:04:05

      Average standard deviation of split frequencies: 0.049587

      20500 -- (-918.025) (-927.324) (-923.897) [-913.882] * (-927.740) (-926.497) (-914.102) [-926.299] -- 0:03:58
      21000 -- [-915.979] (-924.214) (-920.018) (-908.388) * [-916.719] (-930.487) (-908.708) (-917.172) -- 0:03:53
      21500 -- (-913.343) (-926.923) (-914.758) [-910.614] * (-925.503) (-914.354) (-911.565) [-908.697] -- 0:03:47
      22000 -- (-912.278) (-929.976) (-918.708) [-913.886] * (-919.838) (-909.531) (-909.967) [-911.654] -- 0:04:26
      22500 -- (-926.150) [-909.081] (-916.953) (-920.566) * [-906.633] (-919.886) (-912.985) (-910.838) -- 0:04:20
      23000 -- (-912.044) (-917.263) [-925.661] (-911.705) * (-920.192) (-911.941) (-923.058) [-908.599] -- 0:04:14
      23500 -- [-914.188] (-918.587) (-919.800) (-914.613) * (-916.499) (-914.562) (-917.120) [-902.973] -- 0:04:09
      24000 -- (-916.610) [-914.256] (-915.924) (-905.173) * [-913.888] (-911.747) (-922.006) (-911.958) -- 0:04:04
      24500 -- (-923.815) [-909.407] (-917.929) (-917.202) * (-921.586) [-915.163] (-924.624) (-909.711) -- 0:03:58
      25000 -- (-921.886) [-910.581] (-913.053) (-917.867) * [-914.578] (-908.933) (-917.678) (-914.222) -- 0:03:54

      Average standard deviation of split frequencies: 0.039661

      25500 -- (-916.292) [-921.326] (-914.779) (-937.453) * (-915.230) (-913.042) (-914.201) [-910.835] -- 0:04:27
      26000 -- (-913.656) [-909.613] (-915.646) (-927.074) * (-925.001) [-919.065] (-914.917) (-916.514) -- 0:04:22
      26500 -- (-913.971) [-909.290] (-914.788) (-916.281) * (-919.907) (-905.971) (-917.567) [-913.474] -- 0:04:17
      27000 -- [-921.006] (-911.801) (-911.560) (-924.006) * (-923.717) (-910.153) [-905.318] (-908.474) -- 0:04:12
      27500 -- (-917.263) [-914.829] (-916.869) (-910.758) * (-916.060) [-915.440] (-914.931) (-909.797) -- 0:04:07
      28000 -- [-912.718] (-924.459) (-926.693) (-908.531) * (-914.531) (-914.366) [-908.759] (-909.423) -- 0:04:03
      28500 -- (-913.003) (-918.397) (-915.090) [-907.037] * (-916.987) (-911.775) (-917.165) [-905.505] -- 0:03:58
      29000 -- (-922.709) (-922.657) [-926.638] (-921.228) * (-920.820) (-909.234) [-909.158] (-918.013) -- 0:03:54
      29500 -- (-914.682) (-905.097) (-913.578) [-908.149] * (-923.642) (-915.691) [-915.976] (-917.672) -- 0:04:23
      30000 -- [-926.201] (-910.817) (-916.277) (-914.917) * (-915.675) [-916.250] (-922.792) (-930.118) -- 0:04:18

      Average standard deviation of split frequencies: 0.046116

      30500 -- (-915.482) (-909.933) [-920.511] (-923.917) * (-921.953) (-919.223) [-915.918] (-912.997) -- 0:04:14
      31000 -- (-915.222) [-917.160] (-932.095) (-920.264) * (-913.384) (-914.587) (-916.166) [-919.205] -- 0:04:10
      31500 -- (-921.984) (-916.795) (-914.368) [-914.446] * [-916.275] (-920.847) (-927.655) (-927.239) -- 0:04:05
      32000 -- (-908.451) [-908.418] (-913.992) (-922.505) * (-915.124) [-912.313] (-923.124) (-920.766) -- 0:04:32
      32500 -- [-920.961] (-919.678) (-923.760) (-909.645) * (-913.888) [-916.102] (-918.200) (-927.065) -- 0:04:27
      33000 -- (-916.998) (-924.793) (-917.307) [-905.639] * [-906.333] (-921.650) (-908.513) (-939.292) -- 0:04:23
      33500 -- (-929.969) (-910.530) [-905.753] (-916.931) * [-912.048] (-922.421) (-915.118) (-910.646) -- 0:04:19
      34000 -- (-923.597) (-906.912) (-918.504) [-910.527] * [-914.485] (-936.635) (-914.082) (-918.750) -- 0:04:15
      34500 -- [-915.256] (-918.945) (-911.479) (-916.796) * [-918.606] (-918.284) (-907.874) (-910.307) -- 0:04:11
      35000 -- (-923.899) [-917.659] (-912.834) (-925.386) * (-926.271) [-910.125] (-910.155) (-922.960) -- 0:04:08

      Average standard deviation of split frequencies: 0.042012

      35500 -- [-908.463] (-920.308) (-913.380) (-928.132) * (-926.020) (-923.924) (-912.005) [-907.396] -- 0:04:31
      36000 -- [-915.336] (-915.857) (-917.067) (-921.689) * [-916.086] (-929.859) (-924.768) (-919.043) -- 0:04:27
      36500 -- (-921.147) [-913.408] (-914.016) (-918.971) * (-908.957) [-911.236] (-907.067) (-915.805) -- 0:04:23
      37000 -- (-914.805) (-914.979) [-909.251] (-915.746) * [-909.064] (-920.041) (-913.678) (-923.217) -- 0:04:20
      37500 -- (-913.256) [-909.372] (-916.334) (-914.061) * (-914.513) (-908.535) (-922.572) [-914.455] -- 0:04:16
      38000 -- (-909.752) (-920.515) (-926.792) [-921.665] * (-915.086) (-909.072) [-918.068] (-920.407) -- 0:04:13
      38500 -- (-925.624) (-904.822) [-907.510] (-917.761) * (-908.517) [-911.657] (-921.570) (-920.222) -- 0:04:09
      39000 -- (-916.218) [-907.183] (-933.447) (-917.759) * (-903.676) [-912.887] (-916.674) (-919.427) -- 0:04:06
      39500 -- (-918.264) (-905.905) [-923.773] (-924.077) * (-913.881) (-920.212) [-923.443] (-918.995) -- 0:04:27
      40000 -- [-915.324] (-907.850) (-913.032) (-925.808) * (-914.944) (-919.099) [-907.463] (-926.324) -- 0:04:24

      Average standard deviation of split frequencies: 0.026593

      40500 -- [-914.507] (-915.706) (-928.585) (-918.942) * (-919.970) (-920.489) (-909.942) [-911.686] -- 0:04:20
      41000 -- (-916.688) [-906.798] (-913.182) (-932.469) * (-926.725) (-919.500) [-906.685] (-923.568) -- 0:04:17
      41500 -- (-930.762) (-910.301) [-912.609] (-930.734) * [-915.990] (-926.513) (-912.276) (-924.016) -- 0:04:14
      42000 -- (-907.755) (-912.504) [-918.440] (-914.381) * (-923.704) [-914.899] (-904.234) (-922.626) -- 0:04:10
      42500 -- (-914.153) (-918.205) [-906.239] (-916.744) * (-917.191) [-910.437] (-918.541) (-921.533) -- 0:04:07
      43000 -- (-913.597) [-908.814] (-912.751) (-912.048) * (-916.436) (-929.492) [-907.751] (-919.262) -- 0:04:27
      43500 -- [-906.315] (-924.553) (-911.254) (-935.900) * (-922.155) (-910.504) (-907.561) [-915.314] -- 0:04:23
      44000 -- [-916.726] (-920.940) (-907.773) (-930.843) * (-915.843) (-910.082) [-908.716] (-920.717) -- 0:04:20
      44500 -- [-915.909] (-911.542) (-906.808) (-926.324) * (-912.938) (-905.298) (-913.960) [-908.905] -- 0:04:17
      45000 -- (-913.598) (-916.392) (-922.684) [-913.360] * (-919.859) (-917.679) (-911.430) [-923.751] -- 0:04:14

      Average standard deviation of split frequencies: 0.032080

      45500 -- (-915.034) [-903.575] (-919.321) (-913.276) * [-913.602] (-905.915) (-909.583) (-918.068) -- 0:04:11
      46000 -- (-926.434) [-910.130] (-910.431) (-926.798) * (-909.845) (-922.824) [-908.560] (-907.289) -- 0:04:08
      46500 -- [-911.196] (-911.646) (-908.294) (-919.589) * (-933.079) [-913.808] (-925.521) (-912.257) -- 0:04:06
      47000 -- (-919.291) (-920.321) (-906.082) [-915.800] * (-916.780) (-924.253) [-918.557] (-924.582) -- 0:04:23
      47500 -- (-918.583) (-913.202) (-908.462) [-918.620] * [-910.567] (-904.093) (-919.095) (-916.816) -- 0:04:20
      48000 -- (-915.886) (-932.977) [-907.749] (-917.750) * (-907.419) (-909.102) [-906.180] (-935.765) -- 0:04:17
      48500 -- (-915.314) (-931.817) (-916.849) [-915.281] * (-911.847) (-920.020) [-916.667] (-911.329) -- 0:04:15
      49000 -- (-915.240) [-918.209] (-909.409) (-914.624) * (-916.943) (-924.967) (-919.220) [-909.799] -- 0:04:12
      49500 -- [-910.010] (-925.127) (-927.815) (-918.321) * [-918.776] (-921.901) (-916.348) (-912.960) -- 0:04:09
      50000 -- (-912.281) [-920.030] (-935.903) (-910.937) * (-916.151) (-923.350) (-905.527) [-921.891] -- 0:04:06

      Average standard deviation of split frequencies: 0.024656

      50500 -- [-912.395] (-914.652) (-929.134) (-916.837) * (-916.467) [-910.772] (-915.885) (-940.321) -- 0:04:04
      51000 -- (-913.027) [-914.582] (-914.062) (-914.349) * (-928.413) (-910.799) [-906.619] (-933.296) -- 0:04:20
      51500 -- (-923.335) (-917.176) [-914.662] (-912.050) * [-908.520] (-926.120) (-911.151) (-923.179) -- 0:04:17
      52000 -- (-915.266) [-912.926] (-920.984) (-923.338) * (-918.168) (-942.021) (-925.264) [-911.956] -- 0:04:15
      52500 -- [-930.114] (-916.516) (-925.577) (-911.748) * [-918.240] (-915.399) (-924.203) (-914.869) -- 0:04:12
      53000 -- (-919.811) (-916.556) [-913.405] (-918.367) * [-912.819] (-915.458) (-913.585) (-923.628) -- 0:04:10
      53500 -- [-910.840] (-917.654) (-926.802) (-922.925) * (-913.400) (-909.069) [-912.239] (-909.813) -- 0:04:07
      54000 -- (-906.443) (-916.114) [-919.984] (-913.772) * (-921.420) (-930.404) (-918.523) [-913.825] -- 0:04:05
      54500 -- (-919.843) (-913.271) (-913.000) [-913.107] * [-902.779] (-908.811) (-931.090) (-939.984) -- 0:04:20
      55000 -- (-920.687) [-912.472] (-923.311) (-920.159) * [-907.365] (-908.208) (-913.463) (-923.218) -- 0:04:17

      Average standard deviation of split frequencies: 0.023273

      55500 -- (-918.512) (-912.808) (-918.541) [-918.596] * [-905.651] (-917.727) (-916.188) (-914.793) -- 0:04:15
      56000 -- (-911.039) (-909.437) (-916.745) [-908.235] * [-909.475] (-914.465) (-927.771) (-909.060) -- 0:04:12
      56500 -- (-914.734) (-915.081) [-919.846] (-917.132) * (-916.794) [-899.085] (-912.661) (-908.801) -- 0:04:10
      57000 -- (-920.921) [-910.929] (-905.550) (-922.588) * (-916.779) (-906.344) (-913.477) [-911.040] -- 0:04:08
      57500 -- (-934.418) (-911.116) (-913.222) [-908.925] * (-916.259) [-912.930] (-928.320) (-920.853) -- 0:04:05
      58000 -- (-908.238) [-916.625] (-933.675) (-911.020) * (-920.812) [-910.864] (-912.128) (-919.578) -- 0:04:19
      58500 -- (-904.411) (-906.360) (-932.717) [-909.457] * (-934.774) (-911.280) [-909.483] (-915.139) -- 0:04:17
      59000 -- (-920.553) [-909.227] (-915.367) (-919.180) * [-910.700] (-923.447) (-917.769) (-918.193) -- 0:04:15
      59500 -- (-917.287) (-917.734) (-915.894) [-909.449] * (-919.342) [-917.492] (-912.745) (-922.796) -- 0:04:12
      60000 -- (-906.798) [-926.548] (-925.914) (-935.786) * (-915.210) [-906.523] (-915.858) (-923.270) -- 0:04:10

      Average standard deviation of split frequencies: 0.028796

      60500 -- (-910.274) (-924.686) [-914.410] (-926.411) * (-917.273) [-904.580] (-915.694) (-915.451) -- 0:04:08
      61000 -- (-915.281) (-907.529) [-916.847] (-924.518) * (-923.539) (-914.678) [-908.784] (-915.615) -- 0:04:06
      61500 -- (-915.187) [-911.204] (-911.622) (-920.239) * [-915.806] (-928.717) (-918.782) (-926.991) -- 0:04:04
      62000 -- (-910.282) (-913.616) [-911.629] (-921.046) * (-926.270) (-922.125) (-904.283) [-907.822] -- 0:04:17
      62500 -- [-908.929] (-930.330) (-923.988) (-916.566) * (-917.524) (-921.090) (-915.023) [-908.747] -- 0:04:15
      63000 -- [-905.977] (-928.703) (-920.501) (-907.151) * (-922.923) (-923.217) (-918.993) [-906.118] -- 0:04:12
      63500 -- (-928.949) [-920.458] (-929.651) (-914.356) * (-917.229) [-915.745] (-925.623) (-906.761) -- 0:04:10
      64000 -- (-914.610) (-915.305) [-909.715] (-921.931) * (-912.104) (-909.278) (-926.362) [-913.883] -- 0:04:08
      64500 -- (-917.406) [-915.867] (-921.773) (-908.370) * (-924.819) (-915.721) [-913.546] (-916.712) -- 0:04:06
      65000 -- (-912.134) (-921.161) [-901.337] (-931.221) * (-916.867) (-913.483) (-917.151) [-910.421] -- 0:04:04

      Average standard deviation of split frequencies: 0.026427

      65500 -- (-922.353) [-912.244] (-913.226) (-905.138) * (-916.961) (-919.785) (-907.416) [-909.436] -- 0:04:16
      66000 -- (-909.854) (-927.011) [-903.012] (-910.459) * (-925.582) (-915.727) [-922.767] (-919.066) -- 0:04:14
      66500 -- (-913.874) (-913.407) (-912.776) [-907.105] * (-948.387) (-917.639) [-914.555] (-927.806) -- 0:04:12
      67000 -- (-912.280) (-920.873) (-926.503) [-909.870] * (-919.152) (-915.711) [-909.909] (-916.741) -- 0:04:10
      67500 -- (-918.570) [-919.636] (-924.558) (-910.432) * (-927.750) (-914.821) [-905.504] (-931.493) -- 0:04:08
      68000 -- (-921.774) (-919.718) (-912.682) [-905.653] * [-914.946] (-927.358) (-919.821) (-914.389) -- 0:04:06
      68500 -- [-915.901] (-922.540) (-914.965) (-924.991) * (-912.521) (-921.113) [-923.284] (-930.207) -- 0:04:04
      69000 -- (-913.523) (-920.587) [-913.519] (-911.591) * (-923.469) (-917.072) [-914.239] (-928.580) -- 0:04:02
      69500 -- (-927.922) [-916.953] (-915.996) (-918.220) * (-929.407) (-912.625) [-910.285] (-917.107) -- 0:04:14
      70000 -- (-921.386) (-912.721) [-905.204] (-909.893) * (-929.649) (-929.302) (-914.585) [-921.062] -- 0:04:12

      Average standard deviation of split frequencies: 0.032177

      70500 -- (-922.496) (-918.670) (-906.714) [-905.239] * (-918.579) (-918.266) [-912.828] (-915.368) -- 0:04:10
      71000 -- (-921.111) [-912.818] (-917.204) (-917.952) * (-916.187) (-914.142) (-909.259) [-904.217] -- 0:04:08
      71500 -- (-914.895) (-909.932) [-911.988] (-904.832) * (-922.817) (-909.005) (-911.429) [-913.490] -- 0:04:06
      72000 -- (-915.734) (-930.273) (-915.016) [-907.060] * (-906.469) [-905.063] (-917.071) (-925.166) -- 0:04:04
      72500 -- (-910.444) [-909.811] (-925.141) (-916.581) * (-924.891) (-916.201) [-914.661] (-913.759) -- 0:04:15
      73000 -- [-914.704] (-926.359) (-912.259) (-923.628) * (-926.855) [-912.254] (-907.927) (-932.157) -- 0:04:13
      73500 -- (-918.808) [-908.032] (-926.240) (-910.266) * (-908.290) [-914.084] (-915.963) (-933.117) -- 0:04:12
      74000 -- [-906.074] (-914.184) (-906.998) (-916.124) * (-911.674) (-906.285) [-908.440] (-921.054) -- 0:04:10
      74500 -- [-906.954] (-920.042) (-910.280) (-917.643) * (-913.021) (-918.377) [-920.465] (-919.370) -- 0:04:08
      75000 -- [-921.235] (-913.909) (-903.709) (-916.349) * (-924.060) (-914.711) [-920.082] (-916.006) -- 0:04:06

      Average standard deviation of split frequencies: 0.037991

      75500 -- (-915.294) (-906.309) (-926.631) [-909.982] * (-923.338) (-930.517) (-907.830) [-909.903] -- 0:04:04
      76000 -- [-912.969] (-918.194) (-910.171) (-939.030) * (-922.835) [-912.042] (-912.173) (-918.441) -- 0:04:15
      76500 -- (-927.536) [-912.224] (-912.512) (-916.586) * (-923.973) [-918.308] (-904.054) (-909.186) -- 0:04:13
      77000 -- (-927.540) (-916.021) (-906.537) [-927.531] * (-910.618) (-915.373) [-918.869] (-917.543) -- 0:04:11
      77500 -- (-922.112) (-908.758) [-916.295] (-911.248) * (-911.900) [-909.156] (-910.026) (-932.925) -- 0:04:09
      78000 -- (-936.274) (-904.315) [-904.836] (-910.986) * [-913.194] (-912.941) (-922.428) (-917.742) -- 0:04:08
      78500 -- [-921.308] (-916.372) (-927.544) (-913.576) * (-905.381) [-911.171] (-914.070) (-931.251) -- 0:04:06
      79000 -- [-913.197] (-912.866) (-917.530) (-917.984) * (-910.793) [-914.520] (-917.858) (-938.354) -- 0:04:04
      79500 -- (-916.468) [-913.429] (-917.429) (-914.832) * [-912.071] (-912.996) (-921.814) (-915.044) -- 0:04:14
      80000 -- (-920.755) [-914.874] (-926.302) (-910.871) * (-928.741) (-911.178) (-917.500) [-910.012] -- 0:04:13

      Average standard deviation of split frequencies: 0.038569

      80500 -- (-911.763) (-909.518) [-922.623] (-923.881) * (-917.719) [-917.385] (-923.370) (-918.571) -- 0:04:11
      81000 -- (-915.609) [-904.556] (-936.786) (-920.397) * (-910.617) [-909.963] (-919.940) (-921.261) -- 0:04:09
      81500 -- (-926.605) [-906.981] (-910.758) (-921.194) * (-914.919) [-910.161] (-930.594) (-915.503) -- 0:04:07
      82000 -- (-914.428) [-916.374] (-924.062) (-915.697) * (-913.959) [-911.080] (-925.687) (-915.083) -- 0:04:06
      82500 -- [-904.321] (-917.283) (-918.551) (-936.705) * [-911.796] (-917.150) (-928.145) (-913.823) -- 0:04:04
      83000 -- (-909.036) [-912.185] (-920.287) (-910.316) * [-913.191] (-919.203) (-921.107) (-927.455) -- 0:04:03
      83500 -- (-911.762) [-910.396] (-922.795) (-920.439) * [-904.637] (-906.237) (-914.361) (-943.124) -- 0:04:12
      84000 -- (-918.247) (-907.991) [-907.360] (-912.938) * [-906.322] (-928.685) (-912.839) (-928.221) -- 0:04:10
      84500 -- (-932.794) [-911.308] (-919.485) (-918.978) * (-909.916) [-913.807] (-908.368) (-919.839) -- 0:04:09
      85000 -- (-904.561) (-923.256) (-922.460) [-922.917] * (-916.022) (-916.919) [-904.848] (-911.369) -- 0:04:07

      Average standard deviation of split frequencies: 0.037152

      85500 -- (-909.625) (-916.939) [-910.026] (-920.693) * (-931.118) (-923.544) [-921.500] (-908.579) -- 0:04:06
      86000 -- (-915.274) (-908.969) [-902.905] (-909.241) * (-910.650) (-922.028) [-906.580] (-927.524) -- 0:04:04
      86500 -- [-917.507] (-915.791) (-928.237) (-923.736) * (-922.716) [-906.851] (-918.643) (-915.162) -- 0:04:02
      87000 -- (-922.919) [-919.793] (-914.910) (-913.715) * [-920.626] (-915.491) (-936.722) (-916.460) -- 0:04:01
      87500 -- (-912.018) (-920.989) (-923.834) [-920.440] * (-924.087) [-907.140] (-926.032) (-906.515) -- 0:04:10
      88000 -- (-912.625) (-939.653) (-915.205) [-911.687] * (-920.104) (-921.428) [-914.222] (-907.102) -- 0:04:08
      88500 -- [-915.197] (-918.137) (-922.121) (-922.055) * (-919.351) (-911.488) (-910.487) [-911.211] -- 0:04:07
      89000 -- (-919.448) (-925.738) [-909.122] (-920.702) * [-915.663] (-917.062) (-916.886) (-908.504) -- 0:04:05
      89500 -- (-923.217) (-912.626) [-917.124] (-927.989) * (-916.911) [-911.793] (-919.029) (-911.507) -- 0:04:04
      90000 -- [-915.237] (-911.202) (-911.648) (-927.475) * [-909.796] (-924.792) (-913.741) (-911.927) -- 0:04:02

      Average standard deviation of split frequencies: 0.033796

      90500 -- (-913.662) (-913.115) [-907.328] (-923.469) * (-924.329) (-940.011) [-916.689] (-919.738) -- 0:04:01
      91000 -- (-912.851) [-913.317] (-905.017) (-929.109) * (-917.279) (-919.038) [-908.914] (-916.486) -- 0:04:09
      91500 -- [-904.695] (-908.658) (-928.789) (-929.394) * (-918.028) [-910.941] (-913.301) (-924.633) -- 0:04:08
      92000 -- [-910.332] (-916.443) (-918.292) (-929.179) * (-927.103) (-932.687) [-918.863] (-921.289) -- 0:04:06
      92500 -- [-910.547] (-922.659) (-915.308) (-934.038) * [-917.643] (-907.478) (-912.681) (-932.761) -- 0:04:05
      93000 -- [-901.452] (-922.579) (-935.319) (-923.357) * (-914.241) (-915.189) [-912.819] (-913.554) -- 0:04:03
      93500 -- (-909.365) (-923.460) (-931.151) [-917.544] * (-930.178) (-910.550) [-923.704] (-922.038) -- 0:04:02
      94000 -- (-917.801) (-907.128) [-918.887] (-923.448) * (-942.681) (-911.069) (-922.030) [-911.413] -- 0:04:00
      94500 -- [-906.035] (-911.582) (-918.317) (-937.870) * (-912.385) [-920.015] (-930.368) (-918.015) -- 0:03:59
      95000 -- [-918.504] (-905.377) (-919.477) (-934.888) * (-915.155) [-903.553] (-915.352) (-902.820) -- 0:04:07

      Average standard deviation of split frequencies: 0.030907

      95500 -- [-914.871] (-915.240) (-919.506) (-926.818) * (-913.924) (-932.261) (-902.289) [-910.717] -- 0:04:06
      96000 -- (-907.763) [-912.295] (-913.234) (-934.803) * (-915.706) (-926.436) [-907.394] (-914.770) -- 0:04:04
      96500 -- (-915.607) (-923.656) (-922.366) [-914.178] * (-911.464) [-911.102] (-921.366) (-919.798) -- 0:04:03
      97000 -- (-912.384) [-908.819] (-932.963) (-931.052) * (-914.612) (-911.889) [-909.500] (-922.261) -- 0:04:02
      97500 -- (-910.700) (-927.381) (-918.919) [-915.705] * (-923.234) [-915.813] (-920.535) (-917.742) -- 0:04:00
      98000 -- (-914.205) (-915.985) (-911.418) [-907.115] * (-929.803) [-914.826] (-921.686) (-904.277) -- 0:03:59
      98500 -- (-917.912) (-914.805) [-918.322] (-916.409) * (-943.800) [-917.169] (-919.134) (-913.163) -- 0:03:57
      99000 -- [-909.750] (-914.858) (-915.730) (-904.121) * (-916.515) [-915.557] (-925.627) (-911.144) -- 0:04:05
      99500 -- [-916.884] (-915.147) (-925.570) (-916.314) * (-921.824) (-918.085) [-920.310] (-920.079) -- 0:04:04
      100000 -- [-919.823] (-929.588) (-931.775) (-920.048) * [-921.158] (-918.775) (-924.295) (-908.304) -- 0:04:03

      Average standard deviation of split frequencies: 0.032468

      100500 -- (-910.022) (-924.560) (-929.016) [-916.242] * (-917.490) (-915.915) (-934.636) [-905.492] -- 0:04:01
      101000 -- (-917.258) (-926.571) (-931.909) [-911.424] * [-913.065] (-927.113) (-911.665) (-915.048) -- 0:04:00
      101500 -- (-931.374) [-918.421] (-923.212) (-913.456) * (-923.480) (-922.725) [-911.126] (-914.879) -- 0:03:59
      102000 -- [-912.927] (-917.405) (-923.899) (-930.770) * (-913.233) (-921.820) (-916.622) [-903.689] -- 0:03:57
      102500 -- (-913.179) [-928.937] (-924.248) (-929.618) * (-921.427) (-914.099) [-908.936] (-913.290) -- 0:04:05
      103000 -- [-918.031] (-910.022) (-940.908) (-921.385) * (-912.695) [-916.180] (-919.609) (-917.001) -- 0:04:03
      103500 -- [-915.104] (-921.154) (-933.375) (-917.546) * (-910.972) [-916.590] (-920.017) (-917.257) -- 0:04:02
      104000 -- [-907.863] (-928.976) (-945.335) (-917.569) * (-905.031) [-913.994] (-928.587) (-919.786) -- 0:04:01
      104500 -- (-910.430) [-907.411] (-937.378) (-921.139) * [-912.080] (-902.628) (-920.974) (-921.556) -- 0:03:59
      105000 -- (-919.994) [-906.049] (-915.377) (-918.593) * [-913.033] (-920.962) (-918.264) (-922.389) -- 0:03:58

      Average standard deviation of split frequencies: 0.028351

      105500 -- [-911.020] (-909.486) (-918.494) (-916.033) * (-919.623) [-905.650] (-921.246) (-915.442) -- 0:03:57
      106000 -- (-914.016) (-916.067) (-914.892) [-917.006] * (-919.469) (-917.796) [-914.773] (-913.772) -- 0:04:04
      106500 -- (-917.731) [-909.264] (-923.481) (-914.107) * (-918.839) (-914.871) [-907.424] (-909.781) -- 0:04:03
      107000 -- (-920.441) (-938.621) (-913.104) [-914.399] * [-917.300] (-923.765) (-927.590) (-909.408) -- 0:04:02
      107500 -- [-913.834] (-917.507) (-920.821) (-913.674) * [-915.316] (-921.465) (-916.819) (-911.557) -- 0:04:00
      108000 -- (-913.086) [-904.956] (-930.115) (-907.010) * (-919.452) (-912.068) [-909.214] (-920.149) -- 0:03:59
      108500 -- [-922.757] (-906.151) (-933.704) (-918.542) * (-913.241) (-918.364) [-920.466] (-910.468) -- 0:03:58
      109000 -- (-913.316) (-911.870) (-928.679) [-919.951] * (-916.595) (-915.675) [-915.178] (-924.135) -- 0:03:57
      109500 -- (-927.915) [-906.674] (-916.393) (-930.213) * (-923.118) (-912.441) [-907.079] (-928.043) -- 0:03:55
      110000 -- (-916.170) [-908.688] (-918.741) (-924.649) * (-922.496) (-915.480) (-921.106) [-906.405] -- 0:04:02

      Average standard deviation of split frequencies: 0.025842

      110500 -- [-915.777] (-912.057) (-918.648) (-916.438) * (-908.045) (-913.971) (-921.158) [-908.924] -- 0:04:01
      111000 -- (-914.462) (-920.180) [-912.026] (-918.949) * (-916.040) [-909.573] (-935.604) (-920.182) -- 0:04:00
      111500 -- (-918.428) [-906.023] (-914.967) (-912.422) * [-918.458] (-920.399) (-913.182) (-911.267) -- 0:03:59
      112000 -- (-916.637) (-903.486) [-908.354] (-924.723) * (-906.095) (-911.364) (-918.559) [-915.213] -- 0:03:57
      112500 -- (-916.749) (-921.104) (-917.313) [-914.997] * (-920.700) (-926.576) (-913.231) [-909.162] -- 0:03:56
      113000 -- (-913.630) [-916.295] (-928.029) (-909.040) * [-913.562] (-924.981) (-913.301) (-920.550) -- 0:03:55
      113500 -- (-915.754) (-917.214) (-924.248) [-915.194] * (-915.027) (-912.301) [-922.056] (-915.844) -- 0:04:02
      114000 -- (-926.715) (-913.320) (-916.488) [-914.585] * [-902.747] (-910.717) (-921.000) (-915.364) -- 0:04:00
      114500 -- (-936.836) (-916.008) [-914.982] (-914.588) * [-909.154] (-923.848) (-925.645) (-914.650) -- 0:03:59
      115000 -- (-914.831) [-906.392] (-913.534) (-917.282) * [-908.666] (-922.494) (-925.841) (-920.557) -- 0:03:58

      Average standard deviation of split frequencies: 0.028193

      115500 -- (-913.382) (-916.012) (-921.104) [-916.280] * [-916.746] (-931.359) (-915.197) (-917.652) -- 0:03:57
      116000 -- [-922.262] (-930.219) (-916.425) (-914.127) * (-915.974) [-911.417] (-922.990) (-912.451) -- 0:03:56
      116500 -- (-924.292) (-923.807) (-915.887) [-911.615] * [-909.468] (-917.295) (-918.340) (-915.798) -- 0:03:55
      117000 -- [-910.840] (-916.186) (-915.635) (-916.698) * (-908.919) [-909.628] (-925.262) (-915.514) -- 0:03:53
      117500 -- [-916.137] (-920.458) (-913.604) (-913.301) * [-913.021] (-925.883) (-916.939) (-926.926) -- 0:04:00
      118000 -- (-907.259) (-920.434) [-917.959] (-932.613) * (-917.524) (-922.881) [-916.861] (-918.767) -- 0:03:59
      118500 -- (-913.684) [-924.664] (-941.913) (-918.015) * (-920.849) (-913.332) (-907.364) [-908.307] -- 0:03:58
      119000 -- (-916.878) (-927.099) (-923.488) [-913.678] * (-917.600) [-910.862] (-912.692) (-924.991) -- 0:03:56
      119500 -- (-913.552) [-914.038] (-937.093) (-916.969) * (-919.850) (-906.999) [-918.845] (-904.254) -- 0:03:55
      120000 -- [-921.599] (-924.961) (-922.103) (-911.078) * (-919.593) [-909.910] (-922.608) (-911.790) -- 0:03:54

      Average standard deviation of split frequencies: 0.024661

      120500 -- (-916.434) (-921.350) (-925.898) [-916.053] * (-913.220) (-911.581) [-904.346] (-912.093) -- 0:03:53
      121000 -- [-921.259] (-905.996) (-926.769) (-926.300) * (-911.155) [-906.593] (-921.029) (-903.258) -- 0:03:59
      121500 -- (-916.671) (-908.573) [-911.245] (-926.291) * (-922.158) [-909.198] (-929.215) (-905.459) -- 0:03:58
      122000 -- (-938.403) (-910.379) [-920.629] (-917.799) * [-910.154] (-916.484) (-920.542) (-926.255) -- 0:03:57
      122500 -- (-917.375) (-923.302) (-914.083) [-916.151] * (-919.427) (-910.476) (-925.169) [-906.745] -- 0:03:56
      123000 -- (-920.493) (-923.032) (-917.667) [-911.224] * [-906.705] (-916.882) (-923.564) (-913.890) -- 0:03:55
      123500 -- [-904.849] (-904.615) (-909.168) (-919.808) * (-920.912) (-916.296) (-922.835) [-914.187] -- 0:03:54
      124000 -- (-918.694) [-912.082] (-921.372) (-919.314) * [-913.443] (-927.983) (-913.567) (-916.174) -- 0:03:53
      124500 -- (-908.611) [-913.695] (-935.261) (-920.948) * [-902.724] (-920.176) (-921.207) (-919.110) -- 0:03:59
      125000 -- (-918.697) (-923.293) [-912.815] (-925.197) * (-912.412) (-913.801) [-920.445] (-912.163) -- 0:03:58

      Average standard deviation of split frequencies: 0.025529

      125500 -- [-913.370] (-915.605) (-912.402) (-920.276) * (-906.033) (-912.279) [-910.138] (-915.271) -- 0:03:56
      126000 -- (-921.132) (-908.065) (-909.979) [-931.035] * [-913.091] (-911.088) (-912.284) (-912.006) -- 0:03:55
      126500 -- [-917.277] (-911.432) (-928.956) (-927.592) * [-908.580] (-937.018) (-912.499) (-910.714) -- 0:03:54
      127000 -- (-917.392) [-910.393] (-908.907) (-918.315) * [-908.485] (-912.804) (-909.860) (-913.880) -- 0:03:53
      127500 -- (-916.309) (-911.661) (-911.533) [-921.657] * (-909.811) [-912.857] (-906.291) (-908.484) -- 0:03:52
      128000 -- (-924.941) [-910.750] (-908.199) (-922.908) * [-915.830] (-903.978) (-935.990) (-914.315) -- 0:03:51
      128500 -- (-902.314) (-925.665) (-926.568) [-912.222] * (-912.419) [-910.292] (-915.204) (-910.385) -- 0:03:57
      129000 -- [-910.975] (-918.389) (-935.103) (-916.018) * (-929.005) (-920.357) [-909.581] (-916.435) -- 0:03:56
      129500 -- (-929.352) [-911.692] (-935.291) (-915.876) * (-924.582) [-912.073] (-910.786) (-915.075) -- 0:03:55
      130000 -- (-926.246) (-912.077) (-918.461) [-913.629] * (-942.974) (-911.315) [-911.772] (-913.913) -- 0:03:54

      Average standard deviation of split frequencies: 0.023132

      130500 -- (-927.583) [-917.551] (-917.303) (-914.951) * (-916.550) [-914.799] (-909.256) (-915.942) -- 0:03:53
      131000 -- (-916.066) (-935.945) [-905.292] (-916.768) * [-906.484] (-909.850) (-921.996) (-929.250) -- 0:03:52
      131500 -- [-917.640] (-927.586) (-926.035) (-928.066) * (-913.822) [-911.526] (-921.175) (-922.808) -- 0:03:51
      132000 -- [-909.369] (-915.965) (-937.406) (-927.216) * [-906.499] (-912.388) (-913.517) (-917.000) -- 0:03:56
      132500 -- [-916.826] (-922.469) (-938.011) (-923.042) * [-909.934] (-921.742) (-921.933) (-907.951) -- 0:03:55
      133000 -- (-919.229) [-919.018] (-942.104) (-920.639) * (-917.641) (-911.713) [-911.228] (-927.068) -- 0:03:54
      133500 -- (-916.121) [-914.370] (-922.743) (-931.127) * (-932.929) (-919.028) [-908.346] (-922.299) -- 0:03:53
      134000 -- [-906.508] (-910.502) (-917.243) (-920.166) * [-920.346] (-922.407) (-917.752) (-933.415) -- 0:03:52
      134500 -- (-909.641) [-908.594] (-918.843) (-923.983) * (-924.962) [-914.691] (-916.202) (-925.849) -- 0:03:51
      135000 -- (-902.236) (-920.012) [-918.896] (-928.165) * (-916.231) (-914.400) (-906.652) [-920.577] -- 0:03:50

      Average standard deviation of split frequencies: 0.021231

      135500 -- (-910.007) [-916.051] (-910.471) (-911.160) * (-911.887) [-912.866] (-926.381) (-916.095) -- 0:03:49
      136000 -- (-933.695) (-923.033) (-911.288) [-906.781] * (-909.053) [-904.250] (-907.069) (-910.158) -- 0:03:55
      136500 -- (-918.718) [-909.589] (-914.817) (-914.166) * (-917.805) [-909.625] (-911.725) (-919.264) -- 0:03:54
      137000 -- (-903.345) [-919.589] (-923.296) (-914.624) * (-916.778) (-913.441) (-925.868) [-916.526] -- 0:03:53
      137500 -- (-917.856) [-911.169] (-908.537) (-927.928) * (-929.781) (-931.177) [-902.363] (-921.366) -- 0:03:52
      138000 -- (-934.784) (-913.931) [-917.523] (-933.295) * (-910.945) [-910.296] (-927.179) (-920.269) -- 0:03:51
      138500 -- (-906.801) (-912.680) [-910.229] (-922.135) * (-919.153) [-910.557] (-926.700) (-918.381) -- 0:03:50
      139000 -- [-904.018] (-920.854) (-914.226) (-936.087) * (-925.401) (-913.699) (-922.617) [-917.241] -- 0:03:49
      139500 -- (-917.447) (-904.033) [-901.350] (-919.704) * (-927.189) (-906.776) [-921.329] (-915.039) -- 0:03:54
      140000 -- (-926.662) (-910.030) [-917.313] (-909.468) * (-913.114) [-913.331] (-922.369) (-911.045) -- 0:03:53

      Average standard deviation of split frequencies: 0.019389

      140500 -- [-913.597] (-919.390) (-912.799) (-922.626) * (-920.909) [-904.529] (-915.857) (-917.731) -- 0:03:52
      141000 -- [-919.295] (-910.509) (-916.575) (-916.011) * (-915.132) (-908.525) (-928.812) [-917.945] -- 0:03:51
      141500 -- (-917.465) [-923.107] (-916.063) (-918.414) * [-918.819] (-918.464) (-917.879) (-913.832) -- 0:03:50
      142000 -- (-914.644) (-915.797) [-904.418] (-909.663) * (-915.764) (-913.055) (-918.673) [-904.491] -- 0:03:49
      142500 -- (-925.874) (-911.364) [-916.528] (-918.019) * (-912.901) [-908.730] (-920.611) (-930.978) -- 0:03:48
      143000 -- (-928.969) (-921.291) (-917.545) [-908.439] * [-906.765] (-908.503) (-911.007) (-921.098) -- 0:03:47
      143500 -- (-916.513) (-920.045) (-924.285) [-914.011] * [-907.945] (-912.660) (-922.214) (-912.059) -- 0:03:52
      144000 -- (-921.166) (-919.475) (-937.763) [-908.507] * (-912.312) (-917.522) (-918.501) [-904.468] -- 0:03:51
      144500 -- (-908.652) [-913.982] (-926.209) (-911.285) * (-903.557) (-912.797) (-913.276) [-910.619] -- 0:03:50
      145000 -- (-928.609) [-913.236] (-911.709) (-918.553) * (-915.197) (-932.877) (-922.308) [-911.214] -- 0:03:49

      Average standard deviation of split frequencies: 0.024969

      145500 -- [-905.725] (-920.889) (-916.897) (-922.947) * (-923.348) (-918.017) (-941.901) [-917.694] -- 0:03:49
      146000 -- [-910.300] (-924.781) (-921.762) (-923.355) * (-919.725) [-910.394] (-939.716) (-905.633) -- 0:03:48
      146500 -- (-908.506) (-924.602) [-912.408] (-936.355) * (-927.982) (-915.976) (-936.847) [-918.775] -- 0:03:47
      147000 -- (-911.526) (-922.037) [-909.793] (-922.550) * [-909.504] (-927.105) (-944.566) (-917.498) -- 0:03:52
      147500 -- (-925.803) [-907.352] (-912.929) (-913.184) * (-915.998) [-920.237] (-935.712) (-906.096) -- 0:03:51
      148000 -- (-914.169) [-914.552] (-920.258) (-910.431) * (-906.544) (-921.453) (-936.846) [-921.321] -- 0:03:50
      148500 -- (-921.250) [-912.306] (-917.408) (-925.378) * (-913.292) (-918.082) (-945.398) [-912.277] -- 0:03:49
      149000 -- (-910.672) (-915.453) (-921.847) [-919.057] * [-902.944] (-915.072) (-933.012) (-910.893) -- 0:03:48
      149500 -- (-913.565) [-907.260] (-931.252) (-907.461) * [-907.758] (-917.575) (-934.874) (-922.983) -- 0:03:47
      150000 -- (-926.313) (-930.349) (-910.748) [-912.519] * [-914.982] (-915.117) (-919.891) (-916.177) -- 0:03:46

      Average standard deviation of split frequencies: 0.022086

      150500 -- (-918.861) [-906.181] (-912.754) (-918.433) * [-913.774] (-925.775) (-919.070) (-916.354) -- 0:03:51
      151000 -- (-911.993) [-910.142] (-913.393) (-911.142) * [-912.201] (-921.223) (-915.213) (-910.359) -- 0:03:50
      151500 -- (-916.415) (-910.855) (-917.456) [-906.372] * (-924.747) [-909.915] (-917.132) (-915.706) -- 0:03:49
      152000 -- [-915.629] (-908.174) (-912.848) (-910.977) * (-918.206) (-927.588) (-912.347) [-913.271] -- 0:03:48
      152500 -- (-918.058) (-917.771) [-925.285] (-920.473) * (-908.370) (-916.058) (-910.974) [-913.495] -- 0:03:47
      153000 -- [-899.583] (-916.992) (-917.361) (-915.288) * (-907.608) (-913.262) [-907.132] (-920.703) -- 0:03:46
      153500 -- [-907.329] (-927.639) (-926.259) (-921.048) * [-908.272] (-918.903) (-920.536) (-917.210) -- 0:03:46
      154000 -- [-911.328] (-921.644) (-911.470) (-925.604) * (-918.776) (-913.318) [-908.600] (-914.416) -- 0:03:45
      154500 -- [-917.194] (-917.394) (-912.174) (-918.050) * [-910.488] (-908.437) (-915.882) (-911.363) -- 0:03:49
      155000 -- (-916.950) [-909.502] (-931.014) (-907.558) * [-912.821] (-899.467) (-923.867) (-919.944) -- 0:03:48

      Average standard deviation of split frequencies: 0.021556

      155500 -- (-920.380) (-909.555) (-921.662) [-907.106] * (-903.008) (-915.900) (-931.019) [-904.658] -- 0:03:48
      156000 -- (-914.548) [-906.179] (-927.741) (-914.702) * (-920.181) [-909.018] (-921.772) (-919.819) -- 0:03:47
      156500 -- (-919.518) [-931.746] (-916.149) (-916.708) * (-909.577) (-928.668) (-920.406) [-916.879] -- 0:03:46
      157000 -- (-927.752) [-912.906] (-911.853) (-926.284) * (-914.005) (-914.808) [-925.616] (-924.816) -- 0:03:45
      157500 -- (-913.062) (-908.765) (-906.302) [-910.810] * (-911.748) [-911.913] (-923.017) (-916.877) -- 0:03:44
      158000 -- (-921.779) [-914.934] (-908.574) (-918.235) * (-912.948) [-909.116] (-920.186) (-917.044) -- 0:03:49
      158500 -- [-917.834] (-918.411) (-918.860) (-920.601) * [-910.048] (-919.497) (-931.914) (-918.156) -- 0:03:48
      159000 -- [-910.269] (-916.666) (-916.102) (-923.532) * (-917.111) [-915.211] (-922.020) (-915.890) -- 0:03:47
      159500 -- (-913.955) (-919.128) [-914.481] (-911.554) * (-920.826) (-921.293) [-924.009] (-912.597) -- 0:03:46
      160000 -- (-929.330) [-908.636] (-919.286) (-918.509) * (-908.793) [-904.704] (-920.444) (-922.160) -- 0:03:45

      Average standard deviation of split frequencies: 0.024520

      160500 -- (-925.986) [-913.655] (-912.319) (-926.847) * [-919.734] (-916.080) (-928.971) (-909.856) -- 0:03:44
      161000 -- (-918.933) (-915.799) [-914.143] (-919.876) * [-908.573] (-915.526) (-911.398) (-924.970) -- 0:03:44
      161500 -- [-911.866] (-921.634) (-912.595) (-921.135) * (-913.542) (-910.859) [-912.707] (-925.967) -- 0:03:48
      162000 -- (-914.630) [-917.673] (-921.462) (-920.658) * (-910.243) (-931.629) (-910.895) [-904.980] -- 0:03:47
      162500 -- (-909.632) [-920.089] (-917.948) (-915.597) * (-907.251) (-917.859) (-911.328) [-909.681] -- 0:03:46
      163000 -- (-914.847) [-919.119] (-919.800) (-922.073) * [-911.555] (-910.612) (-934.028) (-911.548) -- 0:03:45
      163500 -- (-923.315) [-903.776] (-926.963) (-916.734) * (-911.191) (-906.855) (-924.792) [-910.710] -- 0:03:45
      164000 -- (-915.077) [-910.561] (-933.957) (-913.792) * (-919.213) [-907.193] (-917.342) (-902.326) -- 0:03:44
      164500 -- [-935.109] (-924.176) (-933.051) (-913.797) * (-935.629) [-901.747] (-916.557) (-908.981) -- 0:03:43
      165000 -- (-928.860) [-917.947] (-919.476) (-914.960) * (-931.045) (-911.023) (-914.776) [-912.291] -- 0:03:42

      Average standard deviation of split frequencies: 0.021298

      165500 -- (-918.669) [-905.789] (-910.893) (-913.182) * (-930.224) (-923.433) (-914.706) [-908.277] -- 0:03:46
      166000 -- (-916.307) [-911.177] (-921.976) (-913.327) * (-917.284) (-916.905) (-908.205) [-907.043] -- 0:03:46
      166500 -- (-917.496) (-906.353) (-924.583) [-914.028] * [-913.336] (-912.699) (-919.547) (-913.118) -- 0:03:45
      167000 -- (-909.018) [-915.128] (-923.901) (-925.385) * (-915.162) (-914.591) (-917.114) [-903.817] -- 0:03:44
      167500 -- (-916.524) (-912.578) (-933.504) [-910.144] * (-924.402) (-913.751) (-913.327) [-919.365] -- 0:03:43
      168000 -- (-919.230) (-916.955) (-939.536) [-917.089] * (-908.563) (-921.337) (-916.394) [-912.037] -- 0:03:42
      168500 -- (-911.888) (-911.222) [-916.288] (-929.846) * (-907.540) [-911.029] (-930.745) (-908.973) -- 0:03:42
      169000 -- [-920.601] (-912.318) (-925.266) (-923.163) * (-911.864) (-924.745) [-911.641] (-916.855) -- 0:03:46
      169500 -- (-910.533) (-913.240) [-908.567] (-912.803) * (-926.217) (-915.825) (-914.682) [-913.992] -- 0:03:45
      170000 -- (-909.430) (-922.957) (-917.853) [-920.819] * (-918.685) (-926.031) [-920.949] (-914.111) -- 0:03:44

      Average standard deviation of split frequencies: 0.020808

      170500 -- (-921.138) (-921.166) [-912.324] (-923.859) * (-928.583) (-911.882) (-918.336) [-904.884] -- 0:03:43
      171000 -- (-915.352) (-937.297) [-918.903] (-908.771) * (-918.154) (-914.273) (-919.877) [-910.306] -- 0:03:43
      171500 -- (-911.838) [-923.470] (-918.409) (-909.037) * (-921.251) [-918.084] (-932.886) (-917.845) -- 0:03:42
      172000 -- (-904.482) (-922.579) (-920.093) [-922.080] * (-921.083) [-911.681] (-924.299) (-932.089) -- 0:03:41
      172500 -- (-904.521) (-912.885) (-921.419) [-906.857] * (-916.093) [-913.577] (-931.827) (-922.704) -- 0:03:45
      173000 -- [-907.511] (-910.446) (-919.485) (-916.892) * (-925.860) (-911.774) (-925.382) [-909.112] -- 0:03:44
      173500 -- [-913.809] (-918.973) (-916.814) (-918.160) * (-915.839) (-930.775) (-916.233) [-912.775] -- 0:03:43
      174000 -- [-915.432] (-918.582) (-909.768) (-919.517) * [-912.303] (-946.665) (-909.552) (-916.595) -- 0:03:43
      174500 -- [-916.145] (-926.061) (-906.454) (-913.690) * (-920.464) (-905.345) (-907.613) [-914.923] -- 0:03:42
      175000 -- [-912.568] (-919.060) (-909.003) (-923.001) * (-914.876) [-909.285] (-930.115) (-909.503) -- 0:03:41

      Average standard deviation of split frequencies: 0.019463

      175500 -- (-916.339) (-937.972) [-903.550] (-917.436) * (-920.375) [-913.509] (-917.708) (-922.388) -- 0:03:40
      176000 -- (-918.574) (-923.303) [-910.585] (-926.126) * (-904.363) (-907.689) [-910.386] (-923.694) -- 0:03:44
      176500 -- (-921.292) (-922.189) (-914.344) [-908.824] * (-943.877) [-907.911] (-919.185) (-918.733) -- 0:03:43
      177000 -- (-927.607) [-913.671] (-910.469) (-919.308) * (-926.632) [-910.448] (-915.606) (-916.433) -- 0:03:43
      177500 -- (-921.425) (-910.395) [-911.565] (-921.007) * (-921.369) (-914.144) [-921.431] (-913.761) -- 0:03:42
      178000 -- [-912.848] (-915.942) (-915.852) (-933.124) * [-909.655] (-914.834) (-929.027) (-919.980) -- 0:03:41
      178500 -- (-922.376) (-918.688) [-917.430] (-915.002) * (-928.822) (-916.748) (-904.649) [-924.810] -- 0:03:40
      179000 -- (-917.383) [-912.502] (-914.585) (-944.543) * (-912.445) [-909.186] (-909.843) (-910.432) -- 0:03:40
      179500 -- (-914.090) (-913.513) [-919.013] (-918.537) * (-921.640) [-902.779] (-918.738) (-911.285) -- 0:03:43
      180000 -- (-908.685) [-911.712] (-913.821) (-916.963) * (-923.024) [-907.586] (-930.138) (-920.044) -- 0:03:43

      Average standard deviation of split frequencies: 0.017519

      180500 -- (-911.538) (-912.700) [-919.494] (-927.022) * (-919.642) (-923.612) (-919.119) [-911.950] -- 0:03:42
      181000 -- (-914.169) (-920.726) [-913.568] (-922.170) * (-914.684) (-930.422) (-936.612) [-913.594] -- 0:03:41
      181500 -- (-918.786) (-922.839) [-915.767] (-923.425) * (-913.493) (-918.071) [-910.544] (-916.835) -- 0:03:40
      182000 -- (-919.296) (-914.417) [-920.689] (-921.108) * (-916.187) [-906.361] (-919.594) (-909.658) -- 0:03:40
      182500 -- [-919.371] (-912.067) (-918.710) (-911.948) * (-930.454) (-910.311) (-917.410) [-907.720] -- 0:03:39
      183000 -- (-918.811) [-915.773] (-914.394) (-938.599) * (-911.473) (-910.617) [-919.482] (-909.447) -- 0:03:38
      183500 -- [-919.004] (-903.166) (-909.814) (-917.507) * (-931.960) (-910.416) [-926.378] (-925.249) -- 0:03:42
      184000 -- (-904.050) [-906.402] (-921.642) (-911.897) * (-924.775) [-914.265] (-924.659) (-921.631) -- 0:03:41
      184500 -- (-915.902) [-914.280] (-916.472) (-914.331) * (-922.260) (-919.768) (-913.585) [-911.365] -- 0:03:41
      185000 -- (-913.781) [-910.038] (-922.954) (-917.472) * (-923.255) (-929.636) [-912.090] (-923.083) -- 0:03:40

      Average standard deviation of split frequencies: 0.016996

      185500 -- [-918.759] (-905.197) (-925.299) (-916.133) * (-921.577) (-938.021) (-920.363) [-907.347] -- 0:03:39
      186000 -- (-924.631) [-918.573] (-931.632) (-910.042) * (-916.322) (-939.289) [-907.293] (-913.859) -- 0:03:38
      186500 -- (-928.928) (-912.633) (-918.395) [-906.446] * [-902.509] (-934.378) (-911.976) (-916.620) -- 0:03:38
      187000 -- (-934.526) [-919.483] (-919.936) (-916.288) * (-915.474) (-926.798) (-911.331) [-902.256] -- 0:03:41
      187500 -- (-916.605) [-908.690] (-912.446) (-907.915) * (-913.422) (-929.514) [-912.169] (-917.300) -- 0:03:41
      188000 -- (-918.004) (-907.677) (-923.894) [-911.395] * [-909.432] (-921.293) (-925.875) (-916.822) -- 0:03:40
      188500 -- (-922.909) (-924.369) [-918.062] (-915.088) * (-928.196) (-933.336) (-915.859) [-911.201] -- 0:03:39
      189000 -- (-910.812) (-918.653) (-924.041) [-910.119] * (-910.910) (-926.511) (-917.165) [-915.133] -- 0:03:38
      189500 -- (-915.644) (-928.709) (-907.449) [-913.162] * [-916.437] (-931.781) (-925.785) (-918.694) -- 0:03:38
      190000 -- (-916.303) (-918.594) (-919.950) [-917.664] * [-916.515] (-924.326) (-920.053) (-917.502) -- 0:03:37

      Average standard deviation of split frequencies: 0.018131

      190500 -- [-916.740] (-927.761) (-910.209) (-916.898) * (-928.327) (-925.289) (-910.377) [-912.665] -- 0:03:36
      191000 -- (-918.631) (-920.159) [-915.679] (-912.347) * [-916.477] (-923.467) (-912.566) (-915.247) -- 0:03:40
      191500 -- (-920.604) (-923.637) (-913.356) [-913.003] * [-909.123] (-929.243) (-912.577) (-910.870) -- 0:03:39
      192000 -- [-915.672] (-937.604) (-913.972) (-930.315) * (-928.470) (-916.602) (-913.939) [-912.400] -- 0:03:38
      192500 -- [-905.754] (-918.340) (-918.674) (-918.402) * (-916.302) (-927.921) (-915.720) [-915.333] -- 0:03:38
      193000 -- (-903.744) [-911.316] (-922.940) (-915.332) * [-909.669] (-916.460) (-923.032) (-915.614) -- 0:03:37
      193500 -- (-905.174) [-913.468] (-915.791) (-923.138) * (-909.604) (-923.614) [-912.424] (-926.513) -- 0:03:36
      194000 -- (-912.643) [-913.099] (-923.506) (-922.043) * (-906.345) (-921.278) [-914.324] (-934.025) -- 0:03:36
      194500 -- (-902.855) (-916.995) [-900.099] (-937.906) * [-912.485] (-931.149) (-908.279) (-915.112) -- 0:03:39
      195000 -- [-919.185] (-919.165) (-907.666) (-925.371) * [-910.364] (-920.504) (-915.498) (-917.428) -- 0:03:38

      Average standard deviation of split frequencies: 0.016149

      195500 -- (-918.488) (-928.341) (-913.636) [-914.612] * (-916.017) [-909.335] (-927.983) (-919.173) -- 0:03:38
      196000 -- [-912.617] (-930.357) (-917.179) (-928.192) * [-907.493] (-912.029) (-918.561) (-936.932) -- 0:03:37
      196500 -- (-910.813) (-917.759) (-924.564) [-907.567] * [-910.237] (-908.679) (-912.723) (-937.482) -- 0:03:36
      197000 -- (-913.490) (-916.563) [-907.512] (-911.006) * (-935.912) (-903.723) [-913.812] (-933.915) -- 0:03:36
      197500 -- (-906.176) (-929.915) [-923.950] (-910.636) * (-939.802) [-907.868] (-921.223) (-907.601) -- 0:03:35
      198000 -- (-918.300) (-921.879) [-910.906] (-917.243) * (-917.880) (-926.077) [-908.042] (-922.280) -- 0:03:34
      198500 -- (-907.944) (-930.419) [-908.867] (-912.006) * (-923.069) [-922.642] (-917.235) (-911.901) -- 0:03:38
      199000 -- (-908.138) [-911.037] (-906.994) (-920.749) * (-924.221) [-913.639] (-904.669) (-907.467) -- 0:03:37
      199500 -- (-906.726) [-914.375] (-919.436) (-925.118) * (-928.123) (-920.408) [-900.378] (-925.943) -- 0:03:36
      200000 -- (-920.111) (-927.243) [-914.790] (-913.975) * (-908.316) (-912.127) [-910.028] (-917.529) -- 0:03:36

      Average standard deviation of split frequencies: 0.013116

      200500 -- [-908.135] (-920.158) (-919.363) (-925.023) * (-925.849) [-923.030] (-910.934) (-917.969) -- 0:03:35
      201000 -- (-914.657) [-906.531] (-910.622) (-924.494) * (-926.654) (-925.684) [-911.614] (-926.602) -- 0:03:34
      201500 -- (-913.016) (-908.031) [-908.424] (-935.454) * (-930.248) [-915.647] (-925.924) (-942.692) -- 0:03:33
      202000 -- (-922.551) [-926.796] (-914.776) (-922.722) * (-910.226) [-914.774] (-913.165) (-922.700) -- 0:03:37
      202500 -- (-919.285) [-910.527] (-914.394) (-917.531) * (-918.343) [-919.750] (-913.851) (-924.058) -- 0:03:36
      203000 -- (-912.176) (-910.906) (-918.037) [-919.623] * (-921.401) [-907.278] (-924.385) (-929.075) -- 0:03:35
      203500 -- [-910.502] (-922.889) (-917.400) (-922.951) * (-931.451) [-907.564] (-923.740) (-932.815) -- 0:03:35
      204000 -- (-905.432) (-915.286) [-917.049] (-908.197) * (-924.089) (-911.671) (-917.071) [-918.940] -- 0:03:34
      204500 -- [-903.863] (-918.561) (-922.525) (-905.729) * (-927.944) (-915.544) [-909.823] (-918.702) -- 0:03:33
      205000 -- (-917.869) (-906.504) (-920.570) [-915.657] * (-928.986) (-921.962) [-912.686] (-918.405) -- 0:03:33

      Average standard deviation of split frequencies: 0.014562

      205500 -- (-936.300) (-910.883) (-937.737) [-906.600] * (-926.101) [-919.326] (-922.949) (-921.946) -- 0:03:32
      206000 -- (-916.114) (-937.429) (-915.631) [-910.415] * (-924.196) [-907.791] (-919.744) (-921.489) -- 0:03:35
      206500 -- [-909.758] (-914.690) (-921.243) (-923.441) * [-916.451] (-921.961) (-933.668) (-925.729) -- 0:03:35
      207000 -- [-910.046] (-904.516) (-906.044) (-916.674) * (-919.055) (-925.717) (-924.461) [-910.737] -- 0:03:34
      207500 -- (-902.029) (-912.123) [-905.822] (-917.578) * (-916.657) (-924.603) [-913.259] (-912.614) -- 0:03:33
      208000 -- [-910.311] (-916.000) (-912.187) (-920.598) * [-910.349] (-923.804) (-922.044) (-918.359) -- 0:03:33
      208500 -- (-906.284) (-923.962) [-910.830] (-917.818) * (-919.673) (-923.959) [-917.386] (-917.268) -- 0:03:32
      209000 -- (-926.848) [-914.791] (-907.825) (-916.834) * (-913.759) (-909.818) (-918.326) [-919.201] -- 0:03:31
      209500 -- (-918.157) (-925.440) [-908.320] (-921.602) * [-905.444] (-918.699) (-932.118) (-916.450) -- 0:03:35
      210000 -- (-916.455) (-920.129) (-912.320) [-912.891] * (-913.691) [-916.491] (-918.816) (-928.090) -- 0:03:34

      Average standard deviation of split frequencies: 0.015850

      210500 -- [-911.458] (-912.299) (-922.502) (-934.574) * (-922.995) (-926.576) [-909.121] (-917.077) -- 0:03:33
      211000 -- [-911.669] (-920.111) (-927.801) (-917.157) * (-931.884) [-917.201] (-920.000) (-915.358) -- 0:03:33
      211500 -- [-920.025] (-914.974) (-914.246) (-925.058) * (-936.875) (-916.347) (-914.799) [-907.530] -- 0:03:32
      212000 -- (-923.621) [-911.279] (-915.441) (-919.406) * (-929.846) (-928.992) (-907.280) [-911.761] -- 0:03:31
      212500 -- (-920.979) (-916.633) (-922.511) [-910.155] * (-920.921) (-926.262) [-913.850] (-914.235) -- 0:03:31
      213000 -- (-925.128) (-915.095) [-911.985] (-904.521) * (-915.070) (-924.988) [-916.324] (-917.638) -- 0:03:30
      213500 -- (-917.353) (-925.779) [-916.638] (-909.758) * (-920.904) (-933.752) [-917.264] (-916.854) -- 0:03:33
      214000 -- (-919.965) (-923.386) [-924.398] (-921.896) * (-908.974) (-946.188) (-913.730) [-910.343] -- 0:03:33
      214500 -- (-924.216) (-934.012) [-915.247] (-919.159) * [-909.999] (-921.764) (-919.216) (-913.086) -- 0:03:32
      215000 -- (-931.578) (-926.211) (-927.054) [-910.964] * [-908.593] (-920.829) (-924.006) (-927.486) -- 0:03:31

      Average standard deviation of split frequencies: 0.016467

      215500 -- (-928.927) [-907.649] (-929.021) (-906.002) * [-915.800] (-917.346) (-910.637) (-922.059) -- 0:03:31
      216000 -- (-916.578) (-907.890) [-907.894] (-907.423) * (-921.325) (-927.212) (-919.719) [-911.551] -- 0:03:30
      216500 -- (-922.782) (-911.106) (-920.083) [-909.962] * [-918.285] (-930.693) (-913.200) (-926.662) -- 0:03:29
      217000 -- (-916.975) (-919.743) [-916.386] (-906.362) * [-913.906] (-918.365) (-919.087) (-916.693) -- 0:03:32
      217500 -- (-918.070) (-921.647) (-936.549) [-908.235] * (-911.723) [-927.176] (-917.102) (-922.537) -- 0:03:32
      218000 -- (-921.871) [-912.264] (-914.308) (-909.480) * (-917.018) [-935.095] (-926.053) (-916.158) -- 0:03:31
      218500 -- (-916.651) [-924.779] (-917.423) (-907.402) * (-910.793) (-914.194) (-932.414) [-913.257] -- 0:03:31
      219000 -- [-916.529] (-900.740) (-913.301) (-928.662) * [-906.546] (-913.171) (-924.259) (-914.594) -- 0:03:30
      219500 -- (-920.673) [-906.889] (-930.387) (-920.298) * [-909.004] (-919.953) (-933.229) (-916.433) -- 0:03:29
      220000 -- (-922.114) [-924.739] (-930.372) (-921.420) * [-908.953] (-924.230) (-926.786) (-921.197) -- 0:03:29

      Average standard deviation of split frequencies: 0.017090

      220500 -- [-916.390] (-917.976) (-921.224) (-918.838) * (-920.854) (-923.110) (-925.270) [-926.375] -- 0:03:28
      221000 -- [-914.200] (-915.802) (-914.237) (-914.797) * (-915.122) (-921.791) (-906.599) [-914.222] -- 0:03:31
      221500 -- [-910.702] (-905.392) (-927.242) (-910.739) * [-905.256] (-924.625) (-914.944) (-925.970) -- 0:03:30
      222000 -- (-909.826) (-907.702) (-919.578) [-906.349] * [-909.612] (-922.027) (-913.499) (-911.779) -- 0:03:30
      222500 -- (-918.707) (-927.587) (-916.542) [-913.899] * [-914.329] (-934.830) (-909.989) (-927.278) -- 0:03:29
      223000 -- (-912.206) (-913.515) [-921.020] (-920.210) * (-910.836) [-913.938] (-911.081) (-915.381) -- 0:03:29
      223500 -- [-909.791] (-921.918) (-917.703) (-920.248) * (-913.552) [-918.443] (-918.998) (-922.267) -- 0:03:28
      224000 -- (-909.600) (-911.924) [-913.096] (-914.101) * (-929.016) (-929.141) [-918.451] (-915.524) -- 0:03:27
      224500 -- (-914.315) [-915.401] (-921.954) (-914.127) * (-922.960) (-929.039) (-924.651) [-913.466] -- 0:03:30
      225000 -- (-912.721) (-913.777) (-917.153) [-909.742] * (-913.553) (-925.860) (-919.059) [-921.600] -- 0:03:30

      Average standard deviation of split frequencies: 0.017035

      225500 -- (-920.019) [-911.924] (-921.667) (-923.794) * [-916.742] (-930.391) (-914.745) (-918.966) -- 0:03:29
      226000 -- (-916.694) [-911.622] (-924.199) (-916.337) * (-907.329) [-907.628] (-916.070) (-909.795) -- 0:03:28
      226500 -- (-918.898) (-925.399) [-912.802] (-910.876) * [-917.931] (-910.299) (-916.007) (-912.875) -- 0:03:28
      227000 -- (-923.503) [-915.442] (-927.129) (-934.979) * (-920.848) (-924.354) (-908.115) [-902.270] -- 0:03:27
      227500 -- (-908.197) (-928.513) [-915.080] (-917.967) * [-913.935] (-923.552) (-917.732) (-925.893) -- 0:03:27
      228000 -- (-919.822) (-925.042) [-908.716] (-908.621) * (-906.749) (-911.986) [-917.586] (-913.936) -- 0:03:26
      228500 -- (-922.174) (-925.239) (-920.573) [-908.362] * (-906.537) (-926.467) [-918.568] (-911.330) -- 0:03:29
      229000 -- (-914.069) (-916.020) (-928.417) [-904.859] * (-905.489) (-915.988) (-923.898) [-911.837] -- 0:03:28
      229500 -- (-916.204) [-916.184] (-915.636) (-920.608) * (-905.063) (-916.289) (-916.835) [-920.823] -- 0:03:28
      230000 -- (-913.038) (-921.496) [-912.242] (-916.235) * [-910.130] (-911.745) (-913.390) (-922.507) -- 0:03:27

      Average standard deviation of split frequencies: 0.018207

      230500 -- (-917.511) [-908.192] (-916.328) (-913.719) * (-920.406) [-910.811] (-910.738) (-937.877) -- 0:03:26
      231000 -- (-924.628) [-917.145] (-933.511) (-913.961) * (-913.905) (-925.529) (-930.700) [-918.501] -- 0:03:26
      231500 -- (-916.850) (-918.383) (-931.772) [-910.629] * [-925.330] (-916.729) (-924.608) (-927.807) -- 0:03:25
      232000 -- [-915.900] (-919.521) (-909.542) (-906.314) * [-916.438] (-910.838) (-936.688) (-921.188) -- 0:03:28
      232500 -- (-924.505) (-922.297) (-925.533) [-912.923] * (-922.233) (-910.674) (-949.298) [-909.615] -- 0:03:27
      233000 -- [-906.804] (-911.227) (-917.894) (-914.036) * [-919.386] (-903.625) (-930.138) (-934.612) -- 0:03:27
      233500 -- (-917.937) (-914.179) (-912.726) [-916.762] * [-908.465] (-909.039) (-916.024) (-908.551) -- 0:03:26
      234000 -- [-915.542] (-911.049) (-914.719) (-917.381) * (-913.341) [-917.733] (-918.150) (-930.170) -- 0:03:26
      234500 -- (-917.160) [-916.966] (-926.126) (-908.166) * (-915.410) (-933.482) (-912.633) [-909.108] -- 0:03:25
      235000 -- (-910.711) [-920.024] (-930.619) (-916.558) * [-909.941] (-929.008) (-915.000) (-923.953) -- 0:03:25

      Average standard deviation of split frequencies: 0.015435

      235500 -- [-904.619] (-910.390) (-910.748) (-920.379) * (-931.814) [-920.952] (-917.404) (-919.810) -- 0:03:27
      236000 -- (-911.911) (-915.094) [-915.387] (-920.400) * (-917.910) (-922.714) (-912.146) [-911.882] -- 0:03:27
      236500 -- (-919.769) (-902.046) (-914.250) [-918.140] * (-925.768) (-910.526) (-904.554) [-915.188] -- 0:03:26
      237000 -- (-911.332) (-915.440) [-908.382] (-916.138) * (-919.613) (-906.590) (-923.300) [-911.082] -- 0:03:26
      237500 -- (-932.831) (-915.217) [-907.239] (-935.906) * (-923.303) [-906.239] (-912.499) (-918.372) -- 0:03:25
      238000 -- (-919.034) (-911.949) (-905.014) [-905.494] * (-921.069) [-908.457] (-913.122) (-920.699) -- 0:03:24
      238500 -- (-921.619) (-921.976) [-921.885] (-921.625) * (-927.028) (-919.136) [-917.781] (-916.300) -- 0:03:24
      239000 -- [-913.998] (-920.462) (-909.665) (-914.105) * (-922.566) (-907.950) (-911.029) [-914.624] -- 0:03:23
      239500 -- (-914.471) [-912.672] (-916.351) (-914.386) * (-916.943) (-910.173) [-910.739] (-913.309) -- 0:03:26
      240000 -- (-931.642) (-919.051) (-912.844) [-920.692] * (-913.801) [-911.587] (-909.799) (-931.341) -- 0:03:25

      Average standard deviation of split frequencies: 0.015314

      240500 -- (-919.885) [-917.284] (-917.351) (-919.614) * (-916.484) [-908.721] (-917.289) (-915.678) -- 0:03:25
      241000 -- (-924.633) (-919.259) (-926.552) [-924.335] * (-908.045) (-919.418) [-912.084] (-919.715) -- 0:03:24
      241500 -- [-910.467] (-927.387) (-912.542) (-918.984) * (-907.810) [-907.656] (-913.522) (-917.527) -- 0:03:24
      242000 -- (-907.387) [-914.063] (-917.208) (-918.831) * (-920.565) [-917.003] (-909.226) (-922.490) -- 0:03:23
      242500 -- [-915.508] (-921.004) (-916.550) (-914.787) * (-907.055) (-931.408) (-913.051) [-905.213] -- 0:03:23
      243000 -- [-906.603] (-917.142) (-921.862) (-924.402) * (-923.691) (-927.656) (-913.837) [-914.146] -- 0:03:25
      243500 -- (-910.503) (-931.404) (-917.003) [-908.564] * [-910.744] (-928.827) (-932.393) (-906.786) -- 0:03:25
      244000 -- (-925.325) (-912.288) [-914.363] (-917.428) * (-906.108) (-914.620) (-915.154) [-923.099] -- 0:03:24
      244500 -- [-917.580] (-913.664) (-912.062) (-908.220) * [-908.169] (-919.684) (-908.766) (-929.755) -- 0:03:23
      245000 -- [-911.626] (-932.537) (-915.786) (-905.534) * (-917.046) [-919.807] (-908.417) (-946.049) -- 0:03:23

      Average standard deviation of split frequencies: 0.014982

      245500 -- (-913.080) (-911.388) [-907.838] (-918.665) * (-930.161) [-916.978] (-908.812) (-936.764) -- 0:03:22
      246000 -- (-918.582) (-924.481) (-911.995) [-914.133] * [-905.458] (-920.010) (-910.529) (-926.220) -- 0:03:22
      246500 -- (-924.339) (-915.741) (-927.573) [-907.520] * [-910.996] (-923.274) (-918.556) (-933.109) -- 0:03:21
      247000 -- [-916.828] (-911.557) (-915.780) (-920.555) * [-927.781] (-917.683) (-918.271) (-909.840) -- 0:03:24
      247500 -- [-903.596] (-934.294) (-909.208) (-919.348) * [-910.149] (-917.177) (-902.518) (-915.389) -- 0:03:23
      248000 -- (-932.529) (-930.787) (-923.789) [-911.339] * (-919.626) (-923.527) [-906.208] (-921.590) -- 0:03:23
      248500 -- (-928.203) (-918.208) [-913.833] (-907.493) * (-912.996) [-906.414] (-917.304) (-915.360) -- 0:03:22
      249000 -- (-914.802) (-921.259) [-911.089] (-914.354) * [-915.706] (-909.628) (-929.498) (-924.181) -- 0:03:22
      249500 -- [-909.200] (-919.191) (-912.354) (-905.059) * (-932.009) [-923.216] (-915.157) (-923.873) -- 0:03:21
      250000 -- [-915.234] (-920.393) (-928.864) (-914.835) * (-919.035) [-912.409] (-920.955) (-921.958) -- 0:03:21

      Average standard deviation of split frequencies: 0.014532

      250500 -- (-911.182) (-918.366) (-920.302) [-915.323] * (-924.659) (-919.430) [-909.931] (-918.994) -- 0:03:23
      251000 -- [-908.139] (-925.408) (-927.620) (-923.283) * [-915.172] (-919.991) (-925.271) (-923.054) -- 0:03:22
      251500 -- (-922.369) (-927.943) [-915.043] (-908.632) * (-912.320) (-911.134) (-922.684) [-906.827] -- 0:03:22
      252000 -- [-908.397] (-915.045) (-919.935) (-919.543) * (-921.952) (-925.402) (-925.434) [-913.118] -- 0:03:21
      252500 -- (-915.651) (-910.433) (-917.052) [-903.333] * (-907.399) (-925.433) (-911.675) [-911.957] -- 0:03:21
      253000 -- (-910.783) [-923.078] (-919.296) (-938.124) * (-916.587) (-912.527) (-912.408) [-910.121] -- 0:03:20
      253500 -- (-918.322) (-922.264) [-911.696] (-930.767) * (-911.960) [-913.095] (-928.234) (-925.871) -- 0:03:20
      254000 -- (-914.577) [-907.508] (-916.837) (-924.435) * (-920.117) [-917.629] (-923.782) (-923.987) -- 0:03:19
      254500 -- (-916.126) (-910.466) [-917.808] (-930.532) * (-912.034) (-915.835) [-913.256] (-917.632) -- 0:03:22
      255000 -- (-919.277) [-902.140] (-918.892) (-926.200) * (-918.774) (-915.678) (-913.303) [-924.920] -- 0:03:21

      Average standard deviation of split frequencies: 0.015066

      255500 -- (-919.485) [-903.100] (-922.329) (-917.180) * [-906.842] (-923.435) (-922.577) (-923.648) -- 0:03:21
      256000 -- (-926.281) [-910.333] (-916.484) (-924.155) * (-918.884) (-922.644) (-919.077) [-922.824] -- 0:03:20
      256500 -- (-914.538) (-909.198) [-928.083] (-924.780) * (-916.313) (-911.202) (-917.686) [-919.727] -- 0:03:20
      257000 -- (-926.888) (-910.508) [-911.439] (-913.217) * (-937.154) [-914.142] (-912.984) (-919.837) -- 0:03:19
      257500 -- (-919.335) (-914.942) [-906.912] (-932.703) * [-904.002] (-929.288) (-918.461) (-919.985) -- 0:03:18
      258000 -- (-926.625) [-916.814] (-904.995) (-921.492) * (-919.385) [-918.279] (-937.167) (-921.833) -- 0:03:21
      258500 -- (-917.788) (-919.893) [-902.161] (-924.643) * (-916.136) (-918.233) (-926.981) [-912.163] -- 0:03:20
      259000 -- (-918.888) (-917.237) [-909.729] (-923.007) * (-915.618) [-914.119] (-922.825) (-917.649) -- 0:03:20
      259500 -- (-908.562) (-913.601) (-903.886) [-918.851] * (-916.232) (-907.846) [-903.865] (-925.664) -- 0:03:19
      260000 -- (-917.817) [-913.339] (-920.086) (-915.959) * (-917.607) (-910.571) [-911.391] (-928.680) -- 0:03:19

      Average standard deviation of split frequencies: 0.016934

      260500 -- (-922.255) [-913.369] (-933.027) (-913.311) * [-911.962] (-914.988) (-920.485) (-933.425) -- 0:03:18
      261000 -- (-928.951) [-913.258] (-929.632) (-912.214) * (-911.510) [-922.703] (-911.319) (-917.317) -- 0:03:18
      261500 -- (-915.922) (-914.578) (-924.731) [-913.486] * [-910.522] (-914.215) (-915.751) (-914.813) -- 0:03:17
      262000 -- (-931.171) (-907.498) [-914.147] (-922.942) * [-905.737] (-911.239) (-921.218) (-920.962) -- 0:03:19
      262500 -- (-929.594) (-913.724) [-908.338] (-909.089) * (-909.329) (-906.154) (-928.310) [-907.667] -- 0:03:19
      263000 -- (-913.239) (-916.588) (-920.768) [-903.775] * (-913.793) [-908.762] (-906.357) (-921.529) -- 0:03:18
      263500 -- (-922.835) [-918.882] (-920.948) (-914.899) * (-916.931) (-924.284) (-904.884) [-922.493] -- 0:03:18
      264000 -- (-925.356) (-913.727) (-915.509) [-906.526] * (-914.005) (-922.797) (-914.874) [-903.930] -- 0:03:17
      264500 -- [-912.634] (-919.848) (-916.492) (-920.160) * (-935.633) (-932.794) [-915.160] (-905.282) -- 0:03:17
      265000 -- (-920.323) (-912.459) (-921.668) [-913.092] * (-920.366) [-911.774] (-923.835) (-902.236) -- 0:03:16

      Average standard deviation of split frequencies: 0.019011

      265500 -- (-908.500) (-908.671) [-906.190] (-939.196) * [-908.415] (-923.794) (-928.104) (-913.523) -- 0:03:19
      266000 -- (-914.943) [-906.151] (-911.317) (-921.072) * (-918.228) [-911.091] (-936.074) (-911.855) -- 0:03:18
      266500 -- (-918.095) (-913.857) [-912.315] (-927.422) * (-917.477) (-918.560) [-920.143] (-934.463) -- 0:03:18
      267000 -- (-926.414) [-925.365] (-925.615) (-928.073) * (-910.860) (-929.690) (-920.784) [-913.447] -- 0:03:17
      267500 -- (-922.142) (-909.937) [-906.540] (-921.560) * [-899.787] (-912.788) (-916.882) (-923.671) -- 0:03:17
      268000 -- (-916.246) (-914.699) [-906.858] (-917.078) * [-908.766] (-921.091) (-910.908) (-930.187) -- 0:03:16
      268500 -- [-908.998] (-920.703) (-928.083) (-918.399) * [-907.116] (-926.606) (-912.203) (-929.617) -- 0:03:16
      269000 -- (-919.253) (-920.818) [-911.053] (-930.417) * (-908.173) (-916.368) [-906.421] (-919.813) -- 0:03:18
      269500 -- (-924.498) (-914.471) [-907.452] (-916.341) * [-908.967] (-920.959) (-925.629) (-919.026) -- 0:03:17
      270000 -- (-928.374) (-920.674) (-905.750) [-905.299] * [-907.814] (-923.081) (-916.267) (-919.888) -- 0:03:17

      Average standard deviation of split frequencies: 0.018841

      270500 -- (-923.378) (-912.466) [-903.116] (-916.970) * [-907.378] (-923.577) (-923.749) (-924.868) -- 0:03:16
      271000 -- (-910.868) (-930.040) [-910.964] (-928.466) * (-910.394) (-923.190) (-923.789) [-903.911] -- 0:03:16
      271500 -- (-921.010) (-910.459) [-902.075] (-917.840) * [-904.672] (-927.422) (-923.822) (-914.002) -- 0:03:15
      272000 -- [-917.715] (-912.457) (-917.813) (-922.854) * (-909.594) (-941.406) (-916.705) [-909.367] -- 0:03:15
      272500 -- [-910.543] (-905.810) (-921.616) (-921.592) * (-909.225) (-927.067) [-905.278] (-918.584) -- 0:03:14
      273000 -- (-921.186) (-907.599) [-910.061] (-914.475) * [-910.980] (-938.455) (-907.354) (-919.208) -- 0:03:17
      273500 -- (-919.463) (-910.280) (-910.695) [-921.194] * (-911.608) (-928.717) [-909.656] (-914.163) -- 0:03:16
      274000 -- [-909.880] (-913.622) (-913.238) (-926.112) * (-914.631) (-920.377) (-909.946) [-916.004] -- 0:03:16
      274500 -- (-926.669) [-908.822] (-924.293) (-919.510) * (-916.844) (-925.160) [-913.319] (-917.676) -- 0:03:15
      275000 -- (-919.802) [-904.117] (-923.713) (-918.022) * (-907.654) [-921.607] (-924.703) (-923.770) -- 0:03:15

      Average standard deviation of split frequencies: 0.015682

      275500 -- (-911.534) [-910.314] (-911.310) (-924.292) * [-909.413] (-920.093) (-907.812) (-915.674) -- 0:03:14
      276000 -- (-911.562) [-924.465] (-911.049) (-912.655) * [-909.038] (-927.185) (-914.093) (-920.873) -- 0:03:14
      276500 -- (-919.996) (-905.761) [-911.977] (-921.667) * (-917.112) [-921.156] (-916.104) (-926.980) -- 0:03:13
      277000 -- (-929.140) [-912.563] (-917.519) (-905.166) * [-913.602] (-930.127) (-911.784) (-923.870) -- 0:03:15
      277500 -- (-913.431) [-915.826] (-912.418) (-922.928) * (-910.709) (-920.260) [-913.440] (-924.016) -- 0:03:15
      278000 -- (-917.948) [-907.465] (-909.980) (-918.064) * (-910.780) (-920.245) [-906.618] (-919.750) -- 0:03:14
      278500 -- (-912.611) (-920.874) (-912.586) [-904.016] * (-937.607) (-932.909) (-924.718) [-928.489] -- 0:03:14
      279000 -- [-909.856] (-903.782) (-909.380) (-918.956) * (-912.044) (-939.673) [-918.075] (-913.525) -- 0:03:13
      279500 -- [-930.354] (-922.943) (-927.674) (-923.653) * [-909.279] (-927.945) (-917.032) (-933.750) -- 0:03:13
      280000 -- (-921.480) (-916.991) [-904.412] (-921.721) * (-923.933) (-930.739) [-922.902] (-912.840) -- 0:03:12

      Average standard deviation of split frequencies: 0.020613

      280500 -- (-914.740) (-920.120) (-914.572) [-917.816] * (-916.307) (-919.085) (-928.196) [-907.601] -- 0:03:14
      281000 -- (-918.451) (-910.168) (-923.171) [-913.813] * [-912.212] (-918.159) (-925.593) (-913.170) -- 0:03:14
      281500 -- (-925.839) (-923.569) (-908.077) [-917.138] * (-911.986) (-925.630) [-909.185] (-913.717) -- 0:03:13
      282000 -- [-912.030] (-918.390) (-919.478) (-921.038) * (-908.571) (-922.548) [-914.085] (-919.491) -- 0:03:13
      282500 -- [-910.692] (-913.256) (-912.045) (-923.360) * (-933.587) [-918.509] (-918.424) (-917.151) -- 0:03:13
      283000 -- (-914.945) [-916.114] (-907.108) (-908.671) * [-915.424] (-920.986) (-912.072) (-923.588) -- 0:03:12
      283500 -- (-916.701) [-912.383] (-912.795) (-914.943) * (-911.613) [-907.846] (-910.028) (-919.103) -- 0:03:12
      284000 -- (-918.993) (-912.002) (-911.228) [-916.423] * (-908.617) [-907.658] (-919.149) (-927.705) -- 0:03:14
      284500 -- (-905.206) (-912.373) (-919.423) [-923.766] * (-924.819) (-920.273) [-912.276] (-915.399) -- 0:03:13
      285000 -- (-922.626) (-920.523) [-911.395] (-920.373) * [-914.084] (-916.253) (-910.166) (-921.394) -- 0:03:13

      Average standard deviation of split frequencies: 0.021278

      285500 -- [-907.955] (-928.901) (-914.094) (-920.764) * (-902.660) [-904.645] (-913.330) (-910.935) -- 0:03:12
      286000 -- (-917.971) (-918.520) [-915.094] (-928.009) * (-913.556) (-918.626) [-908.741] (-911.935) -- 0:03:12
      286500 -- (-912.818) [-907.383] (-907.714) (-917.774) * [-907.470] (-912.712) (-915.243) (-911.765) -- 0:03:11
      287000 -- (-912.991) [-914.355] (-906.053) (-920.280) * (-907.744) [-909.811] (-912.277) (-921.629) -- 0:03:11
      287500 -- (-921.998) (-913.925) (-905.632) [-908.221] * (-919.015) (-918.519) [-920.936] (-909.917) -- 0:03:10
      288000 -- [-905.992] (-905.271) (-922.308) (-913.295) * (-928.800) (-924.884) (-916.670) [-913.194] -- 0:03:12
      288500 -- [-910.207] (-916.719) (-926.937) (-917.115) * (-920.026) (-921.893) (-918.408) [-911.850] -- 0:03:12
      289000 -- (-915.537) [-910.893] (-916.437) (-920.265) * (-908.582) (-913.447) (-916.193) [-908.659] -- 0:03:11
      289500 -- [-923.855] (-921.461) (-910.373) (-908.433) * (-913.336) (-920.055) [-904.634] (-906.462) -- 0:03:11
      290000 -- (-917.756) [-920.131] (-946.531) (-921.673) * [-910.821] (-915.753) (-920.618) (-919.711) -- 0:03:10

      Average standard deviation of split frequencies: 0.019167

      290500 -- (-922.804) [-917.372] (-918.053) (-911.450) * [-905.994] (-916.447) (-915.710) (-919.148) -- 0:03:10
      291000 -- (-906.725) [-911.110] (-933.443) (-934.656) * [-917.287] (-915.926) (-910.874) (-921.855) -- 0:03:10
      291500 -- (-911.295) (-915.653) [-916.099] (-929.755) * [-905.486] (-929.754) (-915.815) (-926.221) -- 0:03:12
      292000 -- [-899.827] (-922.975) (-922.773) (-934.393) * [-914.121] (-922.403) (-922.513) (-921.134) -- 0:03:11
      292500 -- (-911.393) (-922.863) (-919.857) [-913.741] * [-905.033] (-926.956) (-914.372) (-916.106) -- 0:03:11
      293000 -- (-912.116) (-920.576) (-915.113) [-912.924] * (-910.847) [-913.429] (-916.206) (-915.016) -- 0:03:10
      293500 -- (-934.384) (-928.098) (-911.813) [-909.123] * (-918.617) (-920.129) (-909.906) [-911.732] -- 0:03:10
      294000 -- (-924.963) (-918.911) (-910.462) [-912.980] * [-917.965] (-911.886) (-913.312) (-915.133) -- 0:03:09
      294500 -- [-914.520] (-925.365) (-908.490) (-923.629) * (-912.303) (-922.564) [-905.099] (-921.067) -- 0:03:09
      295000 -- [-916.780] (-932.127) (-920.789) (-905.016) * (-919.809) (-930.160) [-906.243] (-912.953) -- 0:03:08

      Average standard deviation of split frequencies: 0.016059

      295500 -- (-911.197) [-912.064] (-911.234) (-916.355) * [-904.507] (-921.937) (-917.870) (-931.331) -- 0:03:10
      296000 -- (-928.696) (-901.013) [-917.045] (-925.329) * (-916.991) (-915.676) (-917.291) [-915.229] -- 0:03:10
      296500 -- (-903.839) [-908.666] (-919.996) (-926.503) * (-918.209) [-911.932] (-919.207) (-907.232) -- 0:03:09
      297000 -- (-907.201) [-916.348] (-917.717) (-928.117) * (-917.650) (-920.023) (-914.075) [-913.746] -- 0:03:09
      297500 -- (-921.272) [-913.430] (-912.615) (-913.902) * (-920.644) [-916.813] (-915.288) (-914.911) -- 0:03:08
      298000 -- (-909.857) (-917.384) (-924.644) [-922.818] * (-911.859) (-922.599) (-917.291) [-913.396] -- 0:03:08
      298500 -- [-914.397] (-921.854) (-924.061) (-909.685) * (-918.636) (-910.492) (-918.557) [-912.607] -- 0:03:08
      299000 -- (-917.633) (-919.748) [-911.876] (-919.765) * (-925.676) (-914.738) (-925.005) [-911.552] -- 0:03:09
      299500 -- (-918.403) [-909.826] (-914.337) (-932.684) * (-923.627) (-918.474) [-905.007] (-912.584) -- 0:03:09
      300000 -- (-914.829) (-916.710) (-915.821) [-917.409] * (-919.503) (-935.910) (-915.579) [-919.249] -- 0:03:09

      Average standard deviation of split frequencies: 0.017674

      300500 -- (-926.102) (-929.793) [-906.098] (-903.751) * (-914.834) [-910.412] (-915.304) (-909.043) -- 0:03:08
      301000 -- (-907.869) (-923.918) [-916.857] (-916.156) * (-914.758) (-909.140) (-922.016) [-905.359] -- 0:03:08
      301500 -- [-900.969] (-917.547) (-922.013) (-910.708) * (-921.088) (-915.204) (-926.275) [-913.055] -- 0:03:07
      302000 -- (-919.587) (-912.938) (-919.747) [-915.820] * [-908.502] (-920.117) (-910.081) (-911.358) -- 0:03:07
      302500 -- (-910.868) (-927.945) (-920.830) [-910.733] * (-915.885) (-912.360) [-909.362] (-908.701) -- 0:03:09
      303000 -- (-909.379) (-910.984) (-923.162) [-914.260] * [-904.882] (-917.118) (-922.473) (-915.816) -- 0:03:08
      303500 -- [-908.518] (-910.618) (-930.585) (-921.374) * (-913.785) (-922.305) [-911.216] (-921.196) -- 0:03:08
      304000 -- (-917.603) [-916.019] (-917.662) (-921.015) * (-919.376) (-926.701) [-909.549] (-919.469) -- 0:03:07
      304500 -- [-905.594] (-917.236) (-913.117) (-913.819) * (-919.806) (-914.017) (-907.552) [-916.263] -- 0:03:07
      305000 -- (-927.917) (-916.158) [-904.641] (-914.392) * (-909.005) (-918.812) [-904.631] (-929.711) -- 0:03:06

      Average standard deviation of split frequencies: 0.016246

      305500 -- (-928.023) [-913.839] (-922.360) (-914.344) * (-911.699) (-922.836) (-911.029) [-908.799] -- 0:03:06
      306000 -- (-919.891) [-907.778] (-928.760) (-926.749) * (-903.782) [-908.928] (-913.843) (-924.254) -- 0:03:05
      306500 -- [-918.278] (-919.549) (-920.339) (-921.098) * (-907.085) (-931.625) [-912.605] (-925.640) -- 0:03:07
      307000 -- (-912.834) (-930.488) [-913.939] (-926.122) * [-914.887] (-925.484) (-915.842) (-917.682) -- 0:03:07
      307500 -- [-910.931] (-916.038) (-928.635) (-935.911) * (-913.621) (-922.900) [-903.324] (-921.755) -- 0:03:06
      308000 -- (-923.689) (-913.268) [-921.763] (-929.903) * (-915.872) [-913.954] (-908.335) (-914.353) -- 0:03:06
      308500 -- [-913.424] (-915.383) (-925.169) (-919.119) * (-920.159) (-913.868) [-917.785] (-929.559) -- 0:03:06
      309000 -- (-931.850) [-904.386] (-907.466) (-916.966) * (-919.738) (-907.185) [-906.390] (-907.191) -- 0:03:05
      309500 -- (-928.707) [-904.147] (-917.947) (-928.728) * (-911.917) (-916.506) (-931.770) [-916.013] -- 0:03:05
      310000 -- (-921.690) [-921.600] (-905.170) (-920.591) * [-920.769] (-909.282) (-934.243) (-916.631) -- 0:03:06

      Average standard deviation of split frequencies: 0.015726

      310500 -- (-932.583) (-923.975) [-903.732] (-938.049) * (-917.827) [-904.555] (-922.794) (-910.221) -- 0:03:06
      311000 -- (-926.939) (-914.083) (-915.835) [-910.888] * (-923.781) [-917.133] (-911.886) (-920.261) -- 0:03:06
      311500 -- (-930.245) (-940.625) [-907.340] (-916.484) * (-927.005) (-917.235) (-927.442) [-915.395] -- 0:03:05
      312000 -- (-925.806) [-912.492] (-909.876) (-920.718) * [-911.591] (-912.814) (-924.812) (-911.786) -- 0:03:05
      312500 -- (-911.986) (-923.211) [-914.042] (-928.136) * (-908.381) [-910.622] (-928.781) (-903.955) -- 0:03:04
      313000 -- (-918.970) [-912.418] (-922.315) (-922.543) * (-921.329) (-922.647) (-917.978) [-908.216] -- 0:03:04
      313500 -- (-923.908) [-904.556] (-920.091) (-915.838) * (-923.068) (-929.253) [-910.898] (-918.917) -- 0:03:06
      314000 -- (-928.328) [-903.538] (-912.549) (-913.643) * (-916.522) (-926.847) (-910.003) [-921.594] -- 0:03:05
      314500 -- (-930.248) (-927.942) (-918.918) [-907.308] * (-922.021) (-925.045) (-922.789) [-908.012] -- 0:03:05
      315000 -- (-928.285) [-915.723] (-916.308) (-912.613) * (-925.591) (-912.813) (-912.721) [-910.278] -- 0:03:04

      Average standard deviation of split frequencies: 0.013562

      315500 -- (-920.241) [-908.837] (-915.876) (-915.745) * (-917.966) (-927.963) [-915.788] (-920.858) -- 0:03:04
      316000 -- (-925.152) (-910.784) (-934.689) [-913.430] * (-925.089) [-901.700] (-922.523) (-920.086) -- 0:03:03
      316500 -- [-909.294] (-912.784) (-915.670) (-916.175) * [-905.902] (-921.339) (-918.912) (-919.594) -- 0:03:03
      317000 -- (-907.760) (-932.064) [-912.642] (-916.057) * (-914.723) [-911.659] (-912.235) (-909.041) -- 0:03:05
      317500 -- (-921.196) [-914.080] (-905.006) (-911.592) * (-915.266) (-910.967) (-910.785) [-910.053] -- 0:03:04
      318000 -- [-914.445] (-916.221) (-911.482) (-920.962) * [-905.335] (-922.313) (-913.961) (-917.479) -- 0:03:04
      318500 -- (-917.053) (-927.515) [-907.189] (-918.422) * [-907.108] (-913.971) (-929.729) (-909.182) -- 0:03:04
      319000 -- (-918.762) [-918.515] (-912.465) (-933.834) * (-918.821) (-928.616) (-929.467) [-905.459] -- 0:03:03
      319500 -- (-920.815) (-927.622) (-914.825) [-917.178] * (-915.422) (-924.725) [-920.640] (-911.254) -- 0:03:03
      320000 -- (-912.564) [-915.375] (-910.559) (-933.859) * (-921.670) [-919.675] (-914.258) (-932.989) -- 0:03:02

      Average standard deviation of split frequencies: 0.015102

      320500 -- (-926.064) [-906.149] (-911.396) (-917.416) * [-913.831] (-922.513) (-913.298) (-919.130) -- 0:03:02
      321000 -- (-918.774) [-905.833] (-925.614) (-914.092) * (-915.004) [-912.320] (-925.231) (-927.377) -- 0:03:04
      321500 -- (-918.997) (-927.480) (-937.698) [-916.270] * (-910.481) (-923.640) (-915.374) [-904.019] -- 0:03:03
      322000 -- (-920.850) (-917.723) [-920.754] (-926.237) * (-912.103) (-920.587) (-914.617) [-909.130] -- 0:03:03
      322500 -- (-915.879) (-905.297) (-911.754) [-915.248] * (-911.831) [-906.527] (-927.754) (-915.590) -- 0:03:02
      323000 -- (-925.925) (-910.616) [-912.996] (-922.917) * (-917.210) (-913.309) [-922.841] (-924.396) -- 0:03:02
      323500 -- [-912.390] (-916.357) (-911.626) (-922.208) * [-915.418] (-924.580) (-920.769) (-919.953) -- 0:03:01
      324000 -- (-915.707) [-911.860] (-904.879) (-921.393) * (-922.117) (-916.920) [-915.729] (-911.442) -- 0:03:01
      324500 -- (-917.989) (-917.893) [-910.700] (-907.292) * (-926.044) [-906.284] (-920.755) (-914.861) -- 0:03:03
      325000 -- (-914.382) (-915.827) [-905.573] (-925.797) * (-925.722) (-918.403) [-916.954] (-913.743) -- 0:03:02

      Average standard deviation of split frequencies: 0.014197

      325500 -- (-915.246) (-916.968) (-918.550) [-919.629] * (-920.366) [-914.690] (-920.179) (-903.126) -- 0:03:02
      326000 -- (-916.122) (-929.842) [-912.767] (-914.604) * (-909.063) (-919.215) (-925.270) [-910.748] -- 0:03:01
      326500 -- [-910.850] (-914.178) (-906.685) (-937.825) * (-924.483) [-917.373] (-924.355) (-907.118) -- 0:03:01
      327000 -- (-922.037) (-904.901) (-911.556) [-906.026] * (-927.048) (-925.351) [-921.702] (-914.943) -- 0:03:01
      327500 -- (-921.346) (-916.303) [-910.186] (-915.289) * (-932.145) (-922.668) [-913.689] (-916.263) -- 0:03:00
      328000 -- (-927.250) (-910.257) [-899.363] (-930.548) * (-924.682) (-916.312) (-917.972) [-914.659] -- 0:03:00
      328500 -- [-908.581] (-923.154) (-916.882) (-915.390) * (-916.306) (-916.548) [-918.024] (-917.319) -- 0:03:01
      329000 -- (-920.002) (-926.186) (-910.736) [-916.591] * (-912.553) [-920.679] (-906.974) (-920.078) -- 0:03:01
      329500 -- (-915.695) (-929.881) [-913.480] (-917.099) * (-914.446) (-918.349) [-908.435] (-907.507) -- 0:03:01
      330000 -- (-938.685) [-904.844] (-917.746) (-917.778) * (-920.937) (-909.748) [-916.098] (-917.190) -- 0:03:00

      Average standard deviation of split frequencies: 0.014515

      330500 -- (-921.145) [-909.851] (-923.487) (-915.992) * (-912.108) [-910.883] (-915.237) (-923.268) -- 0:03:00
      331000 -- (-914.325) (-914.318) [-911.937] (-909.596) * (-906.525) [-915.012] (-924.596) (-946.406) -- 0:02:59
      331500 -- [-912.496] (-912.311) (-924.731) (-921.822) * (-914.308) (-909.606) [-917.927] (-931.700) -- 0:02:59
      332000 -- (-909.768) [-904.136] (-913.544) (-913.482) * (-917.887) [-912.347] (-930.168) (-914.054) -- 0:03:01
      332500 -- (-928.378) [-911.186] (-912.078) (-920.617) * (-925.336) (-918.407) (-928.935) [-901.224] -- 0:03:00
      333000 -- (-927.129) [-905.625] (-941.669) (-929.131) * (-920.214) (-910.430) (-925.796) [-911.438] -- 0:03:00
      333500 -- (-926.469) [-904.747] (-921.898) (-924.835) * (-918.859) (-923.915) (-913.970) [-917.947] -- 0:02:59
      334000 -- (-936.473) (-905.068) (-918.079) [-905.164] * (-918.888) (-913.989) [-899.969] (-923.526) -- 0:02:59
      334500 -- (-923.203) (-917.022) (-923.916) [-915.548] * (-926.139) (-911.133) [-912.586] (-920.562) -- 0:02:59
      335000 -- (-927.490) [-919.523] (-923.161) (-915.497) * (-916.933) (-920.450) [-911.821] (-915.697) -- 0:02:58

      Average standard deviation of split frequencies: 0.013520

      335500 -- (-921.052) (-916.488) (-911.142) [-921.214] * (-926.305) (-928.559) (-906.926) [-907.531] -- 0:02:58
      336000 -- (-913.039) (-918.194) [-910.828] (-922.346) * (-913.352) [-908.167] (-919.997) (-908.057) -- 0:02:59
      336500 -- (-917.646) [-919.680] (-906.944) (-918.388) * (-922.732) [-919.794] (-925.814) (-913.007) -- 0:02:59
      337000 -- [-911.654] (-917.986) (-902.942) (-934.094) * (-915.787) [-908.651] (-920.446) (-914.434) -- 0:02:59
      337500 -- (-919.877) (-910.890) [-912.450] (-917.187) * (-925.646) (-914.984) [-906.498] (-941.163) -- 0:02:58
      338000 -- (-918.667) [-910.601] (-917.090) (-930.732) * [-913.824] (-923.098) (-915.434) (-919.069) -- 0:02:58
      338500 -- (-924.357) (-914.941) (-919.421) [-904.678] * (-906.721) (-931.838) (-927.873) [-911.631] -- 0:02:57
      339000 -- (-918.553) (-917.644) [-909.761] (-911.035) * [-913.255] (-910.865) (-924.994) (-913.571) -- 0:02:57
      339500 -- [-917.062] (-939.823) (-915.889) (-928.766) * (-913.247) (-917.190) (-915.968) [-912.219] -- 0:02:58
      340000 -- (-929.003) [-920.893] (-920.414) (-929.978) * (-921.393) [-904.851] (-932.328) (-930.788) -- 0:02:58

      Average standard deviation of split frequencies: 0.013586

      340500 -- [-916.053] (-934.420) (-923.779) (-931.522) * (-914.509) (-935.087) (-916.606) [-902.771] -- 0:02:58
      341000 -- (-925.949) (-923.742) [-919.559] (-934.121) * [-903.798] (-930.445) (-912.411) (-913.360) -- 0:02:57
      341500 -- (-926.103) [-907.826] (-914.598) (-916.445) * (-912.275) [-910.526] (-926.169) (-930.532) -- 0:02:57
      342000 -- (-926.211) (-924.288) [-918.834] (-912.333) * [-912.462] (-902.930) (-922.157) (-916.061) -- 0:02:57
      342500 -- (-922.223) [-910.783] (-924.440) (-909.187) * [-914.111] (-926.721) (-909.899) (-915.896) -- 0:02:56
      343000 -- (-926.048) (-925.916) (-928.364) [-910.535] * (-915.123) (-912.719) [-905.585] (-909.850) -- 0:02:58
      343500 -- (-907.380) (-924.216) (-930.336) [-907.637] * (-913.924) [-903.879] (-915.749) (-908.899) -- 0:02:57
      344000 -- [-911.077] (-921.112) (-916.371) (-919.086) * (-922.256) [-915.923] (-917.384) (-907.597) -- 0:02:57
      344500 -- (-920.860) (-920.323) [-915.847] (-917.129) * (-918.615) [-918.957] (-915.418) (-915.822) -- 0:02:56
      345000 -- [-911.032] (-921.850) (-916.761) (-914.624) * (-914.732) [-912.695] (-918.627) (-919.389) -- 0:02:56

      Average standard deviation of split frequencies: 0.009413

      345500 -- (-916.535) [-915.581] (-912.607) (-922.447) * [-911.124] (-926.747) (-921.669) (-912.294) -- 0:02:56
      346000 -- (-918.080) (-926.504) (-935.330) [-917.344] * [-911.193] (-915.574) (-912.186) (-908.689) -- 0:02:55
      346500 -- (-918.035) (-929.746) (-931.931) [-916.432] * (-922.590) [-909.396] (-913.767) (-911.938) -- 0:02:57
      347000 -- [-918.490] (-916.779) (-927.129) (-912.557) * (-913.819) (-908.097) [-920.034] (-914.480) -- 0:02:56
      347500 -- (-920.374) [-916.674] (-909.051) (-917.978) * (-918.438) (-912.422) (-919.956) [-911.513] -- 0:02:56
      348000 -- (-940.743) (-914.012) (-917.019) [-912.832] * [-908.569] (-928.187) (-932.926) (-919.614) -- 0:02:56
      348500 -- (-939.500) (-909.263) (-918.776) [-912.125] * (-912.004) (-918.578) [-914.561] (-914.438) -- 0:02:55
      349000 -- (-935.653) [-908.074] (-918.424) (-912.719) * (-916.943) (-914.890) [-922.059] (-923.146) -- 0:02:55
      349500 -- (-933.576) (-906.980) [-906.589] (-932.565) * (-917.078) (-911.304) [-914.291] (-916.180) -- 0:02:54
      350000 -- (-928.170) [-902.922] (-930.213) (-919.528) * (-914.143) [-919.892] (-906.572) (-916.200) -- 0:02:54

      Average standard deviation of split frequencies: 0.011121

      350500 -- (-910.322) (-912.798) (-922.558) [-908.849] * (-919.850) (-918.861) [-915.702] (-915.419) -- 0:02:56
      351000 -- (-913.324) [-906.654] (-914.295) (-917.146) * [-909.160] (-906.070) (-930.067) (-918.746) -- 0:02:55
      351500 -- (-910.858) [-906.341] (-917.959) (-922.309) * (-908.429) (-903.529) [-911.805] (-915.245) -- 0:02:55
      352000 -- (-924.962) (-913.754) [-923.560] (-928.578) * (-915.221) (-913.803) [-913.503] (-918.704) -- 0:02:54
      352500 -- [-928.574] (-923.747) (-918.571) (-926.277) * (-909.807) (-917.560) [-928.009] (-917.307) -- 0:02:54
      353000 -- (-925.358) (-909.901) [-909.129] (-932.483) * [-915.965] (-928.327) (-910.523) (-920.530) -- 0:02:54
      353500 -- (-912.170) [-907.679] (-913.546) (-938.641) * (-921.195) [-914.110] (-909.426) (-931.967) -- 0:02:53
      354000 -- (-914.836) (-928.541) [-909.149] (-933.667) * (-913.534) (-915.252) [-902.342] (-933.380) -- 0:02:55
      354500 -- (-923.615) [-915.798] (-927.632) (-920.156) * (-921.570) [-920.633] (-913.469) (-915.276) -- 0:02:54
      355000 -- [-919.272] (-916.967) (-904.323) (-911.877) * (-918.405) (-915.887) [-917.729] (-917.531) -- 0:02:54

      Average standard deviation of split frequencies: 0.009991

      355500 -- (-924.878) [-915.942] (-923.348) (-915.400) * [-911.749] (-920.537) (-917.844) (-915.888) -- 0:02:54
      356000 -- [-912.194] (-924.568) (-926.353) (-915.435) * (-931.328) (-925.862) [-911.900] (-921.205) -- 0:02:53
      356500 -- [-908.137] (-929.437) (-914.227) (-919.008) * [-914.460] (-931.485) (-917.694) (-929.838) -- 0:02:53
      357000 -- (-912.139) (-926.844) (-919.784) [-923.409] * [-916.006] (-911.219) (-916.222) (-919.280) -- 0:02:52
      357500 -- (-927.148) (-924.885) [-920.878] (-927.472) * (-915.081) (-920.117) (-931.575) [-910.109] -- 0:02:52
      358000 -- (-919.039) (-923.740) (-925.678) [-912.770] * (-920.521) (-913.861) [-912.910] (-912.481) -- 0:02:53
      358500 -- [-911.923] (-927.845) (-916.534) (-908.780) * [-917.388] (-910.145) (-909.132) (-930.717) -- 0:02:53
      359000 -- (-929.421) (-929.664) [-912.591] (-911.372) * (-909.806) (-920.064) [-905.021] (-915.747) -- 0:02:53
      359500 -- [-905.516] (-924.889) (-927.342) (-915.640) * (-908.804) [-917.161] (-914.239) (-921.488) -- 0:02:52
      360000 -- (-913.994) (-920.196) (-924.087) [-916.953] * (-922.267) [-908.879] (-918.024) (-913.408) -- 0:02:52

      Average standard deviation of split frequencies: 0.010100

      360500 -- [-927.415] (-913.463) (-925.224) (-919.608) * (-931.519) [-916.017] (-919.787) (-910.657) -- 0:02:52
      361000 -- (-930.891) [-911.802] (-930.387) (-920.873) * (-904.301) [-911.827] (-914.638) (-904.269) -- 0:02:51
      361500 -- (-924.498) (-917.245) (-926.825) [-905.721] * (-910.351) [-911.980] (-920.261) (-910.267) -- 0:02:53
      362000 -- (-922.246) (-920.096) (-923.354) [-915.730] * (-917.618) [-914.425] (-912.644) (-912.972) -- 0:02:52
      362500 -- (-926.890) [-899.933] (-914.031) (-914.432) * (-909.858) [-914.477] (-934.810) (-914.715) -- 0:02:52
      363000 -- (-913.854) (-915.932) (-918.575) [-914.025] * (-910.903) (-909.544) (-923.492) [-910.988] -- 0:02:51
      363500 -- [-912.278] (-910.994) (-920.715) (-916.178) * (-912.449) [-915.235] (-922.764) (-924.611) -- 0:02:51
      364000 -- (-914.039) (-934.973) [-915.472] (-922.489) * (-915.120) (-917.639) (-921.813) [-906.741] -- 0:02:51
      364500 -- [-909.791] (-911.061) (-913.895) (-914.918) * (-919.535) (-918.297) (-916.574) [-909.033] -- 0:02:50
      365000 -- (-925.264) [-908.747] (-907.924) (-917.663) * (-923.309) (-912.124) (-928.873) [-909.062] -- 0:02:50

      Average standard deviation of split frequencies: 0.012529

      365500 -- [-907.935] (-927.127) (-914.948) (-924.970) * [-916.096] (-913.663) (-927.912) (-915.554) -- 0:02:51
      366000 -- (-910.376) (-912.699) (-920.576) [-916.717] * (-910.498) [-906.082] (-924.279) (-919.230) -- 0:02:51
      366500 -- (-923.209) (-911.207) [-906.732] (-921.871) * (-912.111) [-913.580] (-921.518) (-910.266) -- 0:02:51
      367000 -- (-915.026) (-915.348) [-911.223] (-917.527) * (-916.361) [-913.281] (-920.284) (-915.458) -- 0:02:50
      367500 -- (-913.405) (-921.253) (-911.407) [-922.234] * [-907.567] (-907.496) (-915.501) (-916.115) -- 0:02:50
      368000 -- [-912.668] (-926.234) (-911.616) (-907.576) * (-909.798) (-915.188) [-906.271] (-928.283) -- 0:02:50
      368500 -- [-914.385] (-930.406) (-916.561) (-910.342) * (-917.168) [-902.352] (-912.238) (-913.133) -- 0:02:49
      369000 -- (-924.636) (-911.779) [-914.342] (-912.213) * (-922.323) (-900.227) (-917.952) [-922.783] -- 0:02:51
      369500 -- (-926.684) (-934.196) [-917.048] (-909.520) * [-907.972] (-917.832) (-910.122) (-913.434) -- 0:02:50
      370000 -- (-917.096) (-914.884) (-909.426) [-910.545] * (-916.992) (-915.076) (-919.736) [-906.004] -- 0:02:50

      Average standard deviation of split frequencies: 0.011908

      370500 -- (-917.731) (-929.402) [-910.093] (-911.735) * (-913.676) (-924.963) (-927.161) [-915.183] -- 0:02:49
      371000 -- (-917.805) [-910.976] (-928.331) (-909.061) * (-913.657) (-911.231) [-915.269] (-904.986) -- 0:02:49
      371500 -- (-914.688) [-911.429] (-916.937) (-907.544) * (-915.705) [-907.537] (-926.531) (-918.220) -- 0:02:49
      372000 -- (-929.508) (-912.013) [-906.878] (-917.640) * (-920.814) [-899.315] (-921.379) (-914.082) -- 0:02:48
      372500 -- [-907.933] (-928.262) (-914.997) (-918.619) * (-914.664) [-913.642] (-910.462) (-919.560) -- 0:02:48
      373000 -- [-905.566] (-925.515) (-908.096) (-911.110) * (-909.661) (-909.754) (-912.174) [-906.912] -- 0:02:49
      373500 -- [-915.248] (-918.553) (-918.702) (-915.161) * [-904.643] (-906.547) (-923.855) (-914.254) -- 0:02:49
      374000 -- (-928.264) [-908.298] (-918.630) (-906.039) * [-906.332] (-918.554) (-922.262) (-929.588) -- 0:02:49
      374500 -- (-907.764) [-907.147] (-912.599) (-941.642) * (-927.151) (-906.406) (-908.233) [-914.585] -- 0:02:48
      375000 -- (-927.305) [-906.998] (-919.162) (-934.634) * (-935.443) (-921.484) [-918.111] (-907.653) -- 0:02:48

      Average standard deviation of split frequencies: 0.012651

      375500 -- (-924.384) (-913.298) [-912.528] (-917.566) * (-916.599) (-917.140) (-922.431) [-917.316] -- 0:02:47
      376000 -- (-909.537) [-910.567] (-918.619) (-912.452) * (-909.007) [-912.425] (-916.628) (-929.211) -- 0:02:47
      376500 -- (-922.547) [-911.968] (-912.859) (-908.496) * (-922.322) (-926.848) (-913.440) [-910.794] -- 0:02:48
      377000 -- (-922.449) [-911.524] (-922.729) (-915.438) * (-912.067) [-918.019] (-918.559) (-931.952) -- 0:02:48
      377500 -- (-910.272) (-910.146) (-921.616) [-918.781] * (-914.463) (-919.434) (-921.234) [-916.600] -- 0:02:48
      378000 -- [-922.747] (-910.997) (-919.854) (-920.202) * (-917.694) [-909.125] (-921.439) (-925.428) -- 0:02:47
      378500 -- (-916.418) [-907.980] (-918.239) (-919.115) * [-903.185] (-942.177) (-911.515) (-915.143) -- 0:02:47
      379000 -- (-928.196) (-911.144) (-920.702) [-909.939] * (-919.034) (-915.097) (-915.906) [-918.585] -- 0:02:47
      379500 -- [-905.166] (-906.922) (-919.908) (-907.370) * [-908.257] (-928.682) (-917.260) (-906.933) -- 0:02:46
      380000 -- [-910.597] (-916.090) (-916.745) (-908.923) * (-912.743) [-908.525] (-909.245) (-925.076) -- 0:02:48

      Average standard deviation of split frequencies: 0.013847

      380500 -- [-914.690] (-931.700) (-921.954) (-918.411) * [-912.120] (-922.855) (-922.391) (-921.825) -- 0:02:47
      381000 -- (-925.494) [-906.070] (-924.756) (-912.126) * (-904.494) (-920.216) [-904.721] (-918.489) -- 0:02:47
      381500 -- (-919.298) [-915.968] (-909.211) (-909.168) * (-918.094) (-927.738) [-912.521] (-917.574) -- 0:02:46
      382000 -- [-911.198] (-907.295) (-906.865) (-926.612) * (-917.157) [-916.706] (-910.655) (-920.734) -- 0:02:46
      382500 -- (-917.928) (-923.325) (-920.517) [-907.630] * [-917.686] (-917.161) (-916.794) (-921.040) -- 0:02:46
      383000 -- (-925.618) (-908.384) [-917.261] (-917.726) * (-913.036) (-917.118) [-933.895] (-915.194) -- 0:02:45
      383500 -- [-923.977] (-922.679) (-935.838) (-910.843) * (-917.648) (-915.536) (-914.303) [-914.726] -- 0:02:45
      384000 -- (-920.190) [-915.944] (-925.783) (-910.576) * [-906.051] (-926.324) (-908.601) (-907.909) -- 0:02:46
      384500 -- [-917.497] (-913.187) (-909.833) (-919.935) * [-907.193] (-913.766) (-928.829) (-910.650) -- 0:02:46
      385000 -- (-910.297) (-917.496) [-915.408] (-910.101) * (-918.288) (-928.875) [-912.666] (-918.280) -- 0:02:46

      Average standard deviation of split frequencies: 0.015099

      385500 -- [-905.944] (-908.131) (-921.835) (-933.415) * [-919.755] (-929.984) (-920.240) (-912.588) -- 0:02:45
      386000 -- (-917.077) (-911.899) (-923.130) [-912.435] * (-909.352) (-920.776) [-916.529] (-921.552) -- 0:02:45
      386500 -- (-917.895) [-914.544] (-913.626) (-910.982) * [-918.542] (-926.640) (-929.234) (-931.646) -- 0:02:45
      387000 -- (-912.168) [-905.823] (-917.728) (-916.682) * (-922.802) [-907.508] (-910.475) (-921.928) -- 0:02:44
      387500 -- (-911.655) (-911.305) [-910.792] (-923.765) * [-911.483] (-926.519) (-924.856) (-906.943) -- 0:02:45
      388000 -- (-913.885) [-914.255] (-911.780) (-917.965) * [-904.638] (-924.223) (-927.523) (-919.291) -- 0:02:45
      388500 -- (-915.626) (-922.353) (-917.130) [-906.644] * [-916.108] (-921.051) (-919.492) (-916.551) -- 0:02:45
      389000 -- (-925.391) (-929.724) (-916.832) [-915.240] * [-910.303] (-921.162) (-904.945) (-908.713) -- 0:02:44
      389500 -- [-910.086] (-929.089) (-914.796) (-924.272) * (-913.507) (-916.083) [-905.110] (-919.432) -- 0:02:44
      390000 -- (-915.609) [-907.695] (-917.364) (-916.408) * (-924.749) (-918.489) [-917.110] (-921.250) -- 0:02:44

      Average standard deviation of split frequencies: 0.013822

      390500 -- (-909.755) [-904.715] (-919.894) (-918.356) * (-932.778) (-911.932) [-914.337] (-911.902) -- 0:02:43
      391000 -- [-907.589] (-922.119) (-917.991) (-914.339) * (-919.954) [-912.911] (-915.493) (-929.372) -- 0:02:45
      391500 -- (-913.062) (-930.245) [-913.817] (-913.812) * (-914.160) [-904.244] (-907.694) (-903.214) -- 0:02:44
      392000 -- [-909.854] (-925.104) (-923.492) (-914.923) * [-911.446] (-909.878) (-932.218) (-917.456) -- 0:02:44
      392500 -- (-903.266) (-910.962) (-923.743) [-921.454] * [-914.431] (-915.284) (-931.245) (-921.409) -- 0:02:44
      393000 -- (-920.161) [-904.710] (-924.197) (-913.134) * [-908.795] (-915.380) (-924.808) (-915.283) -- 0:02:43
      393500 -- [-914.168] (-922.634) (-915.227) (-927.360) * (-919.718) (-933.643) [-911.181] (-910.912) -- 0:02:43
      394000 -- [-909.133] (-933.619) (-914.988) (-919.034) * [-909.903] (-924.394) (-917.429) (-927.554) -- 0:02:43
      394500 -- (-921.817) [-910.767] (-908.138) (-922.318) * [-909.010] (-921.794) (-916.256) (-926.680) -- 0:02:42
      395000 -- (-919.042) (-911.393) [-907.936] (-914.502) * (-904.842) (-911.094) (-921.314) [-914.911] -- 0:02:43

      Average standard deviation of split frequencies: 0.012662

      395500 -- [-909.873] (-911.262) (-929.147) (-919.784) * [-913.465] (-914.980) (-911.901) (-922.355) -- 0:02:43
      396000 -- (-938.260) (-905.067) [-916.116] (-916.388) * (-919.379) (-919.305) [-906.629] (-922.441) -- 0:02:43
      396500 -- (-920.692) (-913.514) [-912.364] (-924.583) * (-919.345) (-914.915) [-914.897] (-924.818) -- 0:02:42
      397000 -- (-926.529) (-915.734) [-905.778] (-915.820) * (-914.624) (-915.159) [-919.279] (-917.193) -- 0:02:42
      397500 -- (-922.620) (-922.874) [-911.243] (-905.454) * (-918.771) (-914.308) (-922.260) [-913.188] -- 0:02:42
      398000 -- (-921.729) (-909.756) (-927.026) [-909.199] * (-918.958) (-913.380) [-917.070] (-913.029) -- 0:02:41
      398500 -- (-916.459) (-945.784) (-919.478) [-906.644] * (-902.036) (-925.955) (-921.490) [-915.547] -- 0:02:43
      399000 -- [-911.419] (-918.256) (-930.834) (-919.422) * [-912.986] (-923.513) (-919.596) (-907.216) -- 0:02:42
      399500 -- [-924.213] (-923.750) (-905.339) (-914.717) * [-915.986] (-906.856) (-924.737) (-919.738) -- 0:02:42
      400000 -- (-906.572) (-920.720) [-913.182] (-918.571) * (-911.342) (-911.725) [-911.399] (-912.760) -- 0:02:42

      Average standard deviation of split frequencies: 0.011445

      400500 -- (-927.609) (-916.434) [-927.225] (-912.441) * (-907.225) [-908.132] (-919.391) (-922.903) -- 0:02:41
      401000 -- (-915.258) (-918.415) (-909.004) [-913.746] * [-914.705] (-919.840) (-922.997) (-916.507) -- 0:02:41
      401500 -- [-912.426] (-917.764) (-913.490) (-921.639) * (-926.338) [-922.569] (-913.084) (-910.492) -- 0:02:40
      402000 -- (-917.521) [-906.233] (-927.530) (-908.864) * (-906.050) (-932.974) [-906.667] (-918.333) -- 0:02:40
      402500 -- (-914.876) (-913.380) [-911.728] (-920.723) * (-914.136) [-923.608] (-932.092) (-918.234) -- 0:02:41
      403000 -- (-909.323) [-912.559] (-916.707) (-911.026) * (-908.746) (-913.623) [-910.574] (-911.531) -- 0:02:41
      403500 -- [-916.754] (-912.056) (-919.629) (-915.267) * [-911.075] (-910.110) (-919.816) (-919.459) -- 0:02:41
      404000 -- (-928.426) [-906.609] (-916.252) (-929.347) * (-916.178) [-906.356] (-920.077) (-916.328) -- 0:02:40
      404500 -- (-912.576) (-921.723) (-910.553) [-900.578] * (-919.816) (-908.019) (-914.923) [-913.356] -- 0:02:40
      405000 -- (-920.804) (-921.889) (-931.375) [-920.080] * (-925.813) (-929.606) (-908.290) [-907.298] -- 0:02:40

      Average standard deviation of split frequencies: 0.010872

      405500 -- (-909.919) [-899.341] (-917.782) (-908.617) * (-933.479) [-908.190] (-923.783) (-919.392) -- 0:02:39
      406000 -- (-913.691) (-920.407) [-916.089] (-910.601) * (-926.216) (-918.694) (-918.515) [-906.175] -- 0:02:40
      406500 -- [-915.598] (-910.179) (-912.189) (-916.777) * (-903.656) (-923.389) (-920.994) [-916.282] -- 0:02:40
      407000 -- (-912.279) (-910.932) [-903.848] (-907.735) * (-926.037) [-910.340] (-924.104) (-913.140) -- 0:02:40
      407500 -- [-906.165] (-905.217) (-928.589) (-923.029) * (-916.945) [-908.777] (-928.260) (-934.889) -- 0:02:39
      408000 -- (-923.338) (-911.411) [-917.539] (-919.993) * (-927.183) [-918.075] (-926.077) (-918.861) -- 0:02:39
      408500 -- (-929.295) (-921.274) [-913.877] (-925.764) * (-930.232) (-920.655) (-906.337) [-908.288] -- 0:02:39
      409000 -- [-910.536] (-919.180) (-916.302) (-925.008) * (-917.919) [-914.682] (-918.503) (-916.446) -- 0:02:38
      409500 -- (-908.474) [-922.058] (-924.388) (-922.357) * (-915.571) (-914.723) [-906.400] (-914.154) -- 0:02:38
      410000 -- [-909.309] (-935.376) (-906.935) (-920.408) * (-927.607) (-926.192) (-910.644) [-910.995] -- 0:02:39

      Average standard deviation of split frequencies: 0.010018

      410500 -- (-910.696) [-906.736] (-916.284) (-925.590) * [-922.521] (-925.108) (-918.811) (-914.281) -- 0:02:39
      411000 -- (-920.488) (-921.011) (-915.626) [-927.152] * (-911.174) (-919.531) [-918.769] (-914.763) -- 0:02:39
      411500 -- (-921.338) (-926.265) [-913.150] (-929.949) * (-911.353) (-922.174) [-916.282] (-912.597) -- 0:02:38
      412000 -- (-904.593) [-921.436] (-916.430) (-915.637) * [-912.558] (-919.700) (-920.622) (-913.770) -- 0:02:38
      412500 -- (-927.035) (-927.625) (-912.239) [-916.508] * (-906.984) [-912.471] (-917.896) (-920.131) -- 0:02:38
      413000 -- (-927.858) [-908.566] (-916.164) (-919.939) * (-911.882) (-924.210) (-916.120) [-908.730] -- 0:02:37
      413500 -- [-913.329] (-916.769) (-915.257) (-911.159) * (-917.710) (-913.600) (-912.721) [-903.904] -- 0:02:38
      414000 -- (-922.286) (-915.754) (-924.576) [-918.328] * (-916.912) (-908.980) [-904.828] (-920.406) -- 0:02:38
      414500 -- (-914.089) (-930.460) (-916.804) [-910.741] * (-916.930) (-942.605) [-910.915] (-932.911) -- 0:02:38
      415000 -- (-907.352) (-913.034) [-913.443] (-915.171) * (-921.798) (-922.418) (-910.540) [-916.754] -- 0:02:37

      Average standard deviation of split frequencies: 0.011332

      415500 -- [-904.893] (-916.506) (-920.862) (-913.430) * (-923.708) (-918.146) [-914.480] (-916.826) -- 0:02:37
      416000 -- (-929.858) (-919.028) (-913.074) [-904.624] * (-918.652) [-908.508] (-913.647) (-916.004) -- 0:02:37
      416500 -- [-916.950] (-913.968) (-927.084) (-908.735) * (-930.277) [-915.319] (-911.727) (-919.507) -- 0:02:36
      417000 -- [-921.169] (-923.112) (-919.802) (-903.050) * (-928.875) (-918.770) [-915.261] (-916.821) -- 0:02:36
      417500 -- (-925.961) (-928.645) (-921.086) [-910.151] * [-910.351] (-927.887) (-928.075) (-916.162) -- 0:02:37
      418000 -- (-923.120) (-921.796) [-915.808] (-912.696) * (-918.845) (-917.923) (-913.455) [-914.309] -- 0:02:37
      418500 -- [-907.319] (-917.052) (-915.160) (-922.396) * [-911.868] (-915.947) (-916.349) (-913.064) -- 0:02:37
      419000 -- [-908.461] (-912.495) (-916.939) (-918.157) * (-918.908) [-920.224] (-930.082) (-912.354) -- 0:02:36
      419500 -- [-916.198] (-916.476) (-917.385) (-915.835) * (-923.318) [-909.670] (-922.943) (-917.415) -- 0:02:36
      420000 -- [-906.847] (-923.479) (-917.835) (-914.868) * (-921.122) (-921.616) [-918.455] (-913.597) -- 0:02:36

      Average standard deviation of split frequencies: 0.011206

      420500 -- [-911.984] (-921.324) (-917.645) (-913.104) * [-910.041] (-913.164) (-919.620) (-909.830) -- 0:02:35
      421000 -- [-906.347] (-925.910) (-917.701) (-920.491) * [-913.682] (-920.527) (-913.882) (-917.328) -- 0:02:36
      421500 -- (-920.166) (-922.986) [-907.375] (-910.744) * (-910.772) (-913.168) (-913.316) [-913.343] -- 0:02:36
      422000 -- [-909.301] (-907.000) (-919.850) (-909.238) * [-914.334] (-924.478) (-915.488) (-912.100) -- 0:02:36
      422500 -- (-933.366) (-907.336) (-922.935) [-915.820] * (-914.250) (-919.682) (-913.749) [-907.162] -- 0:02:35
      423000 -- [-912.996] (-921.423) (-917.332) (-920.956) * (-930.715) [-915.129] (-910.430) (-913.681) -- 0:02:35
      423500 -- (-910.170) [-922.675] (-920.157) (-917.545) * [-919.308] (-920.558) (-932.001) (-909.661) -- 0:02:35
      424000 -- [-910.713] (-924.107) (-916.288) (-908.819) * (-917.396) (-927.730) (-928.430) [-915.756] -- 0:02:34
      424500 -- (-926.061) (-923.858) (-917.047) [-919.565] * (-923.309) [-914.508] (-931.538) (-936.246) -- 0:02:35
      425000 -- (-911.382) (-910.918) (-918.552) [-915.929] * (-917.654) [-910.696] (-926.248) (-914.323) -- 0:02:35

      Average standard deviation of split frequencies: 0.009456

      425500 -- [-911.144] (-913.385) (-917.146) (-928.846) * (-925.702) (-916.419) (-933.142) [-911.680] -- 0:02:35
      426000 -- (-930.026) (-919.074) [-914.729] (-909.996) * (-928.631) [-915.987] (-910.178) (-912.688) -- 0:02:34
      426500 -- (-916.811) [-906.950] (-928.578) (-912.473) * [-910.033] (-916.436) (-925.428) (-923.765) -- 0:02:34
      427000 -- [-911.255] (-925.387) (-922.007) (-920.880) * (-915.680) (-916.504) [-914.503] (-911.275) -- 0:02:34
      427500 -- [-911.446] (-921.253) (-928.395) (-918.062) * (-920.876) [-908.508] (-919.062) (-902.390) -- 0:02:34
      428000 -- [-908.327] (-909.302) (-931.153) (-918.887) * (-923.495) [-918.322] (-901.592) (-911.115) -- 0:02:33
      428500 -- (-928.639) [-902.148] (-915.323) (-921.692) * [-915.759] (-908.276) (-918.079) (-925.425) -- 0:02:34
      429000 -- (-929.324) [-921.297] (-917.063) (-916.555) * [-917.003] (-916.994) (-906.240) (-914.957) -- 0:02:34
      429500 -- [-906.378] (-919.335) (-911.131) (-918.408) * (-924.186) (-909.869) [-906.721] (-917.503) -- 0:02:34
      430000 -- (-908.610) (-924.547) [-908.894] (-936.806) * [-911.705] (-909.219) (-911.409) (-915.491) -- 0:02:33

      Average standard deviation of split frequencies: 0.009254

      430500 -- (-935.926) [-912.788] (-913.245) (-932.007) * [-908.973] (-917.016) (-903.817) (-910.094) -- 0:02:33
      431000 -- (-920.021) (-919.801) (-915.843) [-919.474] * (-919.625) (-916.388) (-925.701) [-912.361] -- 0:02:33
      431500 -- (-914.402) (-910.277) [-916.835] (-926.398) * (-918.596) (-912.865) (-927.048) [-915.798] -- 0:02:32
      432000 -- [-916.461] (-915.227) (-908.579) (-927.137) * (-914.108) (-936.226) (-923.057) [-912.963] -- 0:02:33
      432500 -- (-914.353) [-923.341] (-919.571) (-926.111) * [-907.197] (-918.003) (-910.224) (-901.626) -- 0:02:33
      433000 -- (-911.989) (-924.160) [-917.689] (-925.024) * [-907.112] (-926.274) (-924.946) (-917.637) -- 0:02:33
      433500 -- (-917.109) (-926.052) [-911.918] (-941.592) * (-906.505) (-918.008) (-917.270) [-903.577] -- 0:02:32
      434000 -- (-915.112) (-921.860) [-915.229] (-939.573) * (-916.563) (-922.994) [-906.811] (-909.723) -- 0:02:32
      434500 -- (-923.327) (-915.330) [-910.378] (-926.198) * (-912.694) (-927.746) [-910.004] (-921.455) -- 0:02:32
      435000 -- [-917.759] (-915.703) (-914.527) (-937.573) * [-906.898] (-927.305) (-914.564) (-928.321) -- 0:02:31

      Average standard deviation of split frequencies: 0.009239

      435500 -- [-909.672] (-914.946) (-916.094) (-927.991) * (-931.766) [-904.909] (-915.787) (-913.580) -- 0:02:32
      436000 -- [-914.842] (-912.075) (-911.128) (-924.320) * (-915.535) (-902.657) [-914.885] (-920.357) -- 0:02:32
      436500 -- [-912.095] (-925.564) (-918.017) (-915.506) * (-911.405) [-918.939] (-916.166) (-920.236) -- 0:02:32
      437000 -- [-908.848] (-931.953) (-910.057) (-914.951) * [-919.094] (-922.831) (-918.835) (-905.862) -- 0:02:32
      437500 -- (-911.756) (-921.782) (-915.095) [-921.201] * (-908.114) [-911.247] (-912.715) (-915.560) -- 0:02:31
      438000 -- (-901.722) (-920.197) (-928.805) [-918.750] * (-908.949) (-916.147) [-904.184] (-926.494) -- 0:02:31
      438500 -- [-903.222] (-914.697) (-916.832) (-929.921) * (-921.368) [-914.037] (-905.572) (-910.906) -- 0:02:31
      439000 -- (-923.872) [-906.820] (-915.514) (-928.700) * (-921.685) (-911.160) [-910.596] (-920.969) -- 0:02:30
      439500 -- (-914.622) [-906.392] (-923.508) (-930.848) * (-924.127) [-913.404] (-910.022) (-922.365) -- 0:02:31
      440000 -- (-907.371) (-917.470) (-929.574) [-914.057] * (-930.708) [-915.165] (-941.020) (-916.701) -- 0:02:31

      Average standard deviation of split frequencies: 0.010114

      440500 -- [-912.036] (-918.001) (-917.062) (-927.595) * (-922.159) (-915.612) [-925.459] (-926.634) -- 0:02:31
      441000 -- [-905.383] (-923.626) (-908.116) (-922.916) * (-918.882) [-918.777] (-917.833) (-930.664) -- 0:02:30
      441500 -- [-911.767] (-921.518) (-906.172) (-915.654) * (-926.948) [-913.939] (-911.820) (-932.285) -- 0:02:30
      442000 -- (-912.791) (-910.594) [-900.904] (-918.126) * (-924.591) [-907.725] (-925.202) (-909.897) -- 0:02:30
      442500 -- (-919.188) (-915.426) (-918.592) [-924.922] * (-912.156) (-917.132) [-916.272] (-919.413) -- 0:02:29
      443000 -- (-929.967) (-904.912) (-914.353) [-912.000] * (-917.070) (-916.416) [-899.481] (-912.557) -- 0:02:30
      443500 -- (-925.297) (-929.431) (-902.375) [-912.429] * (-909.107) [-917.469] (-917.027) (-927.517) -- 0:02:30
      444000 -- (-911.456) (-922.734) [-922.322] (-902.526) * (-914.443) (-928.824) (-932.030) [-924.761] -- 0:02:30
      444500 -- (-909.702) [-907.543] (-909.328) (-928.541) * [-908.489] (-920.399) (-928.039) (-918.625) -- 0:02:29
      445000 -- (-904.760) [-908.087] (-917.939) (-922.555) * [-918.845] (-909.942) (-911.286) (-904.475) -- 0:02:29

      Average standard deviation of split frequencies: 0.009320

      445500 -- (-911.334) (-917.404) [-910.757] (-940.018) * (-914.386) [-907.787] (-912.888) (-929.526) -- 0:02:29
      446000 -- [-912.640] (-918.538) (-922.591) (-934.435) * (-940.503) [-910.200] (-919.492) (-914.328) -- 0:02:29
      446500 -- (-913.502) [-914.430] (-908.954) (-939.061) * [-906.237] (-908.358) (-924.821) (-922.438) -- 0:02:28
      447000 -- (-914.196) (-921.942) [-912.534] (-919.881) * (-925.004) (-909.073) (-906.744) [-917.998] -- 0:02:29
      447500 -- (-917.918) (-911.090) [-909.347] (-946.286) * [-914.074] (-917.302) (-909.369) (-924.667) -- 0:02:29
      448000 -- (-924.755) (-929.620) [-903.784] (-925.953) * (-925.706) (-940.495) [-906.182] (-916.452) -- 0:02:29
      448500 -- [-907.480] (-929.497) (-924.117) (-910.747) * [-913.828] (-931.289) (-910.482) (-924.691) -- 0:02:28
      449000 -- (-913.472) (-939.183) [-909.214] (-915.003) * (-927.468) (-911.105) [-916.557] (-915.973) -- 0:02:28
      449500 -- (-913.206) (-927.053) [-907.489] (-936.440) * (-917.331) [-920.999] (-916.701) (-918.797) -- 0:02:28
      450000 -- [-903.878] (-915.951) (-912.728) (-919.596) * (-920.577) (-924.430) (-913.796) [-909.725] -- 0:02:27

      Average standard deviation of split frequencies: 0.012457

      450500 -- (-910.902) (-941.494) [-906.323] (-910.301) * (-919.461) (-918.144) (-928.327) [-913.482] -- 0:02:28
      451000 -- (-910.202) (-924.561) (-912.195) [-911.533] * (-908.651) (-922.728) (-917.535) [-915.333] -- 0:02:28
      451500 -- (-910.955) (-910.327) (-928.141) [-904.309] * (-918.433) (-925.315) [-908.587] (-919.810) -- 0:02:28
      452000 -- [-918.498] (-920.197) (-928.473) (-904.240) * (-920.816) (-912.149) (-912.454) [-908.192] -- 0:02:27
      452500 -- (-913.259) [-910.239] (-921.002) (-913.065) * (-926.036) (-914.264) (-913.577) [-915.544] -- 0:02:27
      453000 -- (-922.851) (-925.440) (-923.054) [-909.716] * (-912.950) [-923.972] (-909.539) (-915.651) -- 0:02:28
      453500 -- (-911.603) (-937.659) [-908.775] (-928.432) * (-910.876) (-933.862) (-914.486) [-914.101] -- 0:02:28
      454000 -- (-912.569) [-917.227] (-918.826) (-911.501) * [-912.302] (-929.752) (-919.586) (-919.661) -- 0:02:29
      454500 -- (-922.701) (-918.284) (-915.001) [-920.665] * (-913.234) [-907.182] (-921.626) (-918.649) -- 0:02:28
      455000 -- [-913.655] (-922.334) (-916.596) (-925.505) * (-915.215) (-909.057) [-910.236] (-916.397) -- 0:02:29

      Average standard deviation of split frequencies: 0.013815

      455500 -- (-919.297) [-913.114] (-932.075) (-915.553) * (-922.602) (-924.959) [-906.018] (-915.997) -- 0:02:29
      456000 -- (-922.299) (-910.321) [-906.217] (-911.964) * (-912.603) (-920.260) [-922.449] (-913.046) -- 0:02:29
      456500 -- [-918.318] (-905.208) (-919.378) (-931.121) * (-924.948) [-910.956] (-918.141) (-927.275) -- 0:02:28
      457000 -- [-915.031] (-913.943) (-917.315) (-922.447) * [-906.808] (-921.039) (-916.256) (-927.181) -- 0:02:29
      457500 -- (-929.435) [-899.741] (-906.550) (-922.015) * (-910.244) (-928.162) [-910.088] (-914.293) -- 0:02:29
      458000 -- (-909.033) (-922.849) [-922.072] (-925.585) * (-919.830) [-919.292] (-913.197) (-924.032) -- 0:02:29
      458500 -- (-911.668) (-911.535) (-929.280) [-913.514] * [-913.818] (-923.495) (-930.012) (-914.798) -- 0:02:28
      459000 -- [-910.616] (-924.413) (-916.018) (-918.425) * (-914.452) [-912.220] (-921.207) (-920.539) -- 0:02:28
      459500 -- (-918.383) [-916.758] (-907.686) (-915.204) * (-927.499) (-912.464) (-918.070) [-914.636] -- 0:02:28
      460000 -- (-910.420) (-922.228) [-911.653] (-905.460) * [-912.693] (-918.104) (-922.483) (-911.479) -- 0:02:27

      Average standard deviation of split frequencies: 0.013954

      460500 -- [-909.181] (-930.543) (-916.566) (-926.006) * (-921.167) (-925.807) (-920.995) [-911.098] -- 0:02:27
      461000 -- (-922.432) (-916.719) (-912.249) [-907.247] * (-927.304) [-914.037] (-913.698) (-930.400) -- 0:02:28
      461500 -- (-923.357) (-920.401) (-916.561) [-904.979] * (-921.060) (-929.414) (-920.424) [-912.833] -- 0:02:28
      462000 -- [-913.886] (-937.405) (-916.021) (-931.994) * [-901.772] (-934.484) (-915.621) (-906.495) -- 0:02:27
      462500 -- [-914.300] (-906.272) (-915.050) (-915.266) * [-909.537] (-938.570) (-923.831) (-922.282) -- 0:02:27
      463000 -- [-917.685] (-915.583) (-906.710) (-907.611) * (-909.558) (-936.503) [-911.565] (-923.503) -- 0:02:27
      463500 -- (-923.935) (-920.670) [-919.542] (-925.001) * (-916.656) (-921.004) [-918.528] (-917.694) -- 0:02:27
      464000 -- [-907.792] (-926.419) (-915.422) (-925.185) * [-911.742] (-919.857) (-917.801) (-920.105) -- 0:02:26
      464500 -- (-910.229) (-918.495) (-928.089) [-919.193] * (-918.750) (-916.268) (-928.494) [-920.498] -- 0:02:26
      465000 -- (-927.901) (-910.116) [-916.943] (-924.948) * (-920.328) (-910.594) (-915.899) [-904.483] -- 0:02:27

      Average standard deviation of split frequencies: 0.013335

      465500 -- (-927.893) (-915.196) (-909.774) [-914.037] * [-917.907] (-906.828) (-907.799) (-917.997) -- 0:02:26
      466000 -- (-922.030) (-908.492) (-919.261) [-915.115] * [-915.909] (-924.916) (-917.211) (-916.898) -- 0:02:26
      466500 -- (-933.749) [-912.349] (-907.454) (-914.515) * (-930.032) [-910.835] (-916.324) (-919.438) -- 0:02:26
      467000 -- (-922.138) (-916.898) [-911.445] (-921.833) * (-910.007) [-917.552] (-910.723) (-913.757) -- 0:02:26
      467500 -- (-928.783) [-912.906] (-919.863) (-913.682) * [-918.543] (-918.393) (-916.975) (-915.046) -- 0:02:25
      468000 -- (-918.475) (-919.679) (-911.762) [-916.197] * (-912.983) (-923.919) (-926.440) [-913.655] -- 0:02:25
      468500 -- (-915.226) [-912.112] (-928.945) (-921.110) * (-917.478) (-910.257) (-929.497) [-913.796] -- 0:02:26
      469000 -- (-913.446) (-925.302) [-916.990] (-914.481) * (-927.063) [-908.792] (-916.799) (-913.832) -- 0:02:26
      469500 -- (-908.124) (-927.935) [-913.091] (-919.895) * [-902.678] (-920.415) (-931.787) (-907.178) -- 0:02:25
      470000 -- (-913.853) (-918.008) [-916.470] (-922.332) * [-917.690] (-916.925) (-925.468) (-912.182) -- 0:02:25

      Average standard deviation of split frequencies: 0.012201

      470500 -- (-926.193) (-920.362) [-916.854] (-904.513) * (-912.527) [-908.007] (-914.571) (-920.834) -- 0:02:25
      471000 -- (-935.029) [-912.219] (-924.442) (-921.339) * (-915.286) [-911.122] (-923.270) (-925.072) -- 0:02:24
      471500 -- (-908.002) (-920.358) [-920.635] (-918.698) * [-911.205] (-921.292) (-921.288) (-921.602) -- 0:02:24
      472000 -- (-916.320) (-928.323) (-915.727) [-909.411] * (-919.339) (-914.066) (-914.861) [-908.714] -- 0:02:24
      472500 -- (-909.992) (-914.218) (-918.545) [-912.256] * (-911.692) (-916.171) (-922.951) [-910.352] -- 0:02:25
      473000 -- (-912.882) (-913.290) (-929.255) [-918.087] * (-907.763) [-914.093] (-926.128) (-917.527) -- 0:02:24
      473500 -- (-921.820) (-916.433) [-908.226] (-935.112) * (-913.835) [-915.774] (-910.675) (-926.628) -- 0:02:24
      474000 -- (-915.716) (-910.529) [-908.903] (-913.575) * [-901.700] (-930.511) (-903.184) (-912.756) -- 0:02:24
      474500 -- (-912.604) (-914.996) (-913.837) [-906.066] * [-903.939] (-918.826) (-916.051) (-926.853) -- 0:02:23
      475000 -- (-919.532) (-918.564) [-912.508] (-918.783) * [-909.179] (-924.239) (-920.991) (-927.260) -- 0:02:23

      Average standard deviation of split frequencies: 0.013325

      475500 -- (-912.762) [-915.381] (-925.413) (-910.612) * (-909.054) (-931.287) [-909.426] (-907.708) -- 0:02:23
      476000 -- (-912.338) (-924.620) (-919.853) [-906.391] * (-927.215) [-909.739] (-923.473) (-916.567) -- 0:02:23
      476500 -- (-909.862) (-927.105) (-912.808) [-906.489] * (-929.132) (-918.523) (-917.462) [-918.108] -- 0:02:23
      477000 -- (-925.248) (-916.266) (-918.725) [-917.210] * [-918.228] (-923.991) (-919.353) (-928.441) -- 0:02:23
      477500 -- (-914.472) (-912.648) (-911.549) [-910.759] * (-925.723) (-923.321) [-917.506] (-913.399) -- 0:02:23
      478000 -- (-921.993) [-916.546] (-919.334) (-898.249) * (-919.227) [-914.329] (-917.298) (-913.394) -- 0:02:23
      478500 -- (-906.382) (-924.121) (-921.767) [-906.537] * (-919.610) (-920.818) (-905.003) [-906.658] -- 0:02:22
      479000 -- (-914.524) (-927.294) [-905.652] (-911.291) * (-921.933) [-914.040] (-923.293) (-926.131) -- 0:02:22
      479500 -- (-905.942) (-918.173) (-914.135) [-918.248] * [-934.232] (-918.730) (-922.900) (-910.490) -- 0:02:22
      480000 -- [-914.671] (-914.145) (-917.921) (-917.054) * (-919.064) (-914.242) [-917.715] (-910.658) -- 0:02:23

      Average standard deviation of split frequencies: 0.013641

      480500 -- [-904.038] (-918.673) (-923.058) (-916.143) * (-911.918) (-913.033) (-919.891) [-906.418] -- 0:02:22
      481000 -- [-902.170] (-914.178) (-917.831) (-922.598) * (-922.099) (-923.455) (-914.922) [-916.152] -- 0:02:22
      481500 -- [-907.238] (-931.070) (-911.268) (-909.981) * [-915.631] (-922.084) (-917.188) (-915.504) -- 0:02:22
      482000 -- [-908.284] (-917.239) (-920.748) (-916.463) * (-908.661) (-927.698) [-911.998] (-912.134) -- 0:02:21
      482500 -- (-913.372) (-913.780) (-920.654) [-912.891] * (-923.473) (-922.354) (-918.112) [-908.993] -- 0:02:21
      483000 -- (-907.094) [-916.641] (-919.219) (-910.213) * (-913.078) (-919.177) (-915.637) [-911.541] -- 0:02:21
      483500 -- [-910.625] (-907.371) (-927.073) (-917.179) * (-909.209) (-913.700) (-916.462) [-904.570] -- 0:02:22
      484000 -- (-919.143) (-918.085) (-918.417) [-912.276] * (-912.473) (-922.623) (-919.200) [-909.457] -- 0:02:21
      484500 -- (-912.055) [-906.774] (-920.263) (-918.977) * (-924.427) [-913.036] (-910.728) (-909.683) -- 0:02:21
      485000 -- (-929.569) (-920.434) (-917.491) [-926.247] * [-913.790] (-914.423) (-927.149) (-924.406) -- 0:02:21

      Average standard deviation of split frequencies: 0.014550

      485500 -- (-917.853) [-911.577] (-917.052) (-915.494) * (-916.160) (-918.353) (-917.818) [-913.355] -- 0:02:20
      486000 -- (-916.658) (-913.601) [-907.314] (-919.170) * (-918.058) [-911.554] (-916.243) (-912.977) -- 0:02:20
      486500 -- [-914.619] (-906.482) (-912.915) (-921.463) * (-932.425) (-906.788) (-931.197) [-910.799] -- 0:02:20
      487000 -- (-913.690) (-916.676) [-907.517] (-917.178) * [-911.200] (-910.646) (-928.816) (-907.602) -- 0:02:21
      487500 -- (-913.537) (-907.947) [-906.011] (-918.283) * [-921.326] (-905.240) (-933.854) (-923.292) -- 0:02:20
      488000 -- (-920.164) (-921.002) [-917.036] (-915.844) * (-914.451) [-916.394] (-919.370) (-918.459) -- 0:02:20
      488500 -- (-919.741) [-906.886] (-914.372) (-915.463) * (-910.784) [-901.300] (-908.942) (-914.675) -- 0:02:20
      489000 -- (-909.194) [-908.674] (-924.398) (-927.913) * (-904.356) (-927.144) [-901.244] (-910.482) -- 0:02:20
      489500 -- (-910.905) (-914.784) (-918.240) [-916.773] * (-908.441) (-931.771) [-917.413] (-926.635) -- 0:02:19
      490000 -- (-920.321) [-907.992] (-906.715) (-923.409) * (-905.566) (-903.002) [-910.075] (-924.271) -- 0:02:19

      Average standard deviation of split frequencies: 0.013538

      490500 -- (-922.701) [-910.320] (-913.747) (-922.996) * (-915.254) (-916.650) [-910.556] (-910.036) -- 0:02:19
      491000 -- [-917.810] (-913.516) (-916.269) (-922.800) * (-925.366) (-909.305) (-916.227) [-914.555] -- 0:02:19
      491500 -- (-913.083) [-902.410] (-921.564) (-911.780) * (-900.529) (-915.594) [-914.491] (-917.547) -- 0:02:19
      492000 -- (-925.339) (-938.930) [-912.220] (-915.703) * (-912.821) (-912.076) [-918.455] (-917.729) -- 0:02:19
      492500 -- (-925.677) (-916.115) [-922.171] (-917.079) * [-909.579] (-915.691) (-916.152) (-906.902) -- 0:02:19
      493000 -- [-911.186] (-930.732) (-906.279) (-912.923) * (-915.262) (-919.589) [-921.547] (-908.067) -- 0:02:18
      493500 -- (-929.520) [-914.687] (-910.936) (-918.651) * (-910.787) (-924.019) (-931.924) [-914.277] -- 0:02:18
      494000 -- (-932.349) [-902.595] (-920.637) (-914.884) * (-909.908) (-920.369) (-924.243) [-908.607] -- 0:02:18
      494500 -- [-905.865] (-919.171) (-923.693) (-915.054) * (-911.616) (-925.444) (-917.973) [-906.486] -- 0:02:18
      495000 -- (-923.035) [-906.517] (-923.210) (-912.219) * [-913.022] (-916.430) (-915.075) (-917.934) -- 0:02:18

      Average standard deviation of split frequencies: 0.013479

      495500 -- (-931.943) (-909.564) [-909.693] (-919.616) * (-913.904) (-913.740) (-912.366) [-913.084] -- 0:02:18
      496000 -- [-911.082] (-921.324) (-924.938) (-917.154) * [-909.482] (-912.229) (-926.954) (-911.447) -- 0:02:18
      496500 -- (-918.961) [-914.868] (-917.319) (-924.434) * (-918.964) (-919.461) [-920.914] (-909.934) -- 0:02:17
      497000 -- (-908.435) [-908.351] (-907.551) (-915.419) * (-924.859) [-913.781] (-925.259) (-918.621) -- 0:02:17
      497500 -- (-918.003) (-907.922) (-917.127) [-912.696] * [-912.780] (-929.214) (-943.040) (-916.855) -- 0:02:17
      498000 -- (-921.175) [-908.195] (-919.502) (-914.798) * (-918.147) (-918.408) (-927.033) [-915.571] -- 0:02:17
      498500 -- (-923.364) (-924.241) (-919.701) [-910.520] * (-909.168) (-928.208) [-916.736] (-924.060) -- 0:02:16
      499000 -- (-915.809) [-926.414] (-906.431) (-926.176) * (-910.763) (-924.317) [-916.274] (-917.721) -- 0:02:17
      499500 -- [-911.352] (-910.228) (-926.354) (-924.791) * [-910.373] (-925.018) (-918.295) (-914.915) -- 0:02:17
      500000 -- (-923.662) [-909.231] (-924.441) (-903.231) * (-912.621) (-921.670) (-924.932) [-905.036] -- 0:02:17

      Average standard deviation of split frequencies: 0.012497

      500500 -- (-928.496) (-916.130) [-913.793] (-922.480) * [-914.884] (-916.669) (-912.757) (-907.605) -- 0:02:16
      501000 -- (-911.466) [-906.924] (-908.667) (-911.017) * (-922.099) (-909.932) (-916.044) [-906.369] -- 0:02:16
      501500 -- (-914.360) (-927.768) (-922.685) [-912.025] * (-922.710) [-906.807] (-934.223) (-914.859) -- 0:02:16
      502000 -- (-905.400) (-912.095) (-911.685) [-911.320] * (-929.272) (-918.766) (-920.308) [-914.996] -- 0:02:15
      502500 -- (-916.401) [-906.815] (-919.750) (-930.459) * (-920.053) [-912.116] (-918.185) (-914.959) -- 0:02:16
      503000 -- (-913.321) (-912.843) (-916.391) [-915.551] * [-915.177] (-914.479) (-920.547) (-920.013) -- 0:02:16
      503500 -- (-928.984) (-916.173) [-910.480] (-919.215) * (-923.064) (-914.933) (-923.362) [-912.717] -- 0:02:16
      504000 -- (-945.762) (-915.685) (-917.696) [-919.175] * [-912.650] (-921.619) (-922.284) (-912.307) -- 0:02:15
      504500 -- [-917.556] (-916.990) (-919.472) (-912.190) * (-917.518) (-923.325) (-939.999) [-898.984] -- 0:02:15
      505000 -- (-918.441) [-908.348] (-917.829) (-913.750) * (-917.875) [-917.145] (-924.329) (-927.223) -- 0:02:15

      Average standard deviation of split frequencies: 0.014229

      505500 -- [-912.178] (-915.761) (-923.509) (-929.218) * (-913.872) (-925.160) (-928.128) [-908.753] -- 0:02:14
      506000 -- (-908.021) [-911.739] (-928.659) (-914.720) * [-927.187] (-920.622) (-913.212) (-914.347) -- 0:02:14
      506500 -- (-916.952) [-913.840] (-915.731) (-904.483) * (-926.470) [-918.035] (-917.600) (-918.441) -- 0:02:15
      507000 -- (-915.650) [-917.205] (-929.279) (-923.400) * (-925.225) (-919.489) [-908.512] (-926.316) -- 0:02:15
      507500 -- (-911.801) (-910.588) [-911.030] (-922.490) * (-930.607) (-913.186) [-908.391] (-924.425) -- 0:02:14
      508000 -- (-921.536) (-916.551) [-921.561] (-926.367) * [-914.912] (-906.516) (-919.530) (-924.509) -- 0:02:14
      508500 -- (-926.206) [-909.816] (-914.790) (-924.503) * (-915.891) (-923.705) (-914.178) [-922.202] -- 0:02:14
      509000 -- (-911.301) (-916.592) [-916.520] (-920.166) * (-914.468) (-923.839) (-910.911) [-911.399] -- 0:02:14
      509500 -- (-918.677) (-923.296) [-911.647] (-908.812) * [-911.391] (-926.247) (-914.301) (-912.183) -- 0:02:13
      510000 -- (-907.896) (-929.188) [-916.545] (-912.580) * [-931.835] (-915.981) (-922.175) (-916.329) -- 0:02:13

      Average standard deviation of split frequencies: 0.014182

      510500 -- (-916.414) (-915.728) (-928.102) [-910.842] * (-916.953) (-916.543) (-945.615) [-902.947] -- 0:02:14
      511000 -- (-922.773) [-911.953] (-912.309) (-920.290) * [-911.072] (-920.193) (-924.936) (-902.448) -- 0:02:13
      511500 -- (-922.237) [-912.940] (-917.971) (-919.229) * (-926.044) (-930.742) (-916.992) [-913.637] -- 0:02:13
      512000 -- (-920.922) (-923.711) (-904.845) [-911.271] * (-914.032) (-913.321) (-920.356) [-912.035] -- 0:02:13
      512500 -- (-911.542) (-920.595) [-918.823] (-922.168) * (-914.155) (-914.586) [-909.512] (-926.183) -- 0:02:13
      513000 -- (-921.787) (-918.503) [-916.854] (-926.583) * [-910.030] (-922.648) (-907.035) (-914.538) -- 0:02:12
      513500 -- (-907.514) [-911.316] (-925.398) (-920.444) * (-916.027) (-913.260) [-907.615] (-919.831) -- 0:02:12
      514000 -- (-906.379) [-924.800] (-935.160) (-912.532) * (-914.244) (-915.177) [-918.122] (-909.828) -- 0:02:12
      514500 -- (-922.660) (-915.042) [-923.266] (-910.338) * (-919.488) (-913.883) (-918.578) [-912.224] -- 0:02:13
      515000 -- (-920.298) (-913.477) [-912.995] (-923.443) * (-915.495) (-910.706) (-911.218) [-904.000] -- 0:02:12

      Average standard deviation of split frequencies: 0.015863

      515500 -- [-910.423] (-918.973) (-932.489) (-919.889) * (-925.279) (-915.065) [-908.238] (-914.581) -- 0:02:12
      516000 -- (-925.632) (-929.470) [-911.165] (-913.404) * (-913.808) (-912.743) (-933.801) [-913.481] -- 0:02:12
      516500 -- (-919.638) [-919.354] (-918.762) (-920.765) * (-915.140) [-906.798] (-931.873) (-923.697) -- 0:02:11
      517000 -- (-927.911) (-921.578) [-906.197] (-917.269) * [-918.455] (-912.400) (-931.989) (-919.784) -- 0:02:11
      517500 -- (-919.047) (-915.562) (-921.852) [-914.824] * (-922.238) [-915.970] (-917.623) (-909.222) -- 0:02:11
      518000 -- [-916.765] (-910.064) (-917.851) (-916.019) * (-916.021) (-919.332) (-916.808) [-901.938] -- 0:02:11
      518500 -- (-908.895) [-905.049] (-919.692) (-920.039) * (-923.113) (-909.470) (-920.041) [-915.822] -- 0:02:11
      519000 -- (-921.467) [-914.573] (-930.301) (-922.478) * (-913.433) (-918.473) [-903.234] (-928.775) -- 0:02:11
      519500 -- (-921.911) [-921.082] (-928.693) (-916.195) * [-911.256] (-918.569) (-905.563) (-923.828) -- 0:02:11
      520000 -- [-912.344] (-930.771) (-920.983) (-922.273) * (-920.801) [-910.528] (-914.888) (-913.875) -- 0:02:11

      Average standard deviation of split frequencies: 0.016050

      520500 -- [-907.827] (-924.556) (-922.539) (-912.623) * (-915.441) (-910.749) [-907.294] (-917.692) -- 0:02:10
      521000 -- (-915.634) [-916.352] (-910.633) (-919.578) * (-926.526) (-923.632) (-917.809) [-909.860] -- 0:02:10
      521500 -- [-914.540] (-914.959) (-917.307) (-917.584) * (-911.416) (-927.875) [-902.777] (-910.811) -- 0:02:10
      522000 -- (-921.084) (-912.627) [-910.523] (-935.463) * (-922.835) (-920.522) [-918.475] (-907.501) -- 0:02:10
      522500 -- (-916.339) (-915.368) [-909.006] (-915.194) * (-933.842) [-918.070] (-918.715) (-918.814) -- 0:02:10
      523000 -- (-926.961) (-904.880) [-912.327] (-922.520) * [-911.823] (-939.849) (-924.228) (-916.249) -- 0:02:10
      523500 -- (-924.574) [-916.990] (-910.536) (-922.501) * (-917.180) (-925.555) (-919.312) [-910.423] -- 0:02:10
      524000 -- [-919.742] (-918.935) (-914.360) (-927.457) * (-916.099) (-935.502) (-915.847) [-908.915] -- 0:02:09
      524500 -- (-923.404) [-912.729] (-914.687) (-923.228) * (-926.705) (-923.211) [-908.393] (-908.763) -- 0:02:09
      525000 -- (-908.257) (-908.715) (-911.695) [-906.765] * (-911.450) (-929.724) [-910.878] (-912.396) -- 0:02:09

      Average standard deviation of split frequencies: 0.017109

      525500 -- [-915.955] (-914.486) (-908.261) (-922.653) * [-910.022] (-919.051) (-912.475) (-925.944) -- 0:02:09
      526000 -- (-912.866) [-910.004] (-929.910) (-922.841) * (-913.828) (-916.980) (-920.249) [-915.997] -- 0:02:09
      526500 -- [-902.241] (-924.943) (-921.387) (-917.509) * (-914.850) (-928.700) [-907.448] (-922.329) -- 0:02:09
      527000 -- (-909.417) (-921.612) (-917.347) [-910.679] * (-917.109) (-911.446) [-906.844] (-927.949) -- 0:02:09
      527500 -- [-910.689] (-920.966) (-931.604) (-918.499) * [-912.036] (-917.542) (-916.708) (-930.307) -- 0:02:08
      528000 -- (-922.319) (-911.639) [-910.493] (-910.544) * [-910.831] (-918.433) (-909.886) (-920.725) -- 0:02:08
      528500 -- (-926.125) (-909.001) (-922.054) [-928.014] * [-921.164] (-913.679) (-912.072) (-930.800) -- 0:02:08
      529000 -- (-919.663) (-916.993) [-903.322] (-917.730) * (-924.111) (-914.047) [-918.820] (-919.757) -- 0:02:08
      529500 -- (-911.302) (-933.706) [-902.240] (-918.641) * [-915.004] (-922.483) (-919.855) (-923.196) -- 0:02:07
      530000 -- [-907.291] (-921.908) (-905.790) (-911.357) * [-915.871] (-920.956) (-917.438) (-913.213) -- 0:02:08

      Average standard deviation of split frequencies: 0.017686

      530500 -- (-918.542) (-923.514) [-898.312] (-923.227) * [-915.186] (-924.530) (-915.117) (-911.313) -- 0:02:08
      531000 -- (-925.024) (-927.474) [-916.870] (-910.980) * (-925.884) (-923.326) (-912.974) [-911.522] -- 0:02:08
      531500 -- (-920.123) (-925.233) [-907.255] (-921.229) * (-935.379) (-911.625) [-905.229] (-914.945) -- 0:02:07
      532000 -- [-920.619] (-927.130) (-909.556) (-911.061) * (-938.691) (-929.171) (-919.825) [-914.896] -- 0:02:07
      532500 -- (-926.934) (-921.163) [-914.953] (-930.094) * (-934.908) (-926.671) (-918.527) [-915.071] -- 0:02:07
      533000 -- (-921.209) (-915.429) (-926.279) [-916.677] * (-922.428) (-933.809) [-922.918] (-909.870) -- 0:02:07
      533500 -- (-906.450) [-914.481] (-915.617) (-920.618) * (-923.479) [-904.579] (-921.806) (-911.604) -- 0:02:06
      534000 -- (-910.923) [-920.156] (-929.885) (-915.989) * (-927.631) (-914.928) [-908.612] (-908.255) -- 0:02:07
      534500 -- (-917.203) (-927.611) (-926.733) [-912.543] * (-939.695) (-904.973) [-911.466] (-916.084) -- 0:02:07
      535000 -- (-912.725) (-926.360) [-917.140] (-914.982) * (-916.100) (-916.076) [-903.289] (-907.117) -- 0:02:06

      Average standard deviation of split frequencies: 0.017190

      535500 -- [-904.289] (-930.432) (-942.957) (-919.200) * [-930.995] (-908.991) (-917.510) (-917.346) -- 0:02:06
      536000 -- [-913.959] (-914.456) (-928.339) (-913.701) * (-933.754) [-915.432] (-912.620) (-922.478) -- 0:02:06
      536500 -- (-926.545) (-909.174) (-943.699) [-912.534] * (-928.521) (-909.523) (-913.872) [-903.553] -- 0:02:06
      537000 -- (-923.200) [-909.813] (-917.718) (-922.256) * (-914.212) (-920.623) (-915.469) [-916.258] -- 0:02:05
      537500 -- (-923.792) [-910.958] (-931.314) (-917.714) * (-914.880) [-918.362] (-919.621) (-920.467) -- 0:02:06
      538000 -- (-926.558) [-911.561] (-921.945) (-911.985) * (-907.150) [-917.899] (-915.892) (-929.063) -- 0:02:06
      538500 -- (-930.397) (-922.865) (-913.303) [-914.755] * (-919.055) (-926.996) (-929.506) [-914.053] -- 0:02:05
      539000 -- (-921.348) (-926.034) (-920.873) [-907.880] * (-920.618) [-915.066] (-917.221) (-932.163) -- 0:02:05
      539500 -- [-911.875] (-917.999) (-916.154) (-916.235) * (-916.048) (-914.486) [-912.503] (-923.897) -- 0:02:05
      540000 -- (-918.390) (-919.413) [-907.871] (-917.845) * [-912.629] (-920.221) (-925.364) (-914.818) -- 0:02:05

      Average standard deviation of split frequencies: 0.016804

      540500 -- (-937.844) (-906.383) (-910.897) [-909.649] * (-911.710) (-920.780) [-903.965] (-915.678) -- 0:02:04
      541000 -- [-915.588] (-917.877) (-918.436) (-919.660) * (-921.253) (-920.599) (-920.245) [-913.303] -- 0:02:04
      541500 -- (-923.774) (-914.319) [-913.641] (-909.935) * (-925.816) (-933.999) [-917.083] (-920.184) -- 0:02:05
      542000 -- (-921.532) (-927.045) (-917.500) [-903.768] * (-915.095) (-921.513) [-920.242] (-925.247) -- 0:02:05
      542500 -- [-911.239] (-926.412) (-928.772) (-924.285) * (-928.764) (-923.962) [-915.435] (-933.014) -- 0:02:04
      543000 -- (-908.989) (-923.845) [-918.622] (-923.076) * (-937.272) [-913.736] (-926.734) (-909.259) -- 0:02:04
      543500 -- (-914.973) (-909.269) [-918.434] (-908.984) * (-917.184) (-927.135) [-905.632] (-914.982) -- 0:02:04
      544000 -- (-919.486) [-912.030] (-923.140) (-918.974) * (-911.126) (-933.044) [-905.490] (-908.975) -- 0:02:04
      544500 -- (-923.483) (-916.794) [-916.399] (-912.192) * (-910.565) (-917.305) [-915.717] (-929.192) -- 0:02:03
      545000 -- (-935.663) (-919.346) [-908.401] (-914.860) * (-918.129) (-923.767) (-926.494) [-912.834] -- 0:02:03

      Average standard deviation of split frequencies: 0.016797

      545500 -- (-915.292) (-922.699) (-912.116) [-911.228] * [-913.857] (-919.139) (-942.536) (-932.856) -- 0:02:04
      546000 -- (-915.084) (-920.521) [-903.285] (-916.888) * (-913.907) (-914.315) (-914.147) [-904.922] -- 0:02:03
      546500 -- (-917.938) (-916.489) (-923.921) [-904.858] * (-915.593) (-928.979) (-926.031) [-906.088] -- 0:02:03
      547000 -- (-924.050) [-917.370] (-911.528) (-909.874) * (-906.853) (-922.623) (-909.596) [-914.239] -- 0:02:03
      547500 -- (-914.033) (-907.099) (-919.211) [-908.823] * (-915.004) [-910.916] (-918.811) (-920.671) -- 0:02:03
      548000 -- (-934.608) (-919.997) (-933.102) [-920.619] * (-912.009) [-915.782] (-906.752) (-919.560) -- 0:02:02
      548500 -- (-916.569) [-913.098] (-913.882) (-920.232) * [-911.228] (-920.388) (-922.610) (-909.273) -- 0:02:02
      549000 -- (-916.877) [-909.273] (-913.315) (-915.794) * [-912.938] (-914.681) (-916.162) (-913.863) -- 0:02:02
      549500 -- (-930.789) (-910.514) (-923.087) [-911.546] * [-916.607] (-925.905) (-920.062) (-932.345) -- 0:02:02
      550000 -- (-936.950) (-909.397) (-910.278) [-917.695] * (-910.945) (-916.543) (-911.785) [-908.142] -- 0:02:02

      Average standard deviation of split frequencies: 0.016732

      550500 -- (-939.015) (-919.616) (-909.599) [-918.552] * (-922.190) [-909.988] (-920.525) (-921.653) -- 0:02:02
      551000 -- [-921.524] (-921.512) (-920.100) (-915.974) * (-925.614) [-909.419] (-916.343) (-921.975) -- 0:02:02
      551500 -- (-927.886) (-923.848) (-907.196) [-908.173] * (-921.875) (-921.248) (-920.101) [-911.849] -- 0:02:01
      552000 -- (-928.829) (-915.680) [-915.710] (-915.911) * (-910.148) (-931.876) (-920.487) [-911.160] -- 0:02:01
      552500 -- [-917.987] (-932.556) (-918.336) (-926.849) * (-926.727) (-913.104) [-927.665] (-915.267) -- 0:02:01
      553000 -- (-915.045) (-917.096) [-909.468] (-928.441) * (-912.521) (-909.417) (-915.389) [-914.799] -- 0:02:01
      553500 -- [-911.551] (-925.952) (-909.487) (-920.734) * (-909.485) (-912.107) (-910.927) [-910.588] -- 0:02:01
      554000 -- (-909.180) (-925.815) [-914.522] (-911.183) * (-917.471) [-916.244] (-914.263) (-919.570) -- 0:02:01
      554500 -- (-927.659) [-916.692] (-916.801) (-904.581) * (-926.525) [-909.926] (-917.509) (-910.248) -- 0:02:01
      555000 -- (-913.731) (-919.883) (-915.679) [-919.917] * (-939.831) (-914.678) [-915.625] (-916.669) -- 0:02:01

      Average standard deviation of split frequencies: 0.018421

      555500 -- [-906.674] (-915.256) (-909.829) (-916.600) * (-915.498) [-925.309] (-922.010) (-913.993) -- 0:02:00
      556000 -- (-916.011) (-929.064) [-914.729] (-913.935) * (-914.885) [-918.809] (-922.580) (-911.761) -- 0:02:00
      556500 -- (-912.909) (-911.496) (-913.623) [-909.101] * (-918.042) [-905.628] (-915.003) (-921.022) -- 0:02:00
      557000 -- (-912.907) (-923.109) (-905.441) [-907.858] * (-914.889) [-918.640] (-936.476) (-914.814) -- 0:02:00
      557500 -- (-912.816) (-915.539) (-919.898) [-912.604] * [-914.174] (-936.603) (-910.793) (-906.271) -- 0:02:00
      558000 -- [-917.899] (-911.129) (-921.684) (-909.319) * (-921.983) (-923.504) [-912.092] (-912.880) -- 0:02:00
      558500 -- (-912.620) (-925.430) [-910.727] (-927.533) * (-921.741) (-913.867) [-911.659] (-915.191) -- 0:02:00
      559000 -- (-929.098) (-918.863) [-910.185] (-932.243) * (-922.564) (-930.152) [-914.432] (-909.457) -- 0:01:59
      559500 -- (-934.233) (-909.176) (-917.239) [-917.993] * (-926.379) (-921.692) (-929.148) [-908.264] -- 0:01:59
      560000 -- (-915.118) [-915.381] (-912.645) (-916.022) * (-919.513) [-913.647] (-916.391) (-910.299) -- 0:01:59

      Average standard deviation of split frequencies: 0.018650

      560500 -- (-927.846) (-908.136) (-915.475) [-906.340] * [-913.033] (-913.726) (-918.996) (-917.005) -- 0:01:59
      561000 -- (-911.730) [-914.810] (-908.989) (-918.995) * (-917.104) [-911.141] (-923.714) (-915.036) -- 0:01:58
      561500 -- [-915.411] (-910.136) (-917.403) (-917.213) * (-912.355) (-911.674) [-911.818] (-914.723) -- 0:01:59
      562000 -- (-925.297) (-919.671) (-907.668) [-914.124] * (-914.677) [-906.343] (-913.445) (-925.054) -- 0:01:59
      562500 -- [-910.533] (-931.452) (-909.049) (-914.588) * (-923.323) (-905.324) (-914.096) [-917.337] -- 0:01:59
      563000 -- (-928.481) (-921.369) (-923.235) [-906.382] * [-920.759] (-913.706) (-922.230) (-918.015) -- 0:01:58
      563500 -- (-914.195) (-918.948) (-930.937) [-900.786] * (-925.025) [-907.996] (-915.823) (-919.500) -- 0:01:58
      564000 -- [-909.134] (-910.152) (-918.940) (-911.551) * (-909.047) [-906.052] (-910.957) (-923.346) -- 0:01:58
      564500 -- (-919.427) [-907.168] (-923.093) (-915.043) * [-910.594] (-912.575) (-917.944) (-920.000) -- 0:01:58
      565000 -- (-918.324) [-912.311] (-921.236) (-926.112) * (-913.435) (-928.385) [-918.239] (-918.220) -- 0:01:58

      Average standard deviation of split frequencies: 0.018096

      565500 -- (-920.816) [-912.386] (-915.882) (-913.960) * (-922.335) [-904.486] (-905.889) (-929.678) -- 0:01:58
      566000 -- (-929.313) (-914.644) (-914.679) [-921.868] * (-910.664) (-920.277) [-915.896] (-914.682) -- 0:01:58
      566500 -- (-918.477) (-919.918) [-911.273] (-926.427) * [-917.308] (-913.820) (-928.424) (-925.340) -- 0:01:57
      567000 -- (-930.811) (-919.189) (-907.477) [-903.086] * (-924.537) (-916.958) (-915.957) [-917.977] -- 0:01:57
      567500 -- (-933.652) (-912.727) [-911.435] (-919.116) * (-935.921) (-919.952) (-918.207) [-916.515] -- 0:01:57
      568000 -- (-937.839) [-910.256] (-909.244) (-921.871) * (-910.966) (-921.117) [-907.639] (-920.316) -- 0:01:57
      568500 -- (-926.192) [-913.876] (-922.898) (-915.622) * [-914.389] (-931.906) (-917.082) (-928.589) -- 0:01:56
      569000 -- (-916.321) (-909.619) [-916.838] (-909.181) * (-916.764) [-915.733] (-918.313) (-930.184) -- 0:01:57
      569500 -- [-919.902] (-910.461) (-926.082) (-917.948) * (-922.359) (-932.855) [-910.044] (-914.979) -- 0:01:57
      570000 -- (-906.965) (-916.722) [-930.503] (-927.545) * [-909.663] (-925.054) (-919.283) (-921.119) -- 0:01:56

      Average standard deviation of split frequencies: 0.017497

      570500 -- [-908.948] (-919.372) (-924.589) (-915.739) * (-918.603) (-919.364) (-927.347) [-918.563] -- 0:01:56
      571000 -- (-913.290) (-923.216) (-930.996) [-919.891] * (-912.425) (-919.569) [-908.473] (-925.307) -- 0:01:56
      571500 -- (-920.168) (-910.918) (-925.959) [-911.838] * (-907.134) [-917.647] (-925.894) (-918.408) -- 0:01:56
      572000 -- (-931.223) (-918.466) [-916.488] (-929.028) * [-910.139] (-921.674) (-926.021) (-929.089) -- 0:01:55
      572500 -- (-920.973) [-915.056] (-917.077) (-923.687) * [-907.050] (-916.492) (-921.732) (-920.473) -- 0:01:55
      573000 -- (-943.444) [-911.032] (-926.065) (-923.135) * [-911.035] (-908.128) (-933.891) (-922.184) -- 0:01:56
      573500 -- (-935.029) (-904.812) [-920.279] (-916.528) * [-910.185] (-915.629) (-921.427) (-915.322) -- 0:01:56
      574000 -- (-928.096) [-908.772] (-909.459) (-910.406) * (-922.220) [-907.367] (-928.766) (-924.289) -- 0:01:55
      574500 -- (-914.825) (-919.603) [-908.539] (-911.338) * (-914.728) [-916.647] (-927.006) (-917.347) -- 0:01:55
      575000 -- (-933.854) [-910.533] (-922.047) (-920.082) * (-928.431) (-913.816) (-921.405) [-909.999] -- 0:01:55

      Average standard deviation of split frequencies: 0.017782

      575500 -- (-928.153) [-911.701] (-915.386) (-911.902) * (-928.391) (-932.482) [-908.537] (-913.437) -- 0:01:55
      576000 -- (-918.284) [-913.774] (-926.287) (-915.585) * (-913.667) (-923.076) [-904.254] (-917.291) -- 0:01:54
      576500 -- [-915.798] (-915.614) (-918.224) (-915.797) * (-916.470) (-920.755) [-907.576] (-921.869) -- 0:01:54
      577000 -- (-921.931) (-907.117) (-911.998) [-909.728] * (-925.455) [-906.284] (-921.259) (-910.942) -- 0:01:55
      577500 -- [-903.825] (-922.653) (-913.758) (-930.146) * (-932.479) (-916.445) (-924.861) [-912.345] -- 0:01:54
      578000 -- [-903.448] (-910.271) (-921.996) (-916.082) * (-931.257) (-912.369) (-931.781) [-918.209] -- 0:01:54
      578500 -- (-914.188) (-908.344) (-934.118) [-914.508] * (-937.678) [-905.144] (-923.782) (-914.337) -- 0:01:54
      579000 -- (-908.766) (-928.805) [-910.719] (-917.811) * (-925.827) [-905.745] (-905.943) (-915.553) -- 0:01:54
      579500 -- (-932.407) [-913.602] (-923.696) (-912.122) * [-917.617] (-918.703) (-916.871) (-921.462) -- 0:01:53
      580000 -- (-915.254) [-909.985] (-917.945) (-914.188) * (-913.091) [-907.406] (-909.334) (-922.386) -- 0:01:53

      Average standard deviation of split frequencies: 0.017860

      580500 -- (-908.663) (-912.952) [-918.649] (-920.423) * (-919.268) (-914.295) [-910.628] (-916.621) -- 0:01:53
      581000 -- (-923.749) (-918.222) [-904.520] (-922.936) * (-914.692) [-907.912] (-911.514) (-917.845) -- 0:01:53
      581500 -- [-907.101] (-914.933) (-928.514) (-914.766) * (-919.778) [-909.479] (-922.562) (-922.436) -- 0:01:53
      582000 -- [-910.158] (-915.545) (-922.727) (-921.899) * (-908.884) [-906.591] (-927.346) (-938.819) -- 0:01:53
      582500 -- [-911.204] (-921.514) (-913.859) (-929.292) * (-916.495) (-925.131) (-927.308) [-912.273] -- 0:01:53
      583000 -- (-908.734) [-911.662] (-908.292) (-908.329) * (-919.226) (-938.177) [-913.297] (-924.119) -- 0:01:53
      583500 -- (-905.762) [-913.174] (-916.234) (-926.846) * (-928.556) [-922.139] (-913.992) (-918.016) -- 0:01:52
      584000 -- [-909.631] (-916.969) (-915.353) (-909.988) * [-912.975] (-911.311) (-916.313) (-920.565) -- 0:01:52
      584500 -- (-929.468) (-913.881) (-924.189) [-914.217] * (-934.894) (-920.816) (-918.057) [-909.824] -- 0:01:53
      585000 -- (-932.133) [-910.870] (-919.872) (-922.309) * (-917.950) (-920.290) (-917.789) [-913.921] -- 0:01:52

      Average standard deviation of split frequencies: 0.017186

      585500 -- [-906.927] (-923.298) (-927.031) (-922.137) * (-930.582) (-917.954) [-923.350] (-912.277) -- 0:01:52
      586000 -- (-919.092) [-922.794] (-923.008) (-918.742) * (-922.009) [-917.975] (-910.821) (-907.955) -- 0:01:52
      586500 -- (-922.093) [-914.930] (-917.184) (-912.127) * (-930.821) (-906.401) [-906.999] (-924.954) -- 0:01:52
      587000 -- [-905.255] (-917.927) (-915.577) (-906.604) * (-919.782) (-917.936) (-913.836) [-915.327] -- 0:01:51
      587500 -- (-930.435) (-914.231) [-914.924] (-910.466) * (-916.895) [-918.269] (-912.900) (-917.970) -- 0:01:51
      588000 -- [-916.610] (-922.334) (-924.872) (-910.931) * (-919.727) [-906.858] (-913.299) (-918.430) -- 0:01:52
      588500 -- (-915.407) (-915.691) (-911.266) [-910.094] * (-916.372) (-907.977) [-910.167] (-918.470) -- 0:01:51
      589000 -- (-922.014) [-920.316] (-930.514) (-934.629) * [-917.030] (-912.803) (-919.140) (-914.541) -- 0:01:51
      589500 -- [-908.531] (-909.244) (-920.006) (-907.012) * (-914.869) (-914.455) [-910.790] (-916.302) -- 0:01:51
      590000 -- (-925.796) (-919.388) [-912.347] (-920.803) * (-939.487) (-916.747) [-909.934] (-930.444) -- 0:01:51

      Average standard deviation of split frequencies: 0.016470

      590500 -- (-924.234) (-927.585) (-916.722) [-921.142] * (-914.407) (-917.591) [-909.427] (-914.702) -- 0:01:50
      591000 -- (-909.541) [-913.888] (-930.945) (-917.852) * (-926.029) (-917.580) [-903.151] (-906.070) -- 0:01:50
      591500 -- (-912.140) (-914.495) (-917.268) [-902.612] * [-913.014] (-914.842) (-924.938) (-920.378) -- 0:01:50
      592000 -- (-912.721) (-917.827) (-913.275) [-908.021] * (-913.127) (-912.581) (-908.994) [-903.593] -- 0:01:50
      592500 -- (-909.730) [-913.086] (-936.154) (-919.725) * (-917.003) (-915.286) (-913.850) [-908.744] -- 0:01:50
      593000 -- [-903.652] (-928.728) (-932.010) (-917.521) * (-921.656) [-916.792] (-918.040) (-914.061) -- 0:01:50
      593500 -- (-903.583) [-910.400] (-920.168) (-918.394) * (-928.181) (-910.413) [-917.044] (-928.397) -- 0:01:50
      594000 -- (-913.207) (-932.185) (-913.595) [-907.442] * (-915.167) (-923.478) [-922.446] (-924.086) -- 0:01:50
      594500 -- (-919.417) (-910.375) (-912.189) [-902.540] * (-908.395) [-917.458] (-914.814) (-925.464) -- 0:01:49
      595000 -- (-919.034) (-907.102) [-924.686] (-913.430) * (-923.110) (-912.173) [-915.326] (-916.241) -- 0:01:49

      Average standard deviation of split frequencies: 0.016898

      595500 -- (-912.043) (-916.055) [-912.198] (-912.225) * (-925.645) [-909.912] (-912.275) (-917.997) -- 0:01:50
      596000 -- [-910.731] (-910.606) (-917.558) (-915.689) * (-918.752) (-925.974) [-905.978] (-909.568) -- 0:01:49
      596500 -- (-918.204) (-914.801) [-914.404] (-920.639) * (-923.758) (-916.889) [-904.082] (-924.901) -- 0:01:49
      597000 -- (-920.792) [-914.723] (-925.260) (-927.110) * (-927.223) (-926.275) [-908.856] (-909.894) -- 0:01:49
      597500 -- [-911.031] (-922.254) (-907.520) (-925.646) * (-929.589) (-922.783) [-911.016] (-915.381) -- 0:01:49
      598000 -- (-913.067) [-903.017] (-914.159) (-943.097) * (-911.307) (-916.269) (-926.626) [-917.141] -- 0:01:48
      598500 -- (-914.144) (-916.547) (-914.726) [-902.163] * (-916.088) (-920.104) [-913.294] (-914.332) -- 0:01:48
      599000 -- [-906.864] (-912.408) (-914.757) (-924.482) * (-914.243) [-908.148] (-916.637) (-911.330) -- 0:01:49
      599500 -- (-925.175) (-921.548) (-924.247) [-917.224] * (-917.099) (-914.502) [-906.200] (-910.082) -- 0:01:48
      600000 -- (-930.028) (-909.958) [-913.853] (-922.069) * [-912.311] (-912.609) (-912.651) (-913.673) -- 0:01:48

      Average standard deviation of split frequencies: 0.017123

      600500 -- (-922.203) [-907.645] (-918.969) (-921.476) * (-916.086) (-915.432) (-913.724) [-907.326] -- 0:01:48
      601000 -- [-911.631] (-912.487) (-912.915) (-923.606) * (-919.633) (-923.933) (-923.811) [-904.638] -- 0:01:48
      601500 -- (-908.409) [-907.707] (-911.197) (-923.683) * (-924.192) [-906.212] (-912.113) (-919.841) -- 0:01:47
      602000 -- (-918.484) (-929.770) [-912.218] (-916.784) * (-917.752) [-906.093] (-920.773) (-915.820) -- 0:01:47
      602500 -- (-921.442) (-926.600) [-909.663] (-916.888) * (-911.820) [-912.275] (-918.400) (-928.572) -- 0:01:47
      603000 -- (-923.649) (-920.749) (-912.773) [-915.084] * [-914.771] (-919.878) (-916.868) (-923.623) -- 0:01:47
      603500 -- [-907.954] (-931.030) (-913.603) (-913.335) * (-925.083) (-907.633) [-915.500] (-926.162) -- 0:01:47
      604000 -- [-902.748] (-915.901) (-914.040) (-915.267) * (-916.543) (-916.927) [-916.536] (-923.830) -- 0:01:47
      604500 -- [-908.125] (-909.817) (-913.670) (-913.861) * (-913.561) (-915.252) [-920.511] (-933.452) -- 0:01:47
      605000 -- (-906.423) [-911.877] (-909.874) (-927.291) * (-920.762) (-920.632) [-912.236] (-928.124) -- 0:01:47

      Average standard deviation of split frequencies: 0.015487

      605500 -- [-906.919] (-911.819) (-929.299) (-921.721) * (-916.055) [-910.405] (-910.661) (-911.422) -- 0:01:46
      606000 -- [-906.212] (-924.442) (-910.819) (-913.375) * (-905.874) (-925.917) [-920.694] (-909.468) -- 0:01:46
      606500 -- (-918.667) [-916.136] (-912.739) (-920.870) * [-903.257] (-916.728) (-914.266) (-918.630) -- 0:01:47
      607000 -- [-904.141] (-927.871) (-916.223) (-917.787) * [-909.599] (-914.328) (-914.867) (-930.260) -- 0:01:46
      607500 -- [-905.134] (-928.395) (-918.442) (-914.829) * (-898.796) (-913.175) (-919.523) [-904.406] -- 0:01:46
      608000 -- [-903.769] (-920.913) (-928.097) (-915.608) * [-913.340] (-920.964) (-921.989) (-901.774) -- 0:01:46
      608500 -- [-912.103] (-918.515) (-925.798) (-914.175) * (-925.306) (-913.396) [-902.556] (-918.632) -- 0:01:46
      609000 -- (-912.537) (-912.295) [-925.594] (-916.967) * (-929.242) [-907.820] (-918.715) (-909.061) -- 0:01:45
      609500 -- (-911.640) [-913.916] (-922.775) (-929.897) * (-923.912) [-911.679] (-930.512) (-913.235) -- 0:01:45
      610000 -- (-912.887) [-918.981] (-925.069) (-915.455) * [-914.651] (-910.812) (-916.092) (-919.080) -- 0:01:46

      Average standard deviation of split frequencies: 0.015509

      610500 -- [-903.398] (-916.904) (-914.253) (-919.254) * [-910.799] (-919.662) (-918.754) (-915.682) -- 0:01:45
      611000 -- (-926.882) [-923.595] (-917.005) (-908.835) * [-906.408] (-910.305) (-918.947) (-913.049) -- 0:01:45
      611500 -- (-912.936) (-926.805) [-929.129] (-914.888) * (-912.963) (-900.904) [-904.236] (-917.045) -- 0:01:45
      612000 -- (-928.954) [-917.111] (-917.018) (-902.075) * (-918.413) (-915.851) (-909.847) [-902.496] -- 0:01:45
      612500 -- (-917.712) (-920.625) (-913.758) [-900.273] * (-930.471) [-912.098] (-911.294) (-910.576) -- 0:01:45
      613000 -- [-912.089] (-929.575) (-920.301) (-923.243) * [-911.560] (-915.036) (-929.015) (-919.525) -- 0:01:44
      613500 -- (-915.778) [-916.041] (-928.198) (-906.133) * [-907.568] (-908.222) (-929.896) (-919.113) -- 0:01:44
      614000 -- (-941.534) (-911.511) [-908.228] (-912.891) * (-927.646) [-910.291] (-929.326) (-913.063) -- 0:01:44
      614500 -- (-924.807) (-912.314) [-921.305] (-920.477) * (-917.486) (-920.421) [-914.337] (-916.440) -- 0:01:44
      615000 -- (-913.258) [-908.745] (-920.199) (-913.834) * (-922.074) (-916.557) (-923.249) [-898.039] -- 0:01:44

      Average standard deviation of split frequencies: 0.015584

      615500 -- [-911.060] (-910.071) (-917.259) (-914.339) * [-917.214] (-912.758) (-917.221) (-919.381) -- 0:01:44
      616000 -- (-925.630) (-915.410) [-914.262] (-912.857) * (-920.588) [-914.016] (-918.551) (-924.975) -- 0:01:44
      616500 -- (-917.734) (-911.673) (-922.042) [-912.066] * (-930.932) (-917.744) (-914.491) [-911.714] -- 0:01:43
      617000 -- (-920.688) (-922.764) (-926.112) [-917.349] * (-912.277) (-911.687) (-923.745) [-911.294] -- 0:01:43
      617500 -- [-920.362] (-928.593) (-918.750) (-910.028) * (-912.560) (-912.217) [-912.286] (-924.237) -- 0:01:44
      618000 -- (-926.365) [-918.587] (-920.825) (-922.781) * [-909.045] (-922.291) (-908.530) (-923.510) -- 0:01:43
      618500 -- (-916.979) [-914.768] (-911.731) (-912.605) * (-913.900) [-910.010] (-915.262) (-912.553) -- 0:01:43
      619000 -- (-919.587) [-910.386] (-908.422) (-919.183) * (-923.012) (-937.548) (-908.609) [-906.216] -- 0:01:43
      619500 -- (-919.255) [-912.301] (-914.797) (-925.785) * [-909.428] (-924.215) (-922.389) (-915.151) -- 0:01:43
      620000 -- (-921.488) (-917.190) (-929.236) [-909.656] * (-910.033) (-938.094) [-916.164] (-918.445) -- 0:01:42

      Average standard deviation of split frequencies: 0.015190

      620500 -- (-932.922) (-919.205) (-914.410) [-927.157] * (-918.865) (-930.847) (-917.097) [-915.918] -- 0:01:42
      621000 -- (-922.735) [-905.892] (-902.800) (-928.820) * [-915.367] (-939.101) (-924.206) (-914.701) -- 0:01:43
      621500 -- (-929.511) [-904.710] (-915.339) (-922.330) * (-923.702) (-944.091) [-910.600] (-913.131) -- 0:01:42
      622000 -- (-936.291) (-920.831) [-902.437] (-937.539) * (-915.036) [-920.858] (-928.589) (-914.540) -- 0:01:42
      622500 -- (-922.383) (-924.207) [-908.401] (-922.067) * [-906.270] (-931.709) (-919.959) (-914.358) -- 0:01:42
      623000 -- (-910.347) (-922.452) [-908.425] (-914.725) * (-912.484) [-919.694] (-931.699) (-913.661) -- 0:01:42
      623500 -- (-923.145) [-916.786] (-917.833) (-913.796) * (-914.601) (-918.639) (-921.141) [-906.059] -- 0:01:42
      624000 -- (-911.861) (-924.455) (-909.985) [-913.984] * [-922.035] (-921.261) (-928.138) (-913.154) -- 0:01:41
      624500 -- (-914.396) (-925.437) [-908.159] (-919.465) * [-910.987] (-933.159) (-917.272) (-917.766) -- 0:01:41
      625000 -- (-914.874) (-913.826) [-904.253] (-914.277) * [-911.900] (-910.639) (-919.686) (-922.292) -- 0:01:42

      Average standard deviation of split frequencies: 0.016088

      625500 -- (-919.564) [-909.409] (-915.736) (-933.910) * (-905.162) [-905.704] (-907.848) (-921.480) -- 0:01:41
      626000 -- (-936.944) (-914.785) [-910.796] (-917.352) * (-916.027) (-926.449) [-930.814] (-928.487) -- 0:01:41
      626500 -- (-913.012) (-930.655) (-917.826) [-924.581] * (-915.154) (-925.057) [-916.873] (-918.230) -- 0:01:41
      627000 -- [-901.729] (-909.550) (-940.586) (-921.244) * (-921.123) (-916.252) (-914.364) [-919.748] -- 0:01:41
      627500 -- [-918.238] (-922.959) (-908.961) (-928.415) * (-916.427) (-935.821) [-913.531] (-912.636) -- 0:01:40
      628000 -- (-915.440) [-907.240] (-908.507) (-921.899) * (-923.500) [-912.274] (-908.541) (-915.988) -- 0:01:40
      628500 -- (-908.490) [-917.385] (-923.274) (-916.878) * (-910.967) (-916.553) (-911.033) [-914.062] -- 0:01:41
      629000 -- (-915.679) [-913.270] (-933.964) (-923.750) * (-916.229) (-910.841) (-919.632) [-913.754] -- 0:01:40
      629500 -- [-906.126] (-917.292) (-914.215) (-929.022) * (-937.615) (-916.059) (-925.317) [-916.733] -- 0:01:40
      630000 -- (-913.856) (-913.468) [-907.420] (-931.054) * (-928.470) (-908.900) (-913.516) [-918.566] -- 0:01:40

      Average standard deviation of split frequencies: 0.015561

      630500 -- (-934.068) (-917.932) (-929.797) [-913.827] * (-903.996) [-913.330] (-910.511) (-910.295) -- 0:01:40
      631000 -- (-925.426) [-912.725] (-918.877) (-909.391) * (-914.199) (-907.084) [-909.907] (-917.959) -- 0:01:39
      631500 -- (-920.111) (-912.474) (-921.535) [-914.222] * [-913.665] (-930.494) (-915.360) (-919.504) -- 0:01:39
      632000 -- (-915.137) [-904.602] (-927.735) (-916.604) * (-910.050) (-922.882) [-913.732] (-905.127) -- 0:01:40
      632500 -- (-922.214) (-918.499) (-916.359) [-908.668] * [-910.999] (-920.952) (-921.320) (-909.631) -- 0:01:39
      633000 -- (-919.616) (-929.711) (-917.276) [-908.874] * (-916.484) (-919.426) (-920.784) [-916.457] -- 0:01:39
      633500 -- (-909.940) [-915.260] (-930.421) (-920.206) * (-911.050) (-916.214) (-921.347) [-908.928] -- 0:01:39
      634000 -- [-906.053] (-923.781) (-921.675) (-914.203) * (-921.298) (-917.923) (-918.539) [-908.396] -- 0:01:39
      634500 -- (-912.075) (-923.430) [-920.137] (-917.344) * (-911.170) (-916.998) [-919.014] (-922.540) -- 0:01:39
      635000 -- (-907.420) [-921.045] (-910.805) (-916.030) * (-921.911) [-916.106] (-914.818) (-913.112) -- 0:01:38

      Average standard deviation of split frequencies: 0.014487

      635500 -- (-909.985) (-941.773) (-925.884) [-909.940] * (-911.178) (-922.810) (-916.772) [-915.803] -- 0:01:39
      636000 -- [-905.267] (-914.615) (-914.506) (-908.583) * (-909.267) [-916.553] (-917.227) (-919.397) -- 0:01:39
      636500 -- [-909.271] (-930.384) (-913.600) (-918.489) * [-916.664] (-923.310) (-915.840) (-920.326) -- 0:01:38
      637000 -- (-907.866) (-908.006) (-917.938) [-911.662] * (-916.506) (-931.078) [-909.225] (-924.473) -- 0:01:38
      637500 -- [-908.056] (-925.209) (-920.753) (-917.666) * (-931.978) (-909.658) (-906.196) [-913.841] -- 0:01:38
      638000 -- [-912.909] (-934.023) (-924.754) (-918.587) * (-911.250) (-931.810) [-907.249] (-908.826) -- 0:01:38
      638500 -- [-905.575] (-923.403) (-910.431) (-919.113) * (-918.798) [-906.231] (-910.821) (-911.802) -- 0:01:37
      639000 -- (-910.649) (-927.916) (-923.277) [-917.548] * [-912.676] (-913.639) (-914.779) (-924.276) -- 0:01:37
      639500 -- (-914.831) (-911.656) [-925.592] (-922.189) * (-922.645) (-927.852) [-901.885] (-909.481) -- 0:01:38
      640000 -- (-932.307) (-926.825) (-924.087) [-904.495] * [-910.086] (-926.707) (-914.009) (-915.864) -- 0:01:37

      Average standard deviation of split frequencies: 0.013913

      640500 -- (-908.702) (-918.573) [-911.012] (-920.258) * [-904.560] (-924.787) (-914.548) (-916.050) -- 0:01:37
      641000 -- (-918.991) (-920.868) [-908.120] (-927.246) * (-912.303) [-904.847] (-911.724) (-921.267) -- 0:01:37
      641500 -- [-920.584] (-913.958) (-933.442) (-921.981) * (-915.825) [-906.474] (-911.523) (-916.079) -- 0:01:37
      642000 -- (-914.375) (-920.190) [-921.273] (-904.322) * (-917.845) [-916.463] (-925.333) (-918.053) -- 0:01:37
      642500 -- (-915.222) (-922.700) [-914.440] (-920.152) * [-906.913] (-914.784) (-939.184) (-929.021) -- 0:01:36
      643000 -- (-918.096) (-919.356) [-905.814] (-917.389) * [-919.071] (-915.778) (-917.571) (-934.709) -- 0:01:37
      643500 -- (-931.234) [-909.730] (-909.504) (-916.487) * (-917.520) (-911.655) (-914.258) [-919.672] -- 0:01:36
      644000 -- [-910.881] (-917.362) (-916.586) (-920.782) * (-931.305) (-929.113) (-928.250) [-910.013] -- 0:01:36
      644500 -- [-910.006] (-916.392) (-912.766) (-918.848) * [-908.592] (-920.785) (-912.931) (-921.825) -- 0:01:36
      645000 -- (-912.904) (-926.232) [-906.119] (-909.492) * [-902.326] (-910.918) (-916.340) (-913.620) -- 0:01:36

      Average standard deviation of split frequencies: 0.014064

      645500 -- (-916.077) [-919.413] (-918.682) (-912.958) * (-921.544) (-919.191) [-909.123] (-915.488) -- 0:01:36
      646000 -- (-913.089) (-926.882) [-917.480] (-908.500) * (-916.653) (-923.152) (-914.995) [-914.265] -- 0:01:35
      646500 -- (-915.760) (-916.842) (-926.410) [-915.245] * (-911.186) (-928.383) [-908.322] (-911.453) -- 0:01:36
      647000 -- (-917.278) (-930.409) (-909.064) [-913.596] * (-910.581) (-914.784) [-919.652] (-914.082) -- 0:01:36
      647500 -- (-916.111) [-913.620] (-919.391) (-922.267) * [-909.924] (-928.704) (-908.430) (-942.053) -- 0:01:35
      648000 -- (-911.942) [-910.402] (-911.992) (-925.842) * (-907.166) (-920.072) [-907.298] (-908.645) -- 0:01:35
      648500 -- [-910.000] (-919.461) (-907.944) (-915.673) * (-920.101) (-930.328) (-914.909) [-905.949] -- 0:01:35
      649000 -- [-907.885] (-913.368) (-926.199) (-927.996) * (-925.827) [-907.080] (-909.978) (-915.970) -- 0:01:35
      649500 -- (-924.471) (-902.673) (-926.340) [-916.434] * (-924.671) [-921.369] (-916.189) (-916.301) -- 0:01:34
      650000 -- [-904.908] (-918.345) (-922.899) (-907.529) * (-921.969) (-925.113) (-923.889) [-916.758] -- 0:01:34

      Average standard deviation of split frequencies: 0.013634

      650500 -- (-912.499) (-920.753) [-922.949] (-903.174) * (-927.263) [-916.200] (-921.604) (-913.094) -- 0:01:35
      651000 -- [-918.374] (-920.215) (-915.375) (-908.291) * (-936.643) [-911.753] (-911.683) (-920.658) -- 0:01:34
      651500 -- [-903.271] (-911.025) (-912.651) (-910.622) * (-921.486) [-902.134] (-926.986) (-914.120) -- 0:01:34
      652000 -- (-919.838) [-910.209] (-917.114) (-916.959) * (-937.006) (-910.218) (-911.607) [-911.279] -- 0:01:34
      652500 -- (-913.306) [-910.336] (-920.790) (-923.985) * (-939.645) (-923.455) (-912.614) [-918.915] -- 0:01:34
      653000 -- (-910.176) [-910.904] (-913.214) (-909.059) * (-941.953) (-913.725) [-917.368] (-919.172) -- 0:01:34
      653500 -- (-905.670) [-916.621] (-924.415) (-919.980) * (-935.158) (-913.689) [-915.351] (-911.714) -- 0:01:33
      654000 -- (-924.951) (-917.704) (-937.210) [-907.696] * (-932.281) (-934.398) [-907.384] (-919.887) -- 0:01:34
      654500 -- (-915.025) (-910.439) (-920.880) [-908.952] * (-947.683) [-905.696] (-909.588) (-926.382) -- 0:01:33
      655000 -- (-918.276) [-915.187] (-914.164) (-910.439) * (-930.804) [-922.885] (-924.466) (-921.252) -- 0:01:33

      Average standard deviation of split frequencies: 0.013784

      655500 -- [-905.682] (-908.642) (-925.827) (-911.035) * (-937.263) (-916.174) (-907.330) [-911.829] -- 0:01:33
      656000 -- [-912.777] (-921.446) (-909.174) (-919.464) * (-923.895) [-914.120] (-914.213) (-915.563) -- 0:01:33
      656500 -- [-915.842] (-913.415) (-917.792) (-925.362) * (-914.387) (-913.968) (-927.289) [-912.565] -- 0:01:33
      657000 -- [-911.644] (-914.368) (-922.826) (-927.736) * (-935.333) [-908.608] (-921.091) (-907.763) -- 0:01:32
      657500 -- (-915.746) (-927.537) (-932.053) [-924.719] * [-914.845] (-908.821) (-919.200) (-911.126) -- 0:01:33
      658000 -- (-912.355) [-923.810] (-927.717) (-909.074) * (-913.606) (-917.588) (-919.657) [-912.217] -- 0:01:33
      658500 -- (-916.738) (-915.842) [-908.227] (-919.746) * (-918.263) (-907.039) (-921.015) [-902.713] -- 0:01:32
      659000 -- (-917.797) (-911.598) [-913.200] (-928.439) * (-917.895) (-922.932) (-916.104) [-909.142] -- 0:01:32
      659500 -- [-921.611] (-916.756) (-940.440) (-913.253) * (-907.493) (-913.263) (-914.984) [-912.984] -- 0:01:32
      660000 -- (-913.635) (-908.408) (-918.837) [-908.245] * (-921.703) [-909.160] (-922.904) (-922.666) -- 0:01:32

      Average standard deviation of split frequencies: 0.012454

      660500 -- (-922.617) (-913.165) (-918.593) [-913.639] * (-927.541) (-915.453) (-931.640) [-908.780] -- 0:01:32
      661000 -- (-935.885) (-910.720) [-911.399] (-917.667) * [-917.526] (-921.232) (-931.653) (-920.668) -- 0:01:31
      661500 -- [-912.882] (-931.672) (-910.428) (-919.097) * [-923.849] (-906.576) (-925.886) (-916.434) -- 0:01:32
      662000 -- (-913.264) (-922.669) (-916.852) [-909.227] * (-913.957) (-916.309) [-923.696] (-915.606) -- 0:01:31
      662500 -- [-910.035] (-911.776) (-919.976) (-917.474) * [-910.723] (-911.696) (-919.213) (-921.773) -- 0:01:31
      663000 -- (-914.831) (-910.625) [-913.387] (-917.161) * (-908.949) (-913.063) (-929.683) [-913.786] -- 0:01:31
      663500 -- (-905.059) [-919.186] (-923.970) (-922.367) * [-909.977] (-919.530) (-920.971) (-926.515) -- 0:01:31
      664000 -- (-923.434) (-921.497) (-907.298) [-912.726] * (-911.382) [-901.602] (-928.445) (-923.051) -- 0:01:31
      664500 -- (-911.156) (-919.966) (-922.419) [-914.455] * (-921.989) [-914.872] (-914.056) (-919.277) -- 0:01:31
      665000 -- (-900.565) (-922.281) [-909.403] (-912.827) * (-927.497) (-918.886) [-919.890] (-925.215) -- 0:01:31

      Average standard deviation of split frequencies: 0.012483

      665500 -- (-921.535) (-930.135) (-915.014) [-912.606] * [-912.323] (-916.411) (-932.068) (-916.097) -- 0:01:30
      666000 -- [-913.585] (-922.546) (-915.451) (-919.444) * (-913.264) [-913.632] (-920.478) (-926.549) -- 0:01:30
      666500 -- (-910.480) (-923.718) (-913.108) [-906.620] * (-913.759) [-910.459] (-917.341) (-925.786) -- 0:01:30
      667000 -- [-911.395] (-909.834) (-906.822) (-913.745) * [-916.020] (-917.291) (-916.054) (-920.936) -- 0:01:30
      667500 -- (-930.550) (-919.011) (-910.011) [-910.720] * [-919.421] (-931.241) (-913.898) (-933.305) -- 0:01:30
      668000 -- (-929.423) (-911.667) (-918.445) [-913.855] * (-926.669) (-933.109) (-915.019) [-923.869] -- 0:01:30
      668500 -- (-926.095) (-913.975) (-918.304) [-910.679] * (-922.148) (-917.494) [-914.097] (-913.953) -- 0:01:30
      669000 -- [-915.112] (-915.553) (-915.248) (-922.860) * [-922.901] (-911.608) (-919.042) (-906.766) -- 0:01:30
      669500 -- [-907.738] (-916.165) (-935.882) (-917.785) * (-909.028) [-916.586] (-933.674) (-921.632) -- 0:01:29
      670000 -- [-920.964] (-919.383) (-921.246) (-913.492) * (-908.626) (-926.610) [-917.323] (-913.219) -- 0:01:29

      Average standard deviation of split frequencies: 0.011821

      670500 -- [-911.601] (-913.430) (-918.937) (-913.560) * (-910.691) (-927.527) [-917.971] (-916.436) -- 0:01:29
      671000 -- (-916.193) (-908.716) (-907.970) [-919.160] * (-915.519) (-922.985) (-916.152) [-911.311] -- 0:01:29
      671500 -- (-912.456) (-925.695) [-917.925] (-911.193) * (-925.028) [-917.064] (-913.093) (-921.888) -- 0:01:29
      672000 -- [-914.297] (-922.175) (-923.565) (-917.334) * (-909.965) (-907.208) (-921.407) [-909.376] -- 0:01:29
      672500 -- (-916.281) [-915.144] (-913.794) (-918.463) * (-920.629) (-909.849) [-910.740] (-921.865) -- 0:01:29
      673000 -- (-916.549) [-911.504] (-913.321) (-919.491) * (-908.615) [-913.117] (-926.812) (-920.031) -- 0:01:28
      673500 -- (-906.584) (-919.011) (-908.372) [-919.921] * (-920.319) (-914.925) [-915.521] (-914.699) -- 0:01:28
      674000 -- (-907.730) (-926.862) (-915.105) [-913.736] * [-908.856] (-919.990) (-918.648) (-908.915) -- 0:01:28
      674500 -- [-904.067] (-917.145) (-912.332) (-912.848) * (-915.080) (-924.473) (-908.950) [-907.993] -- 0:01:28
      675000 -- (-918.739) (-923.355) [-912.557] (-922.074) * (-922.668) (-910.103) (-922.697) [-912.185] -- 0:01:28

      Average standard deviation of split frequencies: 0.011474

      675500 -- [-908.395] (-910.632) (-919.172) (-920.665) * [-911.031] (-917.431) (-916.173) (-915.990) -- 0:01:28
      676000 -- (-928.112) [-907.814] (-924.017) (-923.225) * [-914.808] (-916.141) (-919.139) (-925.943) -- 0:01:28
      676500 -- (-927.327) [-910.876] (-912.912) (-915.001) * (-910.961) [-919.207] (-909.532) (-914.314) -- 0:01:27
      677000 -- [-919.177] (-911.705) (-912.464) (-921.330) * [-916.446] (-936.141) (-911.518) (-926.708) -- 0:01:27
      677500 -- (-914.565) (-914.779) [-919.734] (-919.352) * (-914.635) (-924.533) [-908.676] (-905.847) -- 0:01:27
      678000 -- [-910.207] (-917.726) (-928.473) (-929.232) * (-913.879) [-912.878] (-914.164) (-911.364) -- 0:01:27
      678500 -- (-907.916) (-908.182) (-919.007) [-913.778] * (-914.775) (-925.061) (-912.149) [-915.239] -- 0:01:27
      679000 -- [-912.630] (-921.598) (-914.138) (-916.184) * (-924.537) (-913.074) [-911.283] (-915.566) -- 0:01:27
      679500 -- (-904.953) [-913.631] (-907.061) (-926.562) * [-914.590] (-918.585) (-919.256) (-934.965) -- 0:01:27
      680000 -- (-922.387) (-938.342) [-911.399] (-912.981) * (-930.351) [-920.369] (-912.164) (-917.173) -- 0:01:27

      Average standard deviation of split frequencies: 0.011962

      680500 -- (-913.945) [-911.679] (-920.211) (-931.908) * (-927.641) [-909.742] (-916.597) (-912.241) -- 0:01:26
      681000 -- (-923.040) (-920.820) [-913.302] (-922.334) * (-913.884) (-931.367) [-908.764] (-918.052) -- 0:01:26
      681500 -- [-916.146] (-904.197) (-933.158) (-912.727) * (-910.167) [-908.231] (-924.314) (-930.078) -- 0:01:26
      682000 -- (-923.087) (-925.120) [-914.388] (-917.834) * (-918.653) (-921.943) (-919.148) [-905.984] -- 0:01:26
      682500 -- (-915.540) [-913.327] (-908.998) (-912.299) * (-914.671) (-913.067) [-919.598] (-915.823) -- 0:01:26
      683000 -- (-925.283) (-918.231) (-910.212) [-906.117] * (-922.196) (-916.054) (-937.624) [-901.608] -- 0:01:26
      683500 -- (-928.724) [-910.595] (-913.044) (-913.265) * [-920.965] (-919.672) (-932.247) (-919.015) -- 0:01:26
      684000 -- [-906.849] (-921.064) (-907.961) (-912.635) * (-916.879) (-920.302) (-929.181) [-914.721] -- 0:01:25
      684500 -- [-908.749] (-913.836) (-913.267) (-913.426) * [-917.078] (-911.757) (-923.366) (-911.611) -- 0:01:25
      685000 -- (-932.880) [-909.085] (-914.532) (-918.472) * (-910.116) [-912.646] (-914.359) (-914.129) -- 0:01:25

      Average standard deviation of split frequencies: 0.012369

      685500 -- (-917.214) (-916.908) [-911.562] (-922.656) * (-919.654) (-910.605) (-916.105) [-914.743] -- 0:01:25
      686000 -- [-911.855] (-923.598) (-921.825) (-922.507) * (-911.845) (-920.299) [-909.072] (-918.854) -- 0:01:25
      686500 -- [-912.447] (-912.335) (-910.285) (-917.956) * (-906.158) [-905.152] (-910.513) (-907.002) -- 0:01:25
      687000 -- (-929.773) (-927.480) [-907.840] (-909.581) * (-925.360) [-910.404] (-913.528) (-923.373) -- 0:01:25
      687500 -- (-924.634) (-906.608) [-916.621] (-917.196) * (-917.179) [-912.560] (-923.914) (-913.547) -- 0:01:25
      688000 -- (-929.985) (-915.298) (-908.655) [-908.358] * (-920.034) (-919.252) [-907.087] (-920.313) -- 0:01:24
      688500 -- (-918.374) (-915.048) [-908.762] (-921.715) * (-920.451) (-918.078) [-907.913] (-920.368) -- 0:01:24
      689000 -- (-924.293) [-921.550] (-915.437) (-925.205) * [-914.766] (-914.047) (-920.146) (-920.416) -- 0:01:24
      689500 -- [-915.859] (-913.124) (-922.360) (-926.125) * (-918.054) (-911.940) (-933.092) [-921.083] -- 0:01:24
      690000 -- (-917.778) (-917.126) [-910.527] (-920.653) * (-916.307) [-909.891] (-916.639) (-915.511) -- 0:01:24

      Average standard deviation of split frequencies: 0.012037

      690500 -- [-908.535] (-922.014) (-915.186) (-933.564) * [-907.344] (-919.673) (-909.609) (-915.027) -- 0:01:24
      691000 -- (-908.731) (-911.797) [-916.017] (-910.724) * (-922.732) [-920.983] (-922.405) (-921.025) -- 0:01:24
      691500 -- (-920.939) [-925.881] (-911.094) (-920.422) * [-908.978] (-916.527) (-916.768) (-917.024) -- 0:01:23
      692000 -- [-908.134] (-904.328) (-918.056) (-921.401) * [-912.628] (-917.156) (-928.183) (-922.417) -- 0:01:23
      692500 -- [-917.055] (-914.164) (-919.564) (-925.684) * (-912.526) [-907.672] (-920.945) (-918.316) -- 0:01:23
      693000 -- (-913.714) (-915.661) [-914.338] (-912.850) * [-908.120] (-915.918) (-932.731) (-914.969) -- 0:01:23
      693500 -- [-905.486] (-926.385) (-928.354) (-915.441) * [-912.192] (-912.787) (-924.048) (-927.451) -- 0:01:23
      694000 -- (-913.760) (-916.861) [-916.845] (-912.054) * (-908.287) [-911.919] (-916.719) (-935.253) -- 0:01:23
      694500 -- (-923.875) (-913.815) (-913.360) [-909.698] * [-909.480] (-927.439) (-924.438) (-920.368) -- 0:01:23
      695000 -- [-912.638] (-915.465) (-925.941) (-927.583) * (-923.761) (-920.792) [-911.304] (-930.639) -- 0:01:22

      Average standard deviation of split frequencies: 0.012007

      695500 -- (-914.170) (-927.911) (-912.192) [-907.635] * [-910.637] (-917.996) (-913.776) (-914.403) -- 0:01:22
      696000 -- [-904.175] (-912.510) (-917.726) (-912.908) * (-922.063) (-909.006) [-907.007] (-911.379) -- 0:01:22
      696500 -- (-916.556) (-935.177) (-927.224) [-906.128] * (-917.898) (-931.966) [-905.891] (-909.549) -- 0:01:22
      697000 -- (-915.522) (-931.705) (-914.665) [-918.142] * [-909.003] (-918.487) (-915.580) (-912.732) -- 0:01:22
      697500 -- [-918.081] (-918.455) (-917.288) (-917.155) * (-911.789) [-911.070] (-911.108) (-920.818) -- 0:01:22
      698000 -- (-915.044) [-910.166] (-921.676) (-907.601) * (-908.066) [-905.778] (-920.279) (-916.947) -- 0:01:22
      698500 -- (-910.454) (-929.488) [-907.524] (-912.205) * (-913.427) (-915.824) [-918.315] (-922.056) -- 0:01:22
      699000 -- (-917.236) (-923.032) (-916.325) [-906.833] * (-916.659) (-926.808) (-907.155) [-921.162] -- 0:01:21
      699500 -- (-924.786) (-913.546) [-908.422] (-912.555) * [-924.203] (-919.033) (-913.397) (-920.352) -- 0:01:21
      700000 -- (-909.799) [-916.365] (-924.213) (-921.348) * (-928.046) (-933.061) (-925.635) [-912.433] -- 0:01:21

      Average standard deviation of split frequencies: 0.013028

      700500 -- [-907.547] (-914.524) (-929.486) (-922.910) * (-913.874) [-904.366] (-918.118) (-916.258) -- 0:01:21
      701000 -- (-919.721) (-927.698) (-912.742) [-916.039] * [-908.554] (-920.682) (-912.078) (-923.123) -- 0:01:21
      701500 -- [-910.315] (-916.879) (-915.085) (-913.756) * (-909.137) [-917.299] (-917.730) (-911.151) -- 0:01:21
      702000 -- [-904.239] (-916.915) (-935.568) (-920.893) * [-920.007] (-917.443) (-928.622) (-922.680) -- 0:01:21
      702500 -- (-918.053) (-917.698) (-915.371) [-908.647] * [-909.984] (-916.014) (-913.504) (-910.742) -- 0:01:20
      703000 -- (-905.640) (-926.229) (-926.314) [-914.090] * (-918.342) (-914.821) [-912.152] (-921.531) -- 0:01:20
      703500 -- (-921.409) [-910.256] (-915.416) (-924.630) * [-910.501] (-912.821) (-921.559) (-919.997) -- 0:01:20
      704000 -- (-910.587) (-904.387) (-912.504) [-907.241] * (-914.280) [-915.506] (-924.036) (-918.530) -- 0:01:20
      704500 -- (-908.732) [-904.974] (-926.155) (-919.201) * (-911.761) [-905.069] (-929.573) (-930.944) -- 0:01:20
      705000 -- [-908.667] (-916.104) (-920.775) (-913.874) * [-916.021] (-908.246) (-921.289) (-918.868) -- 0:01:20

      Average standard deviation of split frequencies: 0.013415

      705500 -- (-915.630) (-914.994) [-922.294] (-914.007) * (-920.000) [-913.186] (-913.377) (-920.150) -- 0:01:20
      706000 -- (-914.418) (-919.380) (-930.700) [-919.799] * (-920.657) (-916.355) (-921.411) [-909.671] -- 0:01:19
      706500 -- [-906.644] (-930.235) (-932.443) (-923.883) * (-918.948) (-922.284) [-904.802] (-912.040) -- 0:01:19
      707000 -- (-927.697) [-911.376] (-928.062) (-923.541) * (-930.748) (-915.995) (-912.691) [-921.121] -- 0:01:19
      707500 -- (-929.168) [-914.514] (-920.648) (-918.563) * [-919.812] (-913.630) (-920.674) (-908.961) -- 0:01:19
      708000 -- (-912.458) (-909.218) [-914.770] (-928.204) * (-916.880) (-913.023) (-933.885) [-911.962] -- 0:01:19
      708500 -- (-921.413) [-907.478] (-916.361) (-910.698) * (-911.260) (-921.074) (-913.965) [-908.570] -- 0:01:19
      709000 -- [-908.368] (-922.866) (-922.589) (-910.953) * (-913.557) (-925.787) (-919.641) [-903.911] -- 0:01:19
      709500 -- [-917.289] (-919.929) (-920.954) (-925.928) * (-922.822) (-920.120) [-914.319] (-918.433) -- 0:01:19
      710000 -- [-921.453] (-916.160) (-922.107) (-922.690) * (-915.348) (-922.521) [-921.621] (-914.455) -- 0:01:18

      Average standard deviation of split frequencies: 0.011638

      710500 -- (-912.579) (-907.146) (-915.767) [-909.802] * (-904.572) (-924.686) (-918.142) [-910.898] -- 0:01:18
      711000 -- (-917.327) (-914.978) [-910.737] (-914.431) * [-908.969] (-922.660) (-905.933) (-918.410) -- 0:01:18
      711500 -- (-911.763) (-910.487) [-911.229] (-921.831) * (-930.636) (-915.516) [-911.580] (-903.894) -- 0:01:18
      712000 -- [-912.573] (-920.623) (-926.567) (-917.251) * (-921.146) (-914.925) (-924.724) [-910.272] -- 0:01:18
      712500 -- [-925.757] (-910.938) (-919.929) (-923.998) * (-923.210) (-917.707) (-908.447) [-911.110] -- 0:01:18
      713000 -- [-910.271] (-928.807) (-918.533) (-920.085) * (-920.272) (-914.702) (-915.193) [-915.730] -- 0:01:18
      713500 -- [-915.983] (-920.468) (-909.534) (-912.768) * (-917.784) [-904.665] (-927.457) (-915.948) -- 0:01:17
      714000 -- (-925.072) (-923.791) (-912.030) [-911.606] * (-923.063) (-908.082) (-929.392) [-912.281] -- 0:01:17
      714500 -- (-933.227) (-917.928) [-917.286] (-908.778) * (-916.006) (-927.196) (-909.127) [-907.134] -- 0:01:17
      715000 -- [-915.358] (-916.668) (-911.179) (-913.774) * (-924.896) (-933.349) [-912.041] (-909.207) -- 0:01:17

      Average standard deviation of split frequencies: 0.011432

      715500 -- (-919.291) (-912.015) (-922.982) [-903.740] * (-923.371) (-923.849) [-909.792] (-908.197) -- 0:01:17
      716000 -- (-919.002) [-915.641] (-916.710) (-907.239) * (-935.153) (-922.130) (-916.258) [-919.165] -- 0:01:17
      716500 -- [-903.059] (-927.298) (-911.150) (-912.219) * (-926.074) [-909.536] (-924.420) (-919.155) -- 0:01:17
      717000 -- (-922.760) (-912.367) [-906.437] (-914.683) * (-931.230) (-929.308) [-918.926] (-914.171) -- 0:01:16
      717500 -- (-933.113) (-920.720) (-916.801) [-922.355] * (-923.230) [-920.099] (-909.685) (-924.483) -- 0:01:16
      718000 -- (-927.969) (-933.717) [-918.164] (-920.714) * [-912.677] (-932.213) (-931.843) (-913.088) -- 0:01:16
      718500 -- (-914.892) (-919.597) (-925.875) [-911.622] * [-916.533] (-922.430) (-914.159) (-927.763) -- 0:01:16
      719000 -- (-908.299) [-921.250] (-920.231) (-913.216) * [-911.690] (-915.480) (-923.026) (-910.322) -- 0:01:16
      719500 -- (-922.807) (-926.009) (-919.392) [-910.027] * (-911.090) (-916.367) [-909.280] (-923.471) -- 0:01:16
      720000 -- (-926.355) (-915.542) (-922.467) [-911.095] * (-915.225) [-908.666] (-923.723) (-914.029) -- 0:01:16

      Average standard deviation of split frequencies: 0.011477

      720500 -- (-921.689) [-913.252] (-926.488) (-916.273) * [-915.955] (-912.151) (-915.494) (-912.293) -- 0:01:16
      721000 -- (-907.239) [-912.400] (-916.860) (-919.634) * (-915.649) (-900.754) [-921.042] (-922.173) -- 0:01:15
      721500 -- (-924.399) [-918.319] (-920.318) (-922.646) * (-915.739) [-903.070] (-915.910) (-909.361) -- 0:01:15
      722000 -- (-939.348) [-918.790] (-914.355) (-920.782) * [-916.299] (-917.332) (-906.673) (-912.622) -- 0:01:15
      722500 -- (-929.427) [-918.763] (-923.138) (-931.347) * (-918.760) (-913.442) (-920.669) [-912.962] -- 0:01:15
      723000 -- (-927.095) [-917.013] (-909.544) (-914.955) * (-923.002) (-922.072) (-913.583) [-908.563] -- 0:01:15
      723500 -- (-920.518) (-912.513) [-910.303] (-920.073) * (-916.769) (-900.968) (-922.092) [-906.065] -- 0:01:15
      724000 -- (-937.386) [-909.929] (-928.315) (-907.937) * (-913.509) (-920.198) (-927.619) [-920.069] -- 0:01:15
      724500 -- (-921.403) [-911.877] (-922.115) (-907.118) * (-911.374) (-918.483) (-916.706) [-911.909] -- 0:01:14
      725000 -- (-924.035) (-913.336) (-930.324) [-909.659] * (-923.735) (-913.111) (-923.639) [-913.426] -- 0:01:14

      Average standard deviation of split frequencies: 0.010684

      725500 -- (-930.197) (-911.220) (-915.858) [-907.794] * (-936.125) (-926.527) (-917.803) [-908.483] -- 0:01:14
      726000 -- (-911.538) (-920.061) (-924.244) [-913.145] * (-919.829) [-907.405] (-943.415) (-923.198) -- 0:01:14
      726500 -- (-912.764) [-919.095] (-921.865) (-903.505) * (-925.826) (-921.975) (-922.197) [-913.387] -- 0:01:14
      727000 -- [-910.119] (-921.592) (-937.394) (-906.788) * [-908.610] (-924.035) (-916.223) (-919.431) -- 0:01:14
      727500 -- (-911.398) [-910.887] (-916.397) (-917.727) * [-908.157] (-919.174) (-915.483) (-925.857) -- 0:01:14
      728000 -- [-907.100] (-929.148) (-917.899) (-918.578) * (-917.131) (-910.868) (-947.434) [-918.296] -- 0:01:13
      728500 -- [-917.381] (-927.729) (-925.428) (-943.184) * (-912.651) [-903.763] (-925.550) (-927.810) -- 0:01:13
      729000 -- (-911.487) (-908.024) [-910.354] (-939.425) * (-916.282) (-916.878) [-907.194] (-927.644) -- 0:01:13
      729500 -- (-932.615) (-910.683) [-909.914] (-908.580) * (-911.557) (-920.525) (-922.662) [-918.653] -- 0:01:13
      730000 -- (-930.509) (-909.105) (-925.544) [-910.346] * [-903.910] (-932.114) (-914.167) (-920.743) -- 0:01:13

      Average standard deviation of split frequencies: 0.009795

      730500 -- (-910.501) (-917.522) (-935.712) [-907.863] * (-918.968) [-910.771] (-925.503) (-931.026) -- 0:01:13
      731000 -- (-925.649) (-930.174) (-905.401) [-910.391] * (-930.253) (-908.519) (-913.497) [-908.226] -- 0:01:13
      731500 -- (-920.208) (-926.287) [-916.589] (-911.199) * (-925.483) [-915.657] (-911.440) (-916.030) -- 0:01:13
      732000 -- [-914.677] (-920.122) (-920.989) (-908.152) * (-923.598) (-936.134) (-919.661) [-904.764] -- 0:01:12
      732500 -- (-923.073) [-911.482] (-919.580) (-933.021) * [-908.705] (-925.804) (-924.011) (-915.506) -- 0:01:12
      733000 -- (-915.344) (-925.195) (-918.748) [-906.301] * (-916.798) (-912.476) (-925.261) [-918.963] -- 0:01:12
      733500 -- (-910.280) (-925.264) (-920.623) [-913.258] * [-910.653] (-914.637) (-923.759) (-910.772) -- 0:01:12
      734000 -- (-930.712) (-913.583) [-908.694] (-918.473) * [-911.096] (-916.240) (-911.053) (-917.936) -- 0:01:12
      734500 -- (-919.898) [-905.869] (-921.777) (-906.850) * [-905.929] (-923.307) (-914.705) (-915.098) -- 0:01:12
      735000 -- (-920.921) [-917.279] (-906.445) (-930.588) * (-909.128) (-916.128) [-909.163] (-914.091) -- 0:01:12

      Average standard deviation of split frequencies: 0.008734

      735500 -- [-918.832] (-911.226) (-905.678) (-913.862) * (-930.444) [-908.020] (-920.643) (-906.663) -- 0:01:11
      736000 -- (-913.114) [-924.517] (-914.204) (-921.040) * (-917.094) (-910.127) [-905.893] (-921.899) -- 0:01:11
      736500 -- (-921.718) (-928.812) [-921.436] (-920.570) * (-930.709) (-920.118) [-907.053] (-923.820) -- 0:01:11
      737000 -- (-923.914) (-915.440) (-924.043) [-916.414] * (-911.750) [-913.923] (-908.477) (-913.312) -- 0:01:11
      737500 -- [-909.975] (-920.664) (-921.957) (-919.548) * [-906.813] (-919.794) (-914.245) (-909.843) -- 0:01:11
      738000 -- (-918.386) [-906.548] (-927.045) (-914.536) * (-911.597) (-906.848) [-911.654] (-919.964) -- 0:01:11
      738500 -- (-908.064) [-917.667] (-926.400) (-922.066) * (-918.153) (-915.231) [-911.222] (-910.215) -- 0:01:11
      739000 -- (-919.700) (-922.146) [-906.209] (-908.985) * (-911.032) (-927.773) [-920.117] (-914.508) -- 0:01:10
      739500 -- [-911.476] (-917.636) (-908.456) (-919.825) * (-920.746) [-913.040] (-915.318) (-928.798) -- 0:01:10
      740000 -- (-931.649) (-910.625) (-913.222) [-908.450] * (-927.757) (-923.219) [-911.642] (-930.559) -- 0:01:10

      Average standard deviation of split frequencies: 0.009720

      740500 -- (-919.306) (-910.389) (-920.153) [-906.760] * (-916.079) (-916.244) [-911.204] (-925.198) -- 0:01:10
      741000 -- (-907.676) (-937.963) [-912.268] (-917.767) * (-914.310) [-908.941] (-921.630) (-927.481) -- 0:01:10
      741500 -- (-916.896) (-914.644) (-925.405) [-915.758] * (-920.397) (-911.127) (-929.384) [-921.191] -- 0:01:10
      742000 -- (-908.171) (-919.462) (-912.783) [-911.990] * (-922.265) (-920.750) [-919.778] (-924.952) -- 0:01:10
      742500 -- (-918.746) (-920.771) (-920.334) [-909.932] * (-918.840) (-919.146) [-906.943] (-916.030) -- 0:01:10
      743000 -- [-908.386] (-912.060) (-919.427) (-909.767) * (-919.368) (-912.493) [-904.714] (-926.416) -- 0:01:09
      743500 -- (-914.736) (-932.894) (-930.385) [-903.910] * (-920.005) [-925.338] (-919.672) (-910.687) -- 0:01:09
      744000 -- (-920.962) (-911.397) [-915.642] (-910.070) * (-923.209) (-923.859) [-909.326] (-917.034) -- 0:01:09
      744500 -- (-926.164) (-920.426) [-900.271] (-930.932) * [-915.833] (-920.473) (-916.110) (-909.419) -- 0:01:09
      745000 -- [-917.038] (-916.145) (-903.994) (-922.389) * [-916.716] (-911.454) (-921.409) (-914.239) -- 0:01:09

      Average standard deviation of split frequencies: 0.009421

      745500 -- (-919.430) (-923.998) (-921.799) [-916.865] * (-923.315) [-915.031] (-916.170) (-915.358) -- 0:01:09
      746000 -- (-914.465) (-919.606) (-916.788) [-903.648] * [-916.816] (-915.044) (-925.474) (-910.735) -- 0:01:09
      746500 -- [-910.490] (-933.302) (-912.843) (-929.031) * (-914.581) [-913.797] (-922.752) (-918.420) -- 0:01:08
      747000 -- (-919.253) (-933.141) [-912.046] (-922.798) * (-915.015) (-924.487) [-909.246] (-914.423) -- 0:01:08
      747500 -- (-916.812) (-927.018) [-909.821] (-928.249) * (-914.657) (-918.136) (-919.050) [-920.583] -- 0:01:08
      748000 -- (-912.789) (-919.242) [-912.020] (-933.161) * (-917.255) (-910.365) [-912.167] (-926.108) -- 0:01:08
      748500 -- [-907.638] (-926.143) (-910.663) (-930.371) * (-926.405) (-912.799) (-904.439) [-909.577] -- 0:01:08
      749000 -- (-919.173) (-916.369) (-915.626) [-908.052] * (-928.544) (-909.085) [-905.321] (-913.064) -- 0:01:08
      749500 -- (-908.064) (-914.118) (-916.056) [-921.323] * (-918.077) [-916.131] (-913.216) (-911.899) -- 0:01:08
      750000 -- [-914.120] (-915.703) (-918.639) (-909.645) * (-920.429) (-917.197) [-910.025] (-929.644) -- 0:01:08

      Average standard deviation of split frequencies: 0.008849

      750500 -- (-911.155) [-923.452] (-919.883) (-916.902) * (-919.040) (-919.369) [-913.541] (-924.387) -- 0:01:07
      751000 -- (-910.580) (-918.791) (-930.605) [-903.050] * (-950.300) [-909.808] (-919.614) (-920.269) -- 0:01:07
      751500 -- (-914.650) (-915.732) (-928.657) [-915.487] * (-923.371) (-915.653) (-915.274) [-912.438] -- 0:01:07
      752000 -- (-923.549) (-914.988) [-914.984] (-905.066) * (-945.469) (-911.594) [-907.843] (-927.888) -- 0:01:07
      752500 -- (-925.563) (-915.716) (-935.756) [-913.217] * [-907.934] (-917.323) (-921.386) (-919.308) -- 0:01:07
      753000 -- (-919.185) [-913.424] (-905.404) (-917.857) * (-911.402) (-919.338) (-920.385) [-906.767] -- 0:01:07
      753500 -- (-923.302) (-913.007) [-909.583] (-907.807) * (-912.076) [-900.542] (-909.109) (-922.611) -- 0:01:07
      754000 -- (-922.587) [-910.341] (-905.993) (-913.314) * (-920.237) [-903.921] (-911.514) (-912.322) -- 0:01:06
      754500 -- (-912.175) (-921.602) [-914.419] (-914.961) * (-916.056) (-917.160) (-919.985) [-911.627] -- 0:01:06
      755000 -- [-906.643] (-903.868) (-928.457) (-920.895) * (-917.065) [-902.833] (-918.134) (-922.985) -- 0:01:06

      Average standard deviation of split frequencies: 0.008956

      755500 -- (-922.910) (-929.627) [-915.407] (-917.542) * (-929.541) (-904.562) (-911.267) [-912.758] -- 0:01:06
      756000 -- [-923.311] (-921.255) (-916.654) (-924.508) * (-919.685) (-913.558) (-913.540) [-906.282] -- 0:01:06
      756500 -- [-914.566] (-915.329) (-917.414) (-935.019) * [-911.971] (-920.746) (-937.955) (-922.346) -- 0:01:06
      757000 -- (-909.911) (-918.750) [-924.026] (-919.769) * (-917.435) (-928.733) [-927.369] (-905.251) -- 0:01:06
      757500 -- (-912.664) (-917.410) [-909.890] (-936.795) * (-914.727) (-928.919) (-927.423) [-906.920] -- 0:01:05
      758000 -- [-913.819] (-924.930) (-917.226) (-919.291) * (-919.877) (-944.329) (-925.891) [-909.976] -- 0:01:05
      758500 -- (-923.447) (-919.753) [-913.499] (-916.208) * (-917.350) (-919.434) (-923.222) [-912.457] -- 0:01:05
      759000 -- (-915.567) (-935.027) [-904.541] (-911.426) * (-919.049) [-912.438] (-915.062) (-918.805) -- 0:01:05
      759500 -- (-921.956) (-920.841) [-910.188] (-913.581) * (-911.802) [-911.192] (-923.749) (-928.281) -- 0:01:05
      760000 -- [-915.004] (-912.461) (-914.215) (-915.596) * [-923.230] (-923.991) (-936.126) (-917.636) -- 0:01:05

      Average standard deviation of split frequencies: 0.008845

      760500 -- [-916.029] (-914.139) (-913.916) (-921.917) * (-916.729) (-926.907) [-912.320] (-907.343) -- 0:01:05
      761000 -- [-909.813] (-916.159) (-904.557) (-909.498) * (-914.738) (-919.470) (-926.023) [-919.175] -- 0:01:05
      761500 -- (-921.105) (-924.413) [-904.722] (-908.852) * [-917.135] (-910.015) (-931.031) (-916.110) -- 0:01:04
      762000 -- (-921.251) (-928.680) [-909.258] (-923.575) * (-922.882) (-915.456) (-937.866) [-916.248] -- 0:01:04
      762500 -- (-927.325) [-918.109] (-909.747) (-906.537) * [-913.865] (-921.294) (-926.006) (-920.009) -- 0:01:04
      763000 -- (-921.788) (-921.360) (-910.189) [-918.702] * (-933.368) [-906.045] (-920.883) (-915.582) -- 0:01:04
      763500 -- (-915.700) [-909.027] (-908.201) (-925.353) * (-914.961) [-901.908] (-912.918) (-912.901) -- 0:01:04
      764000 -- (-918.609) (-919.778) [-915.008] (-918.221) * [-903.742] (-922.350) (-923.135) (-918.272) -- 0:01:04
      764500 -- (-914.584) (-915.549) (-919.862) [-926.581] * (-917.497) (-930.423) (-924.192) [-907.184] -- 0:01:04
      765000 -- [-902.615] (-907.476) (-916.069) (-911.326) * (-913.776) [-917.480] (-952.377) (-926.741) -- 0:01:03

      Average standard deviation of split frequencies: 0.008504

      765500 -- (-910.318) (-939.989) [-912.582] (-925.781) * [-918.580] (-922.677) (-938.208) (-927.449) -- 0:01:03
      766000 -- (-923.901) (-916.940) (-930.895) [-912.045] * [-910.645] (-914.795) (-925.586) (-915.312) -- 0:01:03
      766500 -- [-910.140] (-904.854) (-907.850) (-927.276) * [-906.080] (-905.949) (-922.754) (-919.930) -- 0:01:03
      767000 -- (-919.445) (-931.024) [-917.466] (-914.704) * (-907.811) [-908.110] (-924.180) (-929.286) -- 0:01:03
      767500 -- (-922.211) (-911.333) (-917.141) [-915.012] * [-905.157] (-910.630) (-923.384) (-929.911) -- 0:01:03
      768000 -- [-908.388] (-923.667) (-906.080) (-914.634) * (-922.124) [-906.517] (-929.241) (-913.885) -- 0:01:03
      768500 -- [-923.002] (-924.128) (-909.457) (-925.054) * [-907.427] (-919.324) (-909.372) (-913.906) -- 0:01:02
      769000 -- (-921.771) [-913.245] (-921.068) (-924.103) * [-914.060] (-935.228) (-918.205) (-925.174) -- 0:01:02
      769500 -- (-930.550) (-916.034) [-911.723] (-910.627) * (-914.331) (-918.197) [-909.436] (-927.825) -- 0:01:02
      770000 -- (-921.848) (-923.792) [-910.696] (-908.151) * (-914.232) [-906.443] (-909.473) (-923.823) -- 0:01:02

      Average standard deviation of split frequencies: 0.008452

      770500 -- (-929.648) [-910.849] (-903.196) (-920.919) * (-914.416) (-907.936) (-913.740) [-914.997] -- 0:01:02
      771000 -- (-911.639) (-928.850) (-909.608) [-906.035] * [-913.814] (-922.915) (-911.453) (-915.767) -- 0:01:02
      771500 -- (-916.432) (-921.057) [-912.498] (-910.589) * (-916.658) [-912.470] (-905.608) (-920.306) -- 0:01:02
      772000 -- [-908.890] (-922.297) (-925.676) (-921.374) * (-911.546) (-921.749) [-916.541] (-920.119) -- 0:01:02
      772500 -- (-910.070) (-921.032) (-930.439) [-910.914] * (-919.630) (-928.547) [-910.109] (-927.409) -- 0:01:01
      773000 -- (-916.574) (-913.145) (-932.498) [-915.500] * (-918.103) (-932.685) [-910.238] (-929.901) -- 0:01:01
      773500 -- (-913.062) [-913.230] (-908.984) (-927.664) * [-905.876] (-944.525) (-926.607) (-930.220) -- 0:01:01
      774000 -- (-920.701) (-921.533) [-911.798] (-930.585) * [-921.355] (-923.987) (-935.624) (-932.248) -- 0:01:01
      774500 -- (-929.348) (-912.298) [-910.520] (-924.027) * (-910.843) (-924.244) [-910.012] (-916.801) -- 0:01:01
      775000 -- (-935.388) [-909.260] (-920.663) (-937.978) * (-917.038) (-929.807) (-915.002) [-908.754] -- 0:01:01

      Average standard deviation of split frequencies: 0.008173

      775500 -- (-925.380) (-921.039) (-924.325) [-921.222] * (-919.613) (-927.140) (-917.272) [-918.012] -- 0:01:01
      776000 -- (-919.770) (-913.314) [-909.114] (-923.410) * (-916.132) (-928.783) [-908.955] (-903.535) -- 0:01:00
      776500 -- (-925.968) [-909.219] (-921.950) (-923.358) * (-913.139) (-931.614) (-925.788) [-912.572] -- 0:01:00
      777000 -- (-921.336) [-909.931] (-914.682) (-930.535) * (-912.572) (-930.552) (-912.570) [-911.977] -- 0:01:00
      777500 -- (-929.084) [-907.668] (-915.116) (-938.339) * (-926.044) (-925.727) (-926.064) [-907.957] -- 0:01:00
      778000 -- (-936.140) (-917.689) (-904.151) [-915.436] * (-917.610) (-914.602) (-915.588) [-915.016] -- 0:01:00
      778500 -- (-928.110) (-907.698) [-927.956] (-922.130) * (-916.950) [-908.713] (-918.953) (-910.785) -- 0:01:00
      779000 -- (-940.019) (-917.273) (-909.801) [-919.898] * [-910.811] (-912.215) (-912.625) (-903.005) -- 0:01:00
      779500 -- (-941.472) (-922.063) [-911.206] (-918.027) * (-913.036) (-919.739) (-923.369) [-905.279] -- 0:00:59
      780000 -- (-933.526) [-913.766] (-925.698) (-912.925) * (-921.300) (-927.868) [-909.036] (-909.800) -- 0:00:59

      Average standard deviation of split frequencies: 0.008179

      780500 -- (-918.273) (-925.004) [-917.474] (-934.211) * (-907.816) (-912.715) (-906.901) [-917.911] -- 0:00:59
      781000 -- (-926.827) [-906.391] (-913.277) (-923.465) * (-920.644) (-921.569) [-909.545] (-907.395) -- 0:00:59
      781500 -- (-915.616) (-910.150) [-910.335] (-924.980) * (-914.363) (-916.398) [-908.659] (-905.285) -- 0:00:59
      782000 -- (-932.426) (-923.340) [-910.368] (-924.278) * (-914.684) [-914.185] (-912.226) (-915.205) -- 0:00:59
      782500 -- (-922.291) [-908.112] (-919.457) (-920.542) * [-916.764] (-928.763) (-912.245) (-917.404) -- 0:00:59
      783000 -- (-912.700) [-912.246] (-909.135) (-923.372) * [-909.254] (-933.612) (-907.996) (-916.815) -- 0:00:59
      783500 -- [-915.965] (-918.301) (-906.785) (-930.492) * (-919.915) [-905.479] (-903.057) (-920.340) -- 0:00:58
      784000 -- (-926.317) (-913.586) [-911.396] (-926.873) * (-926.276) (-922.571) (-914.218) [-902.210] -- 0:00:58
      784500 -- (-929.026) [-907.860] (-912.369) (-914.245) * (-919.658) (-921.076) [-907.255] (-911.207) -- 0:00:58
      785000 -- (-926.150) (-916.608) [-915.271] (-919.415) * (-931.550) (-923.341) (-905.937) [-913.108] -- 0:00:58

      Average standard deviation of split frequencies: 0.008287

      785500 -- (-922.266) [-922.633] (-911.706) (-914.945) * [-915.471] (-927.612) (-910.505) (-917.879) -- 0:00:58
      786000 -- (-925.195) (-917.381) (-905.369) [-907.659] * (-915.915) (-918.596) [-911.303] (-917.763) -- 0:00:58
      786500 -- (-901.484) (-922.275) (-916.195) [-905.696] * (-911.501) (-918.111) (-913.305) [-905.615] -- 0:00:58
      787000 -- (-914.090) (-934.335) [-912.963] (-924.756) * (-913.092) (-933.038) [-904.141] (-915.072) -- 0:00:57
      787500 -- (-914.275) (-919.839) [-916.918] (-915.065) * [-903.574] (-918.026) (-910.618) (-919.774) -- 0:00:57
      788000 -- [-907.236] (-913.762) (-916.446) (-912.311) * (-919.202) (-923.753) (-918.813) [-915.966] -- 0:00:57
      788500 -- (-920.303) (-927.379) [-903.341] (-923.056) * (-914.796) (-914.453) (-918.247) [-920.862] -- 0:00:57
      789000 -- (-918.296) (-918.223) [-915.365] (-909.679) * (-919.087) (-926.301) [-911.040] (-909.423) -- 0:00:57
      789500 -- (-919.042) (-929.951) [-906.941] (-911.285) * (-909.004) (-919.893) (-913.197) [-915.084] -- 0:00:57
      790000 -- (-912.680) (-911.804) [-915.087] (-926.242) * (-914.586) (-921.702) (-914.004) [-920.241] -- 0:00:57

      Average standard deviation of split frequencies: 0.008835

      790500 -- (-915.058) [-907.769] (-918.075) (-922.015) * [-907.491] (-924.545) (-913.746) (-926.723) -- 0:00:56
      791000 -- [-924.237] (-910.452) (-916.077) (-918.155) * (-921.180) (-925.429) (-914.363) [-913.869] -- 0:00:56
      791500 -- (-925.876) (-917.322) (-914.348) [-913.785] * [-909.168] (-927.194) (-911.343) (-923.345) -- 0:00:56
      792000 -- (-925.395) (-904.727) [-912.751] (-916.682) * [-924.850] (-916.977) (-915.478) (-914.557) -- 0:00:56
      792500 -- (-918.392) [-911.216] (-914.170) (-925.222) * (-924.923) (-913.751) (-924.581) [-897.449] -- 0:00:56
      793000 -- (-934.860) (-906.302) (-920.375) [-915.689] * (-915.969) (-913.886) (-913.099) [-908.902] -- 0:00:56
      793500 -- (-919.062) (-920.956) (-918.518) [-910.228] * (-917.789) [-915.630] (-923.192) (-932.680) -- 0:00:56
      794000 -- (-918.889) (-951.637) (-919.441) [-917.000] * (-920.435) [-911.726] (-914.705) (-931.479) -- 0:00:56
      794500 -- [-904.987] (-947.516) (-917.587) (-923.283) * (-915.725) [-908.342] (-911.327) (-932.984) -- 0:00:55
      795000 -- (-911.055) (-948.665) [-914.994] (-917.296) * [-909.695] (-916.868) (-912.286) (-927.429) -- 0:00:55

      Average standard deviation of split frequencies: 0.009314

      795500 -- [-904.752] (-920.959) (-918.856) (-919.928) * (-914.462) (-905.286) [-908.053] (-917.830) -- 0:00:55
      796000 -- (-915.872) (-916.029) (-923.090) [-909.527] * [-909.972] (-916.610) (-910.288) (-915.080) -- 0:00:55
      796500 -- (-922.488) (-909.697) (-928.099) [-912.608] * [-904.374] (-914.778) (-919.914) (-925.161) -- 0:00:55
      797000 -- (-916.440) (-914.275) [-909.006] (-910.909) * (-907.919) (-921.890) [-909.960] (-931.674) -- 0:00:55
      797500 -- (-928.530) (-910.273) [-909.626] (-915.187) * (-912.403) [-908.801] (-908.327) (-926.436) -- 0:00:55
      798000 -- (-922.141) (-920.221) (-926.745) [-908.609] * [-904.553] (-917.504) (-914.806) (-927.042) -- 0:00:54
      798500 -- (-945.571) [-908.169] (-914.174) (-924.215) * (-905.080) (-914.625) (-924.838) [-911.828] -- 0:00:54
      799000 -- (-941.956) (-916.568) [-919.318] (-916.730) * [-906.753] (-923.783) (-923.663) (-924.588) -- 0:00:54
      799500 -- (-907.531) (-917.669) [-906.700] (-913.536) * (-920.547) (-933.765) [-909.454] (-916.377) -- 0:00:54
      800000 -- [-901.999] (-923.909) (-910.868) (-920.095) * [-914.815] (-924.600) (-916.703) (-920.892) -- 0:00:54

      Average standard deviation of split frequencies: 0.008831

      800500 -- [-912.118] (-914.282) (-917.837) (-914.700) * (-904.892) [-909.740] (-909.740) (-929.704) -- 0:00:54
      801000 -- [-909.191] (-912.820) (-923.240) (-933.716) * [-916.642] (-919.710) (-912.332) (-912.084) -- 0:00:54
      801500 -- (-920.246) (-921.735) [-910.335] (-924.647) * (-927.525) [-914.575] (-924.082) (-922.497) -- 0:00:53
      802000 -- (-924.133) (-914.459) (-916.534) [-910.452] * [-922.519] (-913.443) (-920.008) (-928.217) -- 0:00:53
      802500 -- [-915.287] (-924.961) (-917.938) (-913.454) * (-918.230) (-918.840) [-908.736] (-924.865) -- 0:00:53
      803000 -- (-924.553) (-910.333) (-916.877) [-907.296] * (-917.016) (-921.183) [-910.296] (-925.836) -- 0:00:53
      803500 -- (-912.641) (-921.251) [-909.768] (-903.601) * (-922.005) (-933.553) (-903.377) [-921.741] -- 0:00:53
      804000 -- (-924.056) (-917.413) (-910.995) [-911.843] * (-915.274) (-918.824) [-910.413] (-932.690) -- 0:00:53
      804500 -- (-914.843) (-920.275) [-907.821] (-917.862) * (-908.099) (-934.161) [-901.237] (-930.261) -- 0:00:53
      805000 -- (-923.376) (-912.526) [-909.568] (-919.304) * (-927.472) (-922.912) [-914.327] (-928.879) -- 0:00:53

      Average standard deviation of split frequencies: 0.008879

      805500 -- (-914.366) [-916.916] (-904.382) (-928.072) * [-912.155] (-919.845) (-911.902) (-914.391) -- 0:00:52
      806000 -- [-914.978] (-916.962) (-914.566) (-924.676) * [-911.639] (-920.337) (-921.464) (-936.713) -- 0:00:52
      806500 -- (-910.675) [-921.936] (-925.353) (-917.690) * (-918.887) (-919.724) [-907.626] (-923.922) -- 0:00:52
      807000 -- [-907.827] (-924.819) (-926.349) (-907.421) * [-911.010] (-922.951) (-922.585) (-924.557) -- 0:00:52
      807500 -- [-919.253] (-914.712) (-923.546) (-906.560) * [-909.339] (-920.551) (-919.402) (-925.416) -- 0:00:52
      808000 -- (-908.824) (-907.350) (-915.836) [-921.654] * [-910.091] (-926.611) (-922.286) (-913.287) -- 0:00:52
      808500 -- (-907.331) (-916.349) (-913.334) [-908.354] * [-901.531] (-927.681) (-928.150) (-914.660) -- 0:00:52
      809000 -- (-915.265) (-907.259) (-914.661) [-914.804] * [-904.022] (-918.939) (-928.847) (-922.476) -- 0:00:51
      809500 -- (-907.776) [-908.326] (-920.753) (-906.312) * (-917.787) (-926.735) (-912.317) [-928.369] -- 0:00:51
      810000 -- (-912.740) (-918.234) (-906.044) [-910.108] * [-903.962] (-933.310) (-924.412) (-917.057) -- 0:00:51

      Average standard deviation of split frequencies: 0.008828

      810500 -- (-911.116) (-910.031) [-912.877] (-916.082) * (-941.090) [-914.774] (-920.126) (-910.775) -- 0:00:51
      811000 -- [-904.288] (-911.958) (-920.072) (-913.726) * [-914.931] (-910.931) (-922.668) (-926.297) -- 0:00:51
      811500 -- (-906.130) (-917.767) (-912.837) [-918.039] * (-908.660) (-926.441) (-915.942) [-913.152] -- 0:00:51
      812000 -- (-911.213) (-915.479) (-912.924) [-906.407] * (-912.242) [-915.002] (-908.105) (-927.154) -- 0:00:51
      812500 -- (-928.515) (-926.967) (-938.848) [-911.898] * [-918.019] (-928.084) (-914.914) (-911.219) -- 0:00:51
      813000 -- (-918.088) (-914.826) (-915.179) [-901.013] * (-916.779) (-932.371) [-920.796] (-929.195) -- 0:00:50
      813500 -- (-923.554) (-919.803) (-918.714) [-906.010] * [-914.431] (-923.410) (-913.710) (-910.055) -- 0:00:50
      814000 -- (-927.308) [-910.983] (-912.188) (-919.301) * [-911.346] (-920.095) (-903.364) (-907.177) -- 0:00:50
      814500 -- [-910.170] (-934.702) (-902.685) (-926.318) * (-921.424) (-919.296) (-910.158) [-908.301] -- 0:00:50
      815000 -- [-910.244] (-924.192) (-915.367) (-915.514) * [-913.037] (-921.357) (-903.260) (-909.680) -- 0:00:50

      Average standard deviation of split frequencies: 0.008455

      815500 -- (-919.476) [-922.974] (-929.744) (-907.669) * (-913.996) [-914.363] (-911.695) (-911.465) -- 0:00:50
      816000 -- [-909.013] (-919.566) (-912.791) (-919.308) * (-922.837) [-911.643] (-914.928) (-908.911) -- 0:00:50
      816500 -- (-924.679) (-914.492) (-905.647) [-911.674] * (-919.906) [-905.263] (-913.468) (-916.366) -- 0:00:49
      817000 -- [-918.741] (-925.261) (-919.089) (-922.567) * (-910.884) (-923.265) [-908.009] (-925.548) -- 0:00:49
      817500 -- (-918.719) (-926.790) [-905.773] (-918.399) * (-914.217) (-923.632) (-923.868) [-910.071] -- 0:00:49
      818000 -- [-911.795] (-936.012) (-921.476) (-923.478) * [-914.048] (-920.233) (-914.361) (-912.337) -- 0:00:49
      818500 -- (-911.980) (-937.169) [-914.157] (-930.587) * (-928.926) (-918.586) (-917.330) [-905.127] -- 0:00:49
      819000 -- (-912.439) (-919.288) [-909.667] (-913.870) * (-909.095) (-922.780) (-919.362) [-907.976] -- 0:00:49
      819500 -- (-920.857) [-921.483] (-914.966) (-920.011) * (-914.339) (-920.123) (-935.170) [-908.368] -- 0:00:49
      820000 -- (-913.233) (-914.264) [-918.655] (-924.084) * (-906.990) (-916.787) (-922.684) [-919.547] -- 0:00:48

      Average standard deviation of split frequencies: 0.008721

      820500 -- (-922.136) (-920.666) [-913.823] (-915.202) * (-919.107) (-934.867) (-918.708) [-911.286] -- 0:00:48
      821000 -- (-909.276) [-914.881] (-915.158) (-926.865) * [-918.434] (-925.106) (-927.330) (-912.617) -- 0:00:48
      821500 -- [-917.189] (-934.711) (-918.870) (-914.372) * [-916.153] (-915.070) (-910.784) (-915.395) -- 0:00:48
      822000 -- (-911.669) (-925.867) [-903.869] (-925.420) * [-913.629] (-925.093) (-919.722) (-906.710) -- 0:00:48
      822500 -- (-912.654) (-926.877) (-916.737) [-908.715] * (-920.667) [-910.613] (-921.473) (-908.147) -- 0:00:48
      823000 -- (-924.910) (-919.424) (-924.617) [-902.144] * (-915.812) (-922.799) [-917.808] (-922.355) -- 0:00:48
      823500 -- (-929.992) [-913.911] (-928.323) (-923.548) * [-915.293] (-926.202) (-918.447) (-912.276) -- 0:00:48
      824000 -- (-926.064) (-913.520) (-919.831) [-911.728] * [-912.606] (-930.703) (-928.680) (-919.768) -- 0:00:47
      824500 -- (-927.374) (-930.658) (-910.971) [-909.360] * [-915.568] (-918.871) (-920.301) (-908.774) -- 0:00:47
      825000 -- (-918.879) (-911.488) [-910.780] (-923.939) * [-909.295] (-922.876) (-918.739) (-913.987) -- 0:00:47

      Average standard deviation of split frequencies: 0.008820

      825500 -- [-913.335] (-915.060) (-910.662) (-929.068) * (-922.123) (-907.206) (-923.519) [-915.831] -- 0:00:47
      826000 -- (-910.244) [-908.410] (-929.756) (-923.548) * (-913.062) (-918.054) (-910.831) [-914.390] -- 0:00:47
      826500 -- [-914.868] (-911.562) (-915.456) (-930.816) * (-934.717) (-914.983) (-913.413) [-906.764] -- 0:00:47
      827000 -- (-908.931) (-919.586) [-913.841] (-931.126) * [-916.680] (-924.975) (-905.547) (-910.756) -- 0:00:47
      827500 -- (-915.999) (-928.462) (-919.798) [-927.107] * (-923.244) (-917.602) [-906.319] (-924.047) -- 0:00:46
      828000 -- (-926.076) (-929.942) (-913.986) [-915.249] * [-911.323] (-928.434) (-913.764) (-928.649) -- 0:00:46
      828500 -- (-912.981) [-904.523] (-908.674) (-925.684) * (-915.792) (-918.142) (-924.929) [-905.927] -- 0:00:46
      829000 -- (-926.863) [-915.985] (-911.909) (-908.407) * (-912.573) [-908.498] (-919.138) (-911.227) -- 0:00:46
      829500 -- (-920.452) (-908.214) (-913.387) [-906.361] * [-911.167] (-917.466) (-922.603) (-913.766) -- 0:00:46
      830000 -- (-919.381) (-904.975) (-921.674) [-908.897] * (-911.588) (-909.953) [-927.273] (-917.144) -- 0:00:46

      Average standard deviation of split frequencies: 0.008409

      830500 -- (-911.227) [-914.229] (-918.418) (-915.151) * (-922.070) [-920.101] (-919.630) (-930.174) -- 0:00:46
      831000 -- (-921.243) (-911.615) [-911.821] (-923.981) * (-913.525) (-933.645) (-921.188) [-921.849] -- 0:00:45
      831500 -- (-926.466) (-909.724) [-913.470] (-911.527) * (-913.990) [-916.579] (-927.955) (-919.010) -- 0:00:45
      832000 -- (-927.092) (-909.301) (-919.423) [-912.246] * [-910.252] (-909.868) (-919.264) (-928.013) -- 0:00:45
      832500 -- (-927.478) [-919.298] (-912.877) (-906.150) * (-911.326) [-910.555] (-935.038) (-923.780) -- 0:00:45
      833000 -- (-922.024) (-935.481) [-908.653] (-916.692) * (-915.960) (-911.560) [-918.069] (-929.360) -- 0:00:45
      833500 -- (-917.053) [-912.802] (-920.814) (-919.417) * (-920.515) [-907.996] (-923.851) (-922.557) -- 0:00:45
      834000 -- (-934.767) [-922.053] (-914.595) (-918.462) * [-909.253] (-906.091) (-917.325) (-913.565) -- 0:00:45
      834500 -- (-922.716) (-923.875) [-908.784] (-914.429) * (-924.053) (-919.218) (-923.208) [-904.956] -- 0:00:45
      835000 -- [-926.569] (-920.182) (-906.288) (-923.791) * [-923.817] (-919.402) (-929.169) (-913.457) -- 0:00:44

      Average standard deviation of split frequencies: 0.008715

      835500 -- (-915.044) (-934.165) (-920.454) [-905.257] * (-912.487) (-903.433) [-902.690] (-911.317) -- 0:00:44
      836000 -- (-921.928) (-924.953) (-915.717) [-911.651] * (-918.627) (-915.363) [-906.267] (-925.979) -- 0:00:44
      836500 -- [-904.992] (-921.939) (-917.454) (-918.143) * (-929.513) (-916.797) (-922.430) [-913.895] -- 0:00:44
      837000 -- (-922.318) [-910.520] (-914.519) (-916.604) * (-914.927) (-918.924) (-910.166) [-903.269] -- 0:00:44
      837500 -- (-911.884) [-913.795] (-927.594) (-915.938) * (-926.302) [-917.931] (-917.352) (-901.687) -- 0:00:44
      838000 -- (-910.566) [-908.080] (-914.607) (-923.624) * (-912.644) (-916.469) [-913.069] (-909.068) -- 0:00:44
      838500 -- (-921.612) (-911.269) (-916.638) [-914.396] * (-920.287) [-913.863] (-914.664) (-918.413) -- 0:00:43
      839000 -- [-920.667] (-915.834) (-924.317) (-921.285) * [-910.519] (-915.622) (-910.315) (-920.855) -- 0:00:43
      839500 -- (-918.026) [-915.425] (-920.926) (-911.051) * (-925.777) [-910.096] (-914.967) (-932.235) -- 0:00:43
      840000 -- (-919.516) (-915.074) (-920.018) [-911.659] * (-915.377) (-926.053) (-914.532) [-913.177] -- 0:00:43

      Average standard deviation of split frequencies: 0.008819

      840500 -- (-929.807) [-906.097] (-923.779) (-929.777) * [-918.029] (-913.097) (-917.474) (-937.522) -- 0:00:43
      841000 -- (-925.841) (-918.008) [-911.742] (-907.135) * (-920.319) [-918.448] (-917.805) (-927.071) -- 0:00:43
      841500 -- (-920.485) (-916.687) (-921.392) [-910.093] * (-917.131) (-916.080) [-908.454] (-913.683) -- 0:00:43
      842000 -- (-939.333) (-913.539) (-907.690) [-910.742] * (-913.796) [-910.213] (-935.593) (-916.904) -- 0:00:42
      842500 -- (-925.053) (-910.323) [-901.375] (-907.977) * (-917.124) (-921.055) [-906.735] (-936.805) -- 0:00:42
      843000 -- (-923.453) (-916.403) [-902.596] (-908.023) * (-925.515) (-908.791) [-915.476] (-911.206) -- 0:00:42
      843500 -- (-919.457) (-904.612) (-911.435) [-912.947] * (-911.024) (-915.693) (-927.366) [-914.971] -- 0:00:42
      844000 -- (-908.176) (-918.208) (-909.023) [-905.278] * (-924.808) (-914.495) (-921.871) [-912.057] -- 0:00:42
      844500 -- (-926.001) [-911.623] (-914.031) (-901.946) * [-911.615] (-910.914) (-918.543) (-924.536) -- 0:00:42
      845000 -- (-921.311) (-913.305) (-921.138) [-910.336] * (-916.482) [-920.888] (-918.763) (-914.273) -- 0:00:42

      Average standard deviation of split frequencies: 0.008358

      845500 -- [-922.366] (-901.882) (-924.624) (-922.024) * (-913.308) (-929.406) [-911.930] (-913.622) -- 0:00:42
      846000 -- (-909.573) [-906.536] (-916.175) (-914.735) * (-923.881) [-908.405] (-917.929) (-914.885) -- 0:00:41
      846500 -- (-909.319) (-923.222) (-928.195) [-906.851] * (-923.712) (-919.239) [-912.114] (-914.667) -- 0:00:41
      847000 -- [-905.958] (-933.043) (-922.924) (-922.350) * (-919.017) [-905.602] (-917.857) (-917.105) -- 0:00:41
      847500 -- [-911.918] (-928.069) (-911.903) (-913.541) * (-904.759) (-919.113) [-908.517] (-919.295) -- 0:00:41
      848000 -- (-919.655) (-913.597) (-938.508) [-907.784] * (-926.340) [-902.986] (-910.744) (-921.060) -- 0:00:41
      848500 -- (-912.932) (-915.405) (-931.247) [-910.792] * (-931.896) (-905.311) [-904.887] (-916.765) -- 0:00:41
      849000 -- (-924.011) (-911.444) [-905.922] (-908.587) * (-913.382) (-901.751) [-904.208] (-927.426) -- 0:00:41
      849500 -- (-925.114) [-916.764] (-911.903) (-932.508) * (-929.952) [-919.249] (-905.688) (-913.077) -- 0:00:40
      850000 -- (-911.714) (-917.301) (-909.461) [-909.602] * (-911.923) [-908.052] (-906.154) (-919.470) -- 0:00:40

      Average standard deviation of split frequencies: 0.008464

      850500 -- [-912.635] (-920.123) (-917.909) (-925.953) * [-912.381] (-919.624) (-924.012) (-922.946) -- 0:00:40
      851000 -- (-914.305) (-912.738) [-912.324] (-916.961) * [-915.749] (-914.664) (-918.914) (-922.387) -- 0:00:40
      851500 -- (-915.340) [-925.164] (-912.251) (-923.855) * (-910.609) (-915.656) (-922.991) [-915.576] -- 0:00:40
      852000 -- [-907.449] (-899.701) (-914.325) (-944.370) * (-922.055) (-931.081) (-914.940) [-915.109] -- 0:00:40
      852500 -- [-903.952] (-910.281) (-912.978) (-934.466) * (-931.394) (-919.485) (-918.423) [-909.357] -- 0:00:40
      853000 -- [-914.684] (-920.768) (-916.981) (-926.318) * (-926.273) (-920.425) (-912.077) [-909.828] -- 0:00:39
      853500 -- (-912.718) [-910.358] (-923.634) (-916.958) * (-910.818) (-916.041) [-912.962] (-919.133) -- 0:00:39
      854000 -- [-909.081] (-911.431) (-914.022) (-924.150) * (-912.934) [-903.366] (-909.233) (-924.956) -- 0:00:39
      854500 -- (-925.438) (-919.178) (-929.154) [-913.618] * [-913.398] (-908.441) (-929.766) (-930.691) -- 0:00:39
      855000 -- (-925.153) [-914.491] (-918.397) (-906.298) * (-930.539) (-919.035) [-915.855] (-908.100) -- 0:00:39

      Average standard deviation of split frequencies: 0.008010

      855500 -- (-923.754) (-920.333) (-913.812) [-905.035] * (-918.442) (-922.419) [-913.196] (-927.014) -- 0:00:39
      856000 -- [-907.209] (-922.761) (-909.571) (-910.829) * [-920.451] (-917.159) (-916.701) (-925.392) -- 0:00:39
      856500 -- (-918.698) (-917.295) (-925.206) [-904.509] * [-923.872] (-915.780) (-915.763) (-910.273) -- 0:00:39
      857000 -- (-926.208) (-913.864) (-912.440) [-905.151] * (-930.428) (-925.583) (-912.150) [-924.309] -- 0:00:38
      857500 -- (-919.069) (-915.591) [-911.397] (-915.627) * (-935.644) [-909.999] (-910.019) (-915.458) -- 0:00:38
      858000 -- (-929.179) [-914.988] (-928.223) (-913.834) * (-920.451) [-908.111] (-906.196) (-903.833) -- 0:00:38
      858500 -- (-924.157) (-906.827) (-910.715) [-921.380] * [-911.617] (-920.355) (-911.384) (-912.104) -- 0:00:38
      859000 -- (-916.039) [-904.962] (-916.667) (-920.883) * (-922.206) (-923.621) [-917.283] (-920.276) -- 0:00:38
      859500 -- (-916.876) [-904.599] (-921.525) (-909.748) * (-929.226) (-918.809) [-908.225] (-912.453) -- 0:00:38
      860000 -- (-922.048) (-920.100) [-914.176] (-907.349) * (-922.340) [-914.426] (-922.163) (-909.676) -- 0:00:38

      Average standard deviation of split frequencies: 0.007419

      860500 -- (-915.605) (-911.586) (-921.841) [-913.298] * (-930.222) (-920.824) [-907.664] (-922.243) -- 0:00:37
      861000 -- [-910.327] (-911.941) (-916.576) (-907.473) * (-917.458) (-924.411) (-914.917) [-913.534] -- 0:00:37
      861500 -- (-909.442) (-913.482) (-921.413) [-911.589] * (-914.966) (-918.175) (-926.324) [-912.373] -- 0:00:37
      862000 -- (-912.416) (-905.349) (-932.546) [-917.968] * (-922.543) (-914.254) (-927.666) [-901.723] -- 0:00:37
      862500 -- (-912.787) (-909.045) (-923.870) [-918.428] * (-930.485) (-919.211) (-923.206) [-914.220] -- 0:00:37
      863000 -- (-914.572) [-911.648] (-933.073) (-911.572) * (-921.696) (-920.972) [-914.524] (-918.721) -- 0:00:37
      863500 -- (-940.063) (-918.631) [-914.675] (-913.251) * (-930.607) (-918.990) [-902.858] (-915.004) -- 0:00:37
      864000 -- (-931.350) (-925.564) [-913.405] (-915.155) * (-924.486) (-925.311) (-911.814) [-907.360] -- 0:00:36
      864500 -- (-934.367) (-916.766) (-918.121) [-913.012] * (-930.823) (-930.625) (-916.742) [-906.859] -- 0:00:36
      865000 -- (-914.699) (-914.627) [-918.870] (-925.309) * (-904.210) [-910.096] (-929.502) (-914.043) -- 0:00:36

      Average standard deviation of split frequencies: 0.006829

      865500 -- [-908.948] (-910.007) (-910.045) (-939.196) * [-906.547] (-921.784) (-928.122) (-925.159) -- 0:00:36
      866000 -- (-926.831) (-914.288) [-916.724] (-924.971) * (-919.697) [-915.156] (-910.940) (-919.986) -- 0:00:36
      866500 -- [-911.189] (-912.423) (-927.297) (-915.643) * (-919.088) (-912.073) (-912.689) [-908.689] -- 0:00:36
      867000 -- [-912.159] (-922.150) (-940.489) (-902.352) * (-917.909) [-914.838] (-931.226) (-908.746) -- 0:00:36
      867500 -- (-918.033) (-926.601) (-914.453) [-907.123] * [-907.894] (-921.060) (-918.316) (-909.937) -- 0:00:36
      868000 -- (-919.205) (-926.147) [-914.414] (-911.602) * [-915.971] (-928.418) (-913.954) (-916.930) -- 0:00:36
      868500 -- [-914.932] (-929.301) (-922.368) (-920.777) * (-917.948) (-908.646) [-920.735] (-914.969) -- 0:00:35
      869000 -- (-914.274) [-914.695] (-913.098) (-922.596) * [-910.661] (-912.839) (-928.908) (-906.187) -- 0:00:35
      869500 -- [-918.053] (-917.728) (-925.748) (-911.085) * (-921.720) (-920.548) [-908.759] (-921.291) -- 0:00:35
      870000 -- [-918.965] (-922.453) (-919.463) (-914.602) * (-925.592) (-926.358) (-912.016) [-909.146] -- 0:00:35

      Average standard deviation of split frequencies: 0.006399

      870500 -- (-922.762) [-913.432] (-925.746) (-926.540) * [-913.060] (-915.214) (-945.601) (-909.227) -- 0:00:35
      871000 -- [-918.950] (-920.053) (-915.709) (-917.134) * (-928.902) (-913.541) [-908.825] (-951.180) -- 0:00:35
      871500 -- (-920.150) (-920.451) [-915.225] (-922.223) * (-922.355) [-914.300] (-911.330) (-929.739) -- 0:00:34
      872000 -- [-913.357] (-908.829) (-915.254) (-923.329) * (-906.216) (-916.898) [-905.864] (-923.060) -- 0:00:34
      872500 -- (-917.940) (-908.797) (-911.856) [-907.996] * (-916.988) (-915.248) [-917.612] (-920.119) -- 0:00:34
      873000 -- (-922.625) (-916.095) [-915.336] (-924.965) * [-912.285] (-920.238) (-916.846) (-914.785) -- 0:00:34
      873500 -- (-915.602) (-916.089) [-903.793] (-923.497) * [-909.258] (-924.789) (-911.230) (-920.638) -- 0:00:34
      874000 -- (-943.620) (-915.480) (-910.580) [-909.829] * (-913.355) [-911.657] (-924.635) (-913.313) -- 0:00:34
      874500 -- (-911.290) [-920.946] (-925.237) (-919.161) * (-923.045) [-909.229] (-910.998) (-915.627) -- 0:00:34
      875000 -- [-911.415] (-928.976) (-918.316) (-917.312) * (-914.614) (-912.261) (-916.227) [-906.876] -- 0:00:34

      Average standard deviation of split frequencies: 0.006458

      875500 -- (-921.221) (-919.750) [-920.626] (-913.062) * [-914.238] (-908.669) (-930.395) (-919.432) -- 0:00:33
      876000 -- (-911.162) (-936.465) [-908.799] (-920.652) * (-912.179) (-915.331) [-926.004] (-918.670) -- 0:00:33
      876500 -- (-916.485) (-923.723) (-911.191) [-911.119] * (-916.132) [-902.716] (-917.837) (-911.385) -- 0:00:33
      877000 -- (-923.850) [-905.229] (-913.966) (-915.134) * (-914.710) [-913.826] (-919.805) (-917.813) -- 0:00:33
      877500 -- (-927.991) (-913.336) [-901.957] (-921.010) * (-921.462) (-909.970) (-929.534) [-913.943] -- 0:00:33
      878000 -- (-936.008) [-910.805] (-916.865) (-910.960) * [-924.653] (-930.952) (-910.487) (-922.055) -- 0:00:33
      878500 -- (-941.566) (-918.981) [-913.194] (-911.810) * (-916.726) [-912.047] (-915.595) (-906.197) -- 0:00:33
      879000 -- (-929.502) [-918.098] (-930.716) (-915.384) * (-915.196) (-909.535) (-915.446) [-925.699] -- 0:00:32
      879500 -- (-912.879) [-915.895] (-918.039) (-924.032) * (-912.758) (-915.482) (-913.750) [-918.292] -- 0:00:32
      880000 -- (-910.319) (-924.605) (-913.938) [-908.734] * [-910.433] (-918.271) (-917.953) (-923.522) -- 0:00:32

      Average standard deviation of split frequencies: 0.006472

      880500 -- (-907.558) (-933.257) (-914.740) [-905.236] * (-906.992) (-910.627) [-910.078] (-908.764) -- 0:00:32
      881000 -- [-909.945] (-916.483) (-918.580) (-918.718) * (-913.734) (-918.532) (-908.935) [-910.432] -- 0:00:32
      881500 -- (-917.355) (-916.080) (-911.773) [-905.918] * (-924.731) [-906.045] (-917.541) (-911.815) -- 0:00:32
      882000 -- (-918.921) [-915.119] (-931.233) (-917.558) * (-913.747) (-908.593) (-919.956) [-917.424] -- 0:00:32
      882500 -- (-923.600) (-925.474) [-919.689] (-904.417) * (-938.327) (-914.400) [-916.493] (-917.268) -- 0:00:31
      883000 -- (-920.205) [-905.788] (-929.417) (-904.040) * [-913.512] (-911.317) (-923.678) (-923.135) -- 0:00:31
      883500 -- (-911.259) (-922.611) [-918.845] (-912.401) * (-909.309) (-926.545) (-916.667) [-908.771] -- 0:00:31
      884000 -- (-911.605) [-903.518] (-912.011) (-915.299) * (-909.985) [-915.872] (-921.968) (-908.434) -- 0:00:31
      884500 -- (-912.830) (-909.068) [-923.198] (-906.852) * (-908.921) [-926.861] (-933.273) (-914.507) -- 0:00:31
      885000 -- (-907.814) (-928.532) (-924.289) [-917.179] * [-904.180] (-924.199) (-921.461) (-916.459) -- 0:00:31

      Average standard deviation of split frequencies: 0.005659

      885500 -- (-918.651) [-906.219] (-936.655) (-927.110) * (-929.901) (-911.566) [-917.564] (-907.215) -- 0:00:31
      886000 -- (-913.220) [-908.995] (-919.412) (-934.233) * (-913.959) (-920.518) [-910.809] (-925.482) -- 0:00:31
      886500 -- [-908.297] (-917.279) (-917.012) (-921.354) * [-925.430] (-912.284) (-912.014) (-930.117) -- 0:00:30
      887000 -- [-922.771] (-928.981) (-912.265) (-920.736) * (-933.049) (-916.962) (-914.514) [-910.360] -- 0:00:30
      887500 -- (-928.331) (-920.717) [-909.901] (-928.674) * (-923.417) (-907.965) (-907.993) [-910.269] -- 0:00:30
      888000 -- [-923.842] (-913.142) (-916.810) (-935.806) * [-917.508] (-911.129) (-918.718) (-923.038) -- 0:00:30
      888500 -- [-921.275] (-914.613) (-928.131) (-928.419) * (-914.365) (-918.865) (-916.360) [-913.574] -- 0:00:30
      889000 -- (-927.941) [-913.505] (-926.434) (-915.424) * (-916.998) (-921.078) [-907.321] (-916.679) -- 0:00:30
      889500 -- (-914.159) (-919.919) [-907.721] (-931.192) * (-909.414) (-919.039) (-914.327) [-907.030] -- 0:00:30
      890000 -- (-917.707) (-912.878) [-916.781] (-933.656) * (-924.943) (-915.337) [-911.390] (-913.561) -- 0:00:29

      Average standard deviation of split frequencies: 0.005100

      890500 -- (-917.290) (-920.729) [-912.941] (-934.143) * (-917.496) [-910.065] (-912.135) (-919.641) -- 0:00:29
      891000 -- [-908.346] (-918.751) (-918.336) (-922.639) * (-928.416) [-916.230] (-918.348) (-913.388) -- 0:00:29
      891500 -- (-914.190) [-916.552] (-916.458) (-926.873) * [-924.469] (-915.406) (-915.818) (-918.298) -- 0:00:29
      892000 -- [-906.936] (-924.975) (-913.789) (-923.024) * (-911.921) (-915.668) (-928.332) [-913.639] -- 0:00:29
      892500 -- (-923.376) (-919.185) [-909.584] (-924.968) * (-912.696) [-907.640] (-928.193) (-914.390) -- 0:00:29
      893000 -- (-923.427) (-921.147) (-908.454) [-912.313] * [-911.027] (-923.452) (-927.396) (-908.369) -- 0:00:29
      893500 -- (-916.276) (-922.045) [-908.119] (-922.994) * [-915.255] (-928.985) (-917.288) (-912.779) -- 0:00:28
      894000 -- [-913.181] (-920.955) (-914.949) (-909.447) * (-923.240) (-921.283) (-911.577) [-915.114] -- 0:00:28
      894500 -- (-915.268) [-917.764] (-918.470) (-920.035) * (-909.768) [-907.979] (-931.937) (-917.535) -- 0:00:28
      895000 -- (-918.007) (-922.225) [-914.587] (-912.180) * [-918.238] (-943.993) (-914.176) (-916.448) -- 0:00:28

      Average standard deviation of split frequencies: 0.004974

      895500 -- (-907.696) (-925.823) (-909.774) [-915.448] * (-924.753) (-922.445) [-924.700] (-916.171) -- 0:00:28
      896000 -- [-916.771] (-902.877) (-915.576) (-905.432) * (-923.298) (-920.117) [-914.308] (-909.069) -- 0:00:28
      896500 -- (-919.864) [-911.408] (-919.094) (-913.122) * (-920.228) (-924.830) [-909.081] (-921.106) -- 0:00:28
      897000 -- [-915.010] (-914.284) (-919.259) (-912.291) * (-909.279) [-912.875] (-922.613) (-914.945) -- 0:00:28
      897500 -- (-915.523) (-917.806) (-911.545) [-908.238] * [-905.006] (-917.387) (-911.425) (-919.664) -- 0:00:27
      898000 -- (-916.086) (-919.403) (-909.252) [-914.598] * (-914.445) (-932.116) [-913.737] (-917.527) -- 0:00:27
      898500 -- (-909.525) (-909.779) [-907.214] (-934.298) * (-925.179) (-923.454) [-916.279] (-913.415) -- 0:00:27
      899000 -- (-912.174) (-910.799) (-921.594) [-932.910] * (-925.306) [-920.945] (-916.651) (-920.922) -- 0:00:27
      899500 -- (-919.984) [-911.519] (-918.762) (-931.579) * (-915.990) [-916.476] (-928.094) (-921.311) -- 0:00:27
      900000 -- (-921.247) (-917.175) [-920.378] (-922.335) * (-911.732) (-917.723) [-914.329] (-914.473) -- 0:00:27

      Average standard deviation of split frequencies: 0.004996

      900500 -- (-912.145) (-913.090) [-905.380] (-908.766) * (-918.996) (-913.868) (-926.288) [-912.064] -- 0:00:27
      901000 -- [-924.005] (-909.515) (-906.910) (-911.456) * (-923.141) [-905.870] (-911.013) (-918.303) -- 0:00:26
      901500 -- (-923.747) (-909.773) [-911.603] (-935.866) * (-914.206) (-915.057) [-913.678] (-930.855) -- 0:00:26
      902000 -- (-911.736) [-912.606] (-916.753) (-916.847) * (-935.535) (-918.738) (-917.911) [-911.987] -- 0:00:26
      902500 -- (-917.134) [-912.257] (-918.754) (-941.943) * (-912.551) (-919.660) (-919.749) [-914.586] -- 0:00:26
      903000 -- (-911.881) [-910.515] (-914.134) (-925.104) * [-910.709] (-907.266) (-934.779) (-914.368) -- 0:00:26
      903500 -- [-912.009] (-911.210) (-921.462) (-920.207) * (-915.282) [-913.754] (-933.422) (-909.842) -- 0:00:26
      904000 -- (-919.375) [-912.642] (-916.459) (-935.124) * [-917.824] (-929.163) (-916.995) (-913.056) -- 0:00:26
      904500 -- (-911.576) [-905.846] (-932.086) (-925.573) * (-915.887) (-923.893) (-912.036) [-909.479] -- 0:00:25
      905000 -- [-905.327] (-917.249) (-922.192) (-933.439) * [-908.561] (-921.702) (-919.302) (-914.101) -- 0:00:25

      Average standard deviation of split frequencies: 0.005014

      905500 -- (-910.334) (-929.804) [-905.043] (-925.809) * (-910.355) (-923.290) [-909.130] (-908.247) -- 0:00:25
      906000 -- (-923.100) [-906.434] (-909.803) (-924.188) * (-923.777) [-903.203] (-925.757) (-920.292) -- 0:00:25
      906500 -- (-928.322) (-916.777) (-905.589) [-910.636] * (-923.031) [-913.416] (-912.718) (-922.043) -- 0:00:25
      907000 -- (-921.944) [-905.314] (-909.513) (-917.859) * (-919.571) (-913.903) (-920.541) [-910.546] -- 0:00:25
      907500 -- [-909.090] (-906.574) (-919.158) (-915.529) * [-909.274] (-900.220) (-926.233) (-913.247) -- 0:00:25
      908000 -- (-914.755) (-907.473) (-926.504) [-917.983] * [-919.048] (-911.246) (-914.772) (-919.130) -- 0:00:25
      908500 -- (-918.982) (-913.504) (-919.144) [-919.019] * (-918.654) (-913.414) (-909.233) [-912.724] -- 0:00:24
      909000 -- (-915.292) [-908.518] (-912.783) (-913.597) * (-914.904) (-909.571) (-910.559) [-907.181] -- 0:00:24
      909500 -- (-915.172) (-921.798) (-922.505) [-913.233] * (-915.205) (-933.200) (-903.218) [-912.097] -- 0:00:24
      910000 -- (-924.986) (-905.447) [-906.500] (-917.335) * [-917.380] (-929.739) (-915.373) (-924.863) -- 0:00:24

      Average standard deviation of split frequencies: 0.004847

      910500 -- (-911.182) (-912.585) (-920.710) [-912.700] * (-920.170) (-913.808) [-910.565] (-922.716) -- 0:00:24
      911000 -- (-910.718) (-908.659) (-909.053) [-919.629] * (-909.686) (-921.853) [-909.094] (-907.235) -- 0:00:24
      911500 -- (-931.196) [-910.550] (-928.374) (-921.150) * [-909.202] (-912.279) (-905.555) (-923.053) -- 0:00:23
      912000 -- (-922.962) (-908.044) (-928.004) [-907.829] * (-914.768) (-931.028) (-918.801) [-914.090] -- 0:00:23
      912500 -- [-915.942] (-920.600) (-920.035) (-929.220) * (-920.533) (-921.805) [-908.775] (-919.420) -- 0:00:23
      913000 -- (-916.914) (-933.128) (-922.628) [-911.641] * (-924.867) [-916.272] (-922.354) (-908.535) -- 0:00:23
      913500 -- (-928.675) (-925.378) (-919.623) [-913.108] * [-913.782] (-906.273) (-914.008) (-924.641) -- 0:00:23
      914000 -- [-922.348] (-932.041) (-911.352) (-909.185) * [-905.065] (-910.883) (-902.129) (-919.977) -- 0:00:23
      914500 -- (-916.008) (-921.840) [-914.430] (-921.622) * [-912.702] (-915.907) (-920.210) (-910.187) -- 0:00:23
      915000 -- [-914.776] (-938.148) (-928.136) (-912.316) * [-900.907] (-933.161) (-911.272) (-903.092) -- 0:00:23

      Average standard deviation of split frequencies: 0.004491

      915500 -- [-909.858] (-932.093) (-908.690) (-921.925) * [-911.084] (-914.698) (-920.572) (-905.230) -- 0:00:22
      916000 -- (-923.721) (-931.181) [-914.233] (-913.309) * (-910.879) (-926.610) (-914.038) [-917.925] -- 0:00:22
      916500 -- (-919.600) (-912.365) [-914.315] (-933.344) * (-914.253) (-920.508) (-925.573) [-907.414] -- 0:00:22
      917000 -- [-907.166] (-920.032) (-914.752) (-916.278) * (-914.974) [-913.868] (-929.679) (-909.473) -- 0:00:22
      917500 -- [-925.145] (-927.285) (-941.650) (-911.940) * [-913.759] (-920.530) (-916.754) (-917.207) -- 0:00:22
      918000 -- [-914.136] (-923.280) (-927.926) (-907.900) * (-922.554) (-916.065) (-913.614) [-912.727] -- 0:00:22
      918500 -- (-907.024) (-917.421) [-921.274] (-929.977) * (-926.835) (-926.511) (-917.130) [-905.080] -- 0:00:22
      919000 -- [-907.082] (-921.775) (-917.200) (-917.314) * (-937.490) [-914.783] (-905.927) (-915.245) -- 0:00:21
      919500 -- (-913.594) [-906.292] (-920.283) (-914.229) * (-929.906) (-908.718) (-922.068) [-911.779] -- 0:00:21
      920000 -- [-910.198] (-937.734) (-929.357) (-913.461) * [-912.784] (-919.509) (-906.583) (-915.847) -- 0:00:21

      Average standard deviation of split frequencies: 0.004143

      920500 -- (-920.903) [-929.262] (-923.889) (-935.110) * (-909.506) (-910.015) [-921.081] (-909.893) -- 0:00:21
      921000 -- (-912.172) (-917.824) (-916.907) [-914.069] * (-918.590) (-933.604) [-905.716] (-916.238) -- 0:00:21
      921500 -- (-927.119) (-922.437) (-922.291) [-917.885] * (-932.759) (-914.704) (-917.584) [-917.301] -- 0:00:21
      922000 -- (-915.862) [-908.843] (-915.701) (-925.108) * [-910.602] (-918.895) (-920.785) (-920.699) -- 0:00:21
      922500 -- (-914.110) (-917.042) [-908.127] (-917.956) * [-917.290] (-922.153) (-918.151) (-909.296) -- 0:00:21
      923000 -- (-907.845) (-916.459) [-913.977] (-920.796) * (-921.020) (-906.550) [-919.459] (-927.457) -- 0:00:20
      923500 -- (-928.095) [-915.591] (-917.789) (-913.849) * (-939.942) (-914.043) (-910.170) [-918.594] -- 0:00:20
      924000 -- [-922.238] (-912.720) (-914.990) (-920.383) * (-917.250) [-906.902] (-918.731) (-926.293) -- 0:00:20
      924500 -- (-922.345) (-914.872) [-903.590] (-928.418) * (-946.078) (-916.418) (-940.192) [-911.334] -- 0:00:20
      925000 -- (-932.044) (-920.132) [-909.444] (-927.283) * (-932.392) (-908.435) (-932.389) [-919.075] -- 0:00:20

      Average standard deviation of split frequencies: 0.004350

      925500 -- (-924.443) (-917.123) [-908.901] (-923.011) * (-928.063) (-912.812) [-906.205] (-924.432) -- 0:00:20
      926000 -- [-904.088] (-911.374) (-913.758) (-911.994) * (-928.163) [-914.279] (-920.092) (-913.270) -- 0:00:20
      926500 -- (-917.102) (-934.954) [-916.095] (-916.277) * (-928.283) (-912.286) (-910.857) [-901.309] -- 0:00:19
      927000 -- [-908.736] (-914.761) (-924.523) (-915.749) * (-934.158) (-912.659) (-917.056) [-907.978] -- 0:00:19
      927500 -- (-907.240) [-916.168] (-909.470) (-919.092) * (-921.333) (-930.532) [-913.772] (-914.713) -- 0:00:19
      928000 -- (-918.948) (-919.589) [-913.533] (-920.531) * (-910.742) [-919.885] (-918.191) (-911.710) -- 0:00:19
      928500 -- (-910.001) (-911.473) [-919.437] (-925.406) * (-913.228) (-928.478) [-909.616] (-920.845) -- 0:00:19
      929000 -- (-919.933) (-925.642) (-927.273) [-907.536] * (-919.962) [-905.532] (-915.780) (-913.833) -- 0:00:19
      929500 -- [-916.202] (-915.375) (-915.428) (-921.316) * (-910.743) (-915.042) (-924.200) [-915.020] -- 0:00:19
      930000 -- (-921.646) (-924.161) (-918.325) [-915.380] * (-922.194) (-923.950) [-919.930] (-909.693) -- 0:00:18

      Average standard deviation of split frequencies: 0.004328

      930500 -- (-916.323) (-915.922) (-923.861) [-915.363] * (-929.381) (-915.582) [-911.560] (-913.212) -- 0:00:18
      931000 -- (-928.029) (-933.793) (-931.530) [-913.471] * (-919.692) (-922.848) (-904.234) [-911.749] -- 0:00:18
      931500 -- (-919.110) (-917.799) [-911.670] (-910.206) * (-927.907) (-923.668) (-911.498) [-909.456] -- 0:00:18
      932000 -- [-913.392] (-914.336) (-926.672) (-905.370) * [-912.371] (-906.632) (-917.789) (-924.150) -- 0:00:18
      932500 -- (-929.259) [-914.540] (-920.312) (-922.098) * (-917.513) (-901.913) (-923.197) [-909.757] -- 0:00:18
      933000 -- [-905.664] (-914.764) (-919.472) (-921.583) * (-922.054) [-920.716] (-925.614) (-905.498) -- 0:00:18
      933500 -- (-923.184) [-912.765] (-917.594) (-913.864) * (-920.274) [-906.993] (-918.571) (-906.821) -- 0:00:18
      934000 -- (-917.138) (-916.250) (-920.574) [-922.727] * (-923.674) [-905.159] (-913.128) (-909.704) -- 0:00:17
      934500 -- (-919.808) [-915.642] (-927.056) (-926.487) * (-929.855) [-905.234] (-919.109) (-918.639) -- 0:00:17
      935000 -- (-914.201) (-911.036) (-926.123) [-920.918] * (-915.338) (-919.993) [-922.370] (-915.508) -- 0:00:17

      Average standard deviation of split frequencies: 0.004395

      935500 -- [-919.838] (-917.736) (-912.768) (-940.888) * [-912.839] (-913.642) (-921.837) (-911.604) -- 0:00:17
      936000 -- (-911.978) (-920.213) [-926.077] (-918.253) * [-909.265] (-907.440) (-921.178) (-912.213) -- 0:00:17
      936500 -- (-922.596) (-922.446) (-921.272) [-913.303] * [-920.753] (-912.767) (-913.252) (-921.212) -- 0:00:17
      937000 -- [-922.677] (-917.825) (-919.299) (-920.772) * [-912.892] (-921.065) (-914.462) (-911.384) -- 0:00:17
      937500 -- [-909.342] (-905.289) (-914.704) (-914.055) * (-914.930) (-916.319) [-916.155] (-916.273) -- 0:00:16
      938000 -- (-914.333) (-918.466) (-922.236) [-913.853] * (-932.800) (-921.660) (-917.273) [-911.478] -- 0:00:16
      938500 -- [-911.473] (-923.682) (-924.956) (-908.289) * (-933.423) (-913.472) (-924.939) [-920.425] -- 0:00:16
      939000 -- (-906.874) (-921.709) (-912.880) [-913.883] * (-924.098) [-911.197] (-916.498) (-919.849) -- 0:00:16
      939500 -- [-913.341] (-909.206) (-917.856) (-906.841) * (-935.541) [-902.020] (-906.319) (-938.717) -- 0:00:16
      940000 -- [-918.205] (-930.549) (-912.541) (-928.172) * (-915.292) (-903.880) [-923.052] (-912.674) -- 0:00:16

      Average standard deviation of split frequencies: 0.003872

      940500 -- (-930.367) [-907.480] (-924.191) (-914.322) * (-907.887) (-923.477) [-912.043] (-910.932) -- 0:00:16
      941000 -- (-910.588) (-918.198) [-911.662] (-916.205) * (-923.232) (-930.403) (-936.365) [-912.267] -- 0:00:15
      941500 -- (-920.513) [-919.053] (-909.275) (-927.932) * [-913.824] (-921.071) (-918.391) (-917.655) -- 0:00:15
      942000 -- (-942.970) (-908.082) (-919.440) [-909.133] * (-910.216) (-910.779) [-916.648] (-927.815) -- 0:00:15
      942500 -- (-917.534) [-908.344] (-908.667) (-938.844) * (-908.395) (-906.061) [-921.114] (-922.590) -- 0:00:15
      943000 -- (-923.258) [-917.595] (-915.388) (-928.882) * (-922.260) (-917.565) [-914.447] (-919.724) -- 0:00:15
      943500 -- (-931.176) (-923.937) [-911.724] (-925.622) * (-913.209) (-913.290) [-914.294] (-910.784) -- 0:00:15
      944000 -- [-915.460] (-927.693) (-914.541) (-916.701) * (-916.284) [-911.570] (-908.689) (-922.731) -- 0:00:15
      944500 -- (-911.901) (-922.385) (-919.771) [-907.636] * (-916.324) (-913.429) (-911.750) [-919.012] -- 0:00:15
      945000 -- (-921.731) (-912.803) (-941.613) [-917.477] * (-909.667) (-910.844) [-909.067] (-923.042) -- 0:00:14

      Average standard deviation of split frequencies: 0.004304

      945500 -- (-924.845) [-914.824] (-923.444) (-908.540) * (-922.888) (-918.903) [-914.495] (-929.490) -- 0:00:14
      946000 -- (-921.527) [-907.193] (-910.937) (-927.522) * (-909.814) [-920.499] (-913.572) (-917.572) -- 0:00:14
      946500 -- (-918.030) (-924.401) [-910.126] (-907.398) * (-916.071) (-911.715) (-912.524) [-907.009] -- 0:00:14
      947000 -- [-909.396] (-927.268) (-922.299) (-919.387) * (-919.989) (-916.134) (-914.166) [-912.297] -- 0:00:14
      947500 -- [-909.511] (-928.489) (-918.358) (-933.050) * (-926.320) (-918.195) (-901.733) [-916.568] -- 0:00:14
      948000 -- [-909.494] (-922.591) (-921.276) (-928.589) * (-923.096) [-909.580] (-917.020) (-916.122) -- 0:00:14
      948500 -- [-911.515] (-922.923) (-914.567) (-926.733) * (-928.954) (-920.077) (-915.534) [-917.125] -- 0:00:13
      949000 -- (-918.297) (-921.436) (-930.224) [-929.073] * (-914.621) (-922.846) (-925.684) [-914.163] -- 0:00:13
      949500 -- [-916.789] (-912.186) (-914.067) (-917.988) * (-917.770) (-911.853) [-913.702] (-917.869) -- 0:00:13
      950000 -- (-915.364) (-914.175) (-922.058) [-912.035] * (-914.009) [-910.277] (-921.176) (-912.971) -- 0:00:13

      Average standard deviation of split frequencies: 0.004463

      950500 -- (-912.287) (-911.089) (-915.925) [-909.551] * [-909.066] (-907.677) (-931.249) (-912.634) -- 0:00:13
      951000 -- (-912.904) [-912.753] (-909.802) (-906.674) * (-913.752) [-914.765] (-918.698) (-921.489) -- 0:00:13
      951500 -- (-912.798) (-911.274) [-914.310] (-923.812) * (-924.436) (-918.332) (-919.086) [-903.724] -- 0:00:13
      952000 -- (-913.164) (-926.547) [-910.544] (-916.819) * (-924.364) (-914.539) [-909.098] (-910.355) -- 0:00:12
      952500 -- (-924.298) (-912.136) [-907.468] (-912.681) * [-927.041] (-936.002) (-916.812) (-920.403) -- 0:00:12
      953000 -- (-928.285) (-901.759) [-907.270] (-924.911) * (-939.559) (-930.705) (-925.105) [-916.439] -- 0:00:12
      953500 -- (-912.278) [-908.057] (-927.965) (-917.916) * (-930.463) [-913.676] (-902.175) (-915.868) -- 0:00:12
      954000 -- [-913.290] (-910.213) (-923.112) (-915.238) * (-922.744) (-909.316) (-913.984) [-912.785] -- 0:00:12
      954500 -- (-916.849) (-902.819) (-911.600) [-910.360] * (-914.194) (-918.833) (-921.404) [-912.411] -- 0:00:12
      955000 -- (-920.409) [-914.699] (-929.658) (-909.652) * (-925.027) [-906.898] (-906.947) (-926.535) -- 0:00:12

      Average standard deviation of split frequencies: 0.003990

      955500 -- (-913.217) (-913.330) (-911.815) [-910.719] * (-912.359) (-905.185) (-919.549) [-909.021] -- 0:00:12
      956000 -- [-911.512] (-906.107) (-926.191) (-910.042) * (-917.278) [-917.840] (-923.721) (-925.962) -- 0:00:11
      956500 -- [-919.580] (-910.556) (-914.364) (-928.556) * (-918.224) (-918.048) [-905.301] (-924.213) -- 0:00:11
      957000 -- (-907.878) (-910.566) [-908.474] (-927.380) * (-933.217) [-912.584] (-917.115) (-915.919) -- 0:00:11
      957500 -- [-904.636] (-912.432) (-919.032) (-923.047) * (-916.852) (-913.284) (-919.773) [-908.648] -- 0:00:11
      958000 -- (-929.484) (-913.335) (-916.993) [-916.190] * [-910.988] (-918.769) (-915.221) (-922.034) -- 0:00:11
      958500 -- (-919.198) (-923.243) [-915.674] (-925.776) * (-908.491) (-920.006) [-911.775] (-922.867) -- 0:00:11
      959000 -- [-913.864] (-917.172) (-919.960) (-917.972) * (-909.718) [-910.206] (-911.347) (-922.836) -- 0:00:11
      959500 -- (-913.920) (-927.622) (-917.834) [-918.789] * (-898.933) [-914.844] (-906.439) (-919.385) -- 0:00:10
      960000 -- [-910.620] (-915.110) (-917.592) (-909.304) * [-908.463] (-914.060) (-912.247) (-927.223) -- 0:00:10

      Average standard deviation of split frequencies: 0.004015

      960500 -- (-926.290) (-916.751) [-907.750] (-919.016) * (-922.749) (-920.122) (-910.433) [-912.589] -- 0:00:10
      961000 -- [-912.878] (-916.094) (-915.581) (-912.259) * (-917.125) (-912.916) (-920.314) [-913.625] -- 0:00:10
      961500 -- (-920.303) [-909.526] (-911.317) (-920.405) * (-915.876) [-925.548] (-913.587) (-908.029) -- 0:00:10
      962000 -- (-927.182) (-931.764) (-919.267) [-913.438] * (-911.208) (-905.438) [-907.499] (-914.286) -- 0:00:10
      962500 -- (-930.171) [-919.564] (-922.051) (-914.442) * (-924.437) (-916.146) (-931.512) [-906.078] -- 0:00:10
      963000 -- (-929.241) (-913.686) [-915.263] (-917.350) * (-918.264) (-927.331) [-922.051] (-916.381) -- 0:00:09
      963500 -- (-917.040) (-924.322) (-919.334) [-907.929] * (-923.049) (-918.330) (-919.105) [-914.941] -- 0:00:09
      964000 -- (-920.869) (-917.230) [-924.604] (-910.550) * (-917.896) (-921.224) [-914.990] (-921.009) -- 0:00:09
      964500 -- (-922.909) (-913.366) [-917.987] (-921.825) * (-917.556) (-926.882) (-914.599) [-912.432] -- 0:00:09
      965000 -- (-918.596) (-918.765) [-914.213] (-918.008) * [-905.515] (-914.434) (-920.451) (-916.472) -- 0:00:09

      Average standard deviation of split frequencies: 0.004791

      965500 -- (-918.944) (-910.356) [-906.588] (-926.238) * (-912.874) (-913.283) [-909.931] (-911.088) -- 0:00:09
      966000 -- [-913.191] (-908.052) (-919.694) (-906.485) * [-916.111] (-923.042) (-914.823) (-922.634) -- 0:00:09
      966500 -- [-906.479] (-916.528) (-919.036) (-916.750) * (-921.974) [-906.368] (-910.123) (-915.824) -- 0:00:09
      967000 -- (-919.454) [-920.814] (-914.987) (-935.843) * (-914.636) [-914.753] (-917.541) (-924.362) -- 0:00:08
      967500 -- (-915.278) [-911.004] (-935.670) (-949.209) * [-915.746] (-925.309) (-914.375) (-917.763) -- 0:00:08
      968000 -- (-924.785) (-908.417) (-916.018) [-903.672] * (-924.850) (-929.982) [-919.163] (-923.270) -- 0:00:08
      968500 -- (-911.651) (-926.099) (-914.904) [-904.852] * [-928.230] (-927.084) (-905.950) (-942.329) -- 0:00:08
      969000 -- (-915.366) (-908.346) (-909.186) [-917.378] * (-940.638) [-912.735] (-921.598) (-922.041) -- 0:00:08
      969500 -- (-906.788) (-919.346) (-916.403) [-906.796] * (-925.591) (-926.669) (-927.756) [-907.557] -- 0:00:08
      970000 -- [-922.012] (-927.328) (-917.126) (-919.419) * (-917.974) (-918.591) (-914.072) [-913.819] -- 0:00:08

      Average standard deviation of split frequencies: 0.005430

      970500 -- [-917.579] (-921.844) (-911.841) (-912.331) * (-913.229) (-912.644) [-915.486] (-928.956) -- 0:00:07
      971000 -- (-916.471) (-929.052) (-906.344) [-910.481] * (-923.600) (-922.670) (-912.377) [-911.722] -- 0:00:07
      971500 -- (-914.485) [-911.047] (-913.254) (-913.498) * (-930.554) (-926.076) [-923.463] (-915.148) -- 0:00:07
      972000 -- (-921.995) (-917.995) (-917.230) [-908.910] * (-917.371) (-919.622) [-907.396] (-908.438) -- 0:00:07
      972500 -- (-924.781) (-925.647) (-909.805) [-913.543] * (-913.918) (-921.257) [-915.304] (-915.714) -- 0:00:07
      973000 -- (-917.535) (-911.670) [-902.255] (-927.743) * (-909.943) (-910.846) [-914.103] (-928.782) -- 0:00:07
      973500 -- [-923.474] (-922.020) (-905.667) (-936.891) * (-917.359) [-912.682] (-911.735) (-918.333) -- 0:00:07
      974000 -- (-923.337) (-919.555) (-906.581) [-910.636] * (-919.313) [-911.153] (-915.269) (-913.034) -- 0:00:07
      974500 -- (-923.269) (-923.273) [-913.150] (-916.578) * [-906.265] (-908.409) (-916.498) (-913.930) -- 0:00:06
      975000 -- (-921.329) (-922.291) [-929.303] (-924.424) * (-925.050) (-910.536) [-908.595] (-922.022) -- 0:00:06

      Average standard deviation of split frequencies: 0.005533

      975500 -- (-920.939) (-920.343) (-929.263) [-909.352] * (-916.749) (-907.140) (-924.579) [-906.043] -- 0:00:06
      976000 -- (-926.556) [-908.212] (-927.442) (-917.711) * (-925.016) [-908.962] (-920.915) (-914.896) -- 0:00:06
      976500 -- (-919.756) [-911.944] (-930.307) (-914.587) * (-916.706) (-925.931) (-928.398) [-916.386] -- 0:00:06
      977000 -- (-920.815) (-911.298) (-928.716) [-911.743] * [-909.696] (-928.741) (-922.834) (-905.647) -- 0:00:06
      977500 -- [-922.199] (-912.733) (-919.458) (-913.495) * [-902.557] (-917.219) (-928.651) (-912.508) -- 0:00:06
      978000 -- [-912.781] (-920.966) (-930.408) (-913.534) * (-905.573) [-906.928] (-929.591) (-909.290) -- 0:00:05
      978500 -- (-920.446) (-926.085) (-925.308) [-904.971] * (-913.428) [-915.704] (-924.704) (-923.837) -- 0:00:05
      979000 -- (-930.166) (-914.009) [-920.004] (-919.062) * (-924.769) (-923.189) (-913.738) [-915.660] -- 0:00:05
      979500 -- (-919.556) (-913.150) (-906.255) [-920.977] * [-909.036] (-915.512) (-920.994) (-912.892) -- 0:00:05
      980000 -- (-903.747) [-908.498] (-916.173) (-923.054) * (-908.248) (-917.881) (-926.807) [-920.559] -- 0:00:05

      Average standard deviation of split frequencies: 0.006336

      980500 -- [-912.065] (-914.803) (-914.839) (-921.701) * (-914.123) [-916.484] (-920.283) (-918.145) -- 0:00:05
      981000 -- (-914.985) (-931.265) (-924.711) [-915.956] * [-913.462] (-915.122) (-936.915) (-917.374) -- 0:00:05
      981500 -- (-914.042) (-917.338) [-908.350] (-918.652) * [-908.443] (-908.196) (-935.506) (-929.079) -- 0:00:04
      982000 -- (-913.610) (-923.896) [-915.364] (-915.880) * (-913.078) [-917.369] (-934.483) (-913.764) -- 0:00:04
      982500 -- (-912.087) (-923.061) (-907.607) [-903.593] * [-912.730] (-929.117) (-916.522) (-927.151) -- 0:00:04
      983000 -- (-907.189) [-915.534] (-915.433) (-915.673) * [-906.261] (-921.312) (-923.675) (-928.194) -- 0:00:04
      983500 -- (-921.915) (-915.151) [-918.218] (-907.840) * (-925.391) (-919.939) (-912.915) [-916.014] -- 0:00:04
      984000 -- (-924.488) (-911.679) [-913.747] (-915.628) * (-929.798) (-924.357) (-909.189) [-909.217] -- 0:00:04
      984500 -- [-908.213] (-920.142) (-908.738) (-922.355) * [-911.694] (-925.414) (-922.930) (-910.700) -- 0:00:04
      985000 -- (-914.444) [-910.426] (-913.213) (-922.954) * [-907.367] (-921.944) (-906.025) (-921.672) -- 0:00:04

      Average standard deviation of split frequencies: 0.005433

      985500 -- [-909.221] (-920.528) (-916.128) (-931.228) * (-919.049) (-920.808) [-898.733] (-923.659) -- 0:00:03
      986000 -- (-912.865) (-912.874) (-922.249) [-918.024] * (-911.087) (-921.034) (-914.999) [-912.493] -- 0:00:03
      986500 -- [-913.328] (-912.940) (-919.257) (-923.440) * [-907.333] (-922.127) (-911.433) (-920.104) -- 0:00:03
      987000 -- (-915.606) [-905.636] (-937.911) (-912.235) * [-911.114] (-937.749) (-921.566) (-919.069) -- 0:00:03
      987500 -- (-920.986) [-914.487] (-914.798) (-914.130) * (-926.840) (-926.744) [-907.094] (-913.800) -- 0:00:03
      988000 -- [-919.286] (-911.875) (-914.260) (-921.390) * (-923.559) (-925.586) (-912.925) [-915.132] -- 0:00:03
      988500 -- (-919.531) (-914.316) (-913.763) [-914.866] * (-918.962) [-914.680] (-915.392) (-921.460) -- 0:00:03
      989000 -- (-920.745) (-915.592) [-911.222] (-926.843) * (-918.840) (-912.713) (-913.603) [-911.484] -- 0:00:02
      989500 -- (-925.802) (-913.733) [-915.018] (-926.477) * (-921.130) (-906.427) [-910.248] (-912.170) -- 0:00:02
      990000 -- [-907.506] (-926.407) (-919.475) (-923.556) * (-913.959) (-928.703) [-910.413] (-926.466) -- 0:00:02

      Average standard deviation of split frequencies: 0.006099

      990500 -- (-912.399) (-942.164) [-905.534] (-909.917) * (-920.972) [-903.168] (-913.016) (-920.555) -- 0:00:02
      991000 -- (-914.349) (-918.253) (-910.375) [-916.857] * (-931.736) (-909.454) [-911.297] (-930.384) -- 0:00:02
      991500 -- (-915.236) (-930.148) [-907.706] (-919.938) * (-922.206) [-903.067] (-934.452) (-925.660) -- 0:00:02
      992000 -- (-925.357) [-915.615] (-917.236) (-919.578) * (-933.183) [-907.514] (-930.925) (-919.688) -- 0:00:02
      992500 -- (-918.646) (-922.538) [-930.718] (-916.082) * [-920.336] (-914.696) (-930.588) (-925.815) -- 0:00:02
      993000 -- [-914.786] (-918.233) (-912.963) (-929.126) * (-922.963) (-917.814) [-910.555] (-921.911) -- 0:00:01
      993500 -- (-917.094) (-924.332) (-918.647) [-910.872] * (-921.131) (-908.587) [-905.694] (-927.043) -- 0:00:01
      994000 -- (-915.673) (-935.774) [-918.342] (-914.174) * (-916.673) [-906.985] (-919.887) (-908.614) -- 0:00:01
      994500 -- (-921.872) (-929.686) [-909.583] (-921.742) * (-917.468) (-901.683) [-909.570] (-928.475) -- 0:00:01
      995000 -- (-919.217) (-949.936) [-912.817] (-927.899) * [-915.933] (-915.438) (-918.737) (-924.168) -- 0:00:01

      Average standard deviation of split frequencies: 0.006239

      995500 -- [-916.578] (-929.606) (-922.657) (-926.104) * (-915.180) [-904.123] (-912.241) (-921.061) -- 0:00:01
      996000 -- [-909.639] (-922.585) (-931.535) (-914.548) * (-933.859) (-914.160) [-922.878] (-921.155) -- 0:00:01
      996500 -- (-912.092) (-932.506) (-928.931) [-911.812] * (-923.186) [-907.331] (-925.331) (-918.687) -- 0:00:00
      997000 -- (-909.149) [-913.779] (-910.705) (-929.628) * (-924.300) (-916.641) [-906.107] (-917.439) -- 0:00:00
      997500 -- (-906.050) (-927.269) [-908.610] (-916.253) * (-927.482) [-908.616] (-932.603) (-916.482) -- 0:00:00
      998000 -- [-907.449] (-916.292) (-908.752) (-908.457) * (-920.512) (-920.845) [-907.722] (-918.502) -- 0:00:00
      998500 -- (-913.750) (-925.235) [-916.493] (-916.488) * (-920.544) (-912.573) [-901.846] (-922.415) -- 0:00:00
      999000 -- (-924.265) [-915.667] (-923.677) (-907.626) * (-909.911) (-922.207) (-916.222) [-912.571] -- 0:00:00
      999500 -- (-918.011) [-912.711] (-919.174) (-917.886) * (-924.319) [-913.786] (-928.357) (-924.199) -- 0:00:00
      1000000 -- (-917.915) (-920.560) [-915.113] (-926.894) * [-914.267] (-915.901) (-923.592) (-907.629) -- 0:00:00

      Average standard deviation of split frequencies: 0.005910
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -917.915406 -- 24.492881
         Chain 1 -- -917.915408 -- 24.492881
         Chain 2 -- -920.559844 -- 28.610797
         Chain 2 -- -920.559838 -- 28.610797
         Chain 3 -- -915.112842 -- 24.862514
         Chain 3 -- -915.112842 -- 24.862514
         Chain 4 -- -926.893646 -- 26.810326
         Chain 4 -- -926.893644 -- 26.810326
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -914.266555 -- 27.829351
         Chain 1 -- -914.266569 -- 27.829351
         Chain 2 -- -915.901394 -- 27.886645
         Chain 2 -- -915.901392 -- 27.886645
         Chain 3 -- -923.591697 -- 27.994892
         Chain 3 -- -923.591711 -- 27.994892
         Chain 4 -- -907.629427 -- 27.639980
         Chain 4 -- -907.629438 -- 27.639980

      Analysis completed in 4 mins 30 seconds
      Analysis used 269.20 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -896.25
      Likelihood of best state for "cold" chain of run 2 was -896.25

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            43.2 %     ( 34 %)     Dirichlet(Revmat{all})
            69.0 %     ( 50 %)     Slider(Revmat{all})
            33.4 %     ( 30 %)     Dirichlet(Pi{all})
            33.7 %     ( 24 %)     Slider(Pi{all})
            59.7 %     ( 25 %)     Multiplier(Alpha{1,2})
            47.6 %     ( 29 %)     Multiplier(Alpha{3})
            66.5 %     ( 32 %)     Slider(Pinvar{all})
            63.5 %     ( 59 %)     ExtSPR(Tau{all},V{all})
            24.5 %     ( 24 %)     ExtTBR(Tau{all},V{all})
            67.3 %     ( 65 %)     NNI(Tau{all},V{all})
            52.1 %     ( 43 %)     ParsSPR(Tau{all},V{all})
            27.4 %     ( 27 %)     Multiplier(V{all})
            58.6 %     ( 64 %)     Nodeslider(V{all})
            25.9 %     ( 29 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            44.0 %     ( 25 %)     Dirichlet(Revmat{all})
            69.2 %     ( 63 %)     Slider(Revmat{all})
            32.6 %     ( 29 %)     Dirichlet(Pi{all})
            33.1 %     ( 21 %)     Slider(Pi{all})
            59.8 %     ( 18 %)     Multiplier(Alpha{1,2})
            48.2 %     ( 24 %)     Multiplier(Alpha{3})
            66.5 %     ( 49 %)     Slider(Pinvar{all})
            63.5 %     ( 62 %)     ExtSPR(Tau{all},V{all})
            24.6 %     ( 23 %)     ExtTBR(Tau{all},V{all})
            67.8 %     ( 67 %)     NNI(Tau{all},V{all})
            52.2 %     ( 45 %)     ParsSPR(Tau{all},V{all})
            27.4 %     ( 25 %)     Multiplier(V{all})
            58.6 %     ( 57 %)     Nodeslider(V{all})
            26.3 %     ( 28 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.69    0.44    0.26 
         2 |  167134            0.71    0.46 
         3 |  167058  166402            0.72 
         4 |  166394  166219  166793         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.69    0.44    0.26 
         2 |  166163            0.71    0.46 
         3 |  166326  166129            0.72 
         4 |  166889  167057  167436         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -909.69
      | 2                                    2                     |
      | 1       2                  2  2         22                2|
      |                     2                 1       1            |
      |      1                                    2              2 |
      |   212   1 1   1  11      11  1                 12          |
      |    2  2      2 1     1   22            2  1 1      *       |
      |                 2     1    1     121       1  2  1     1   |
      |1    1     2                 *     12       2 2       2 2   |
      |          1 21  2                                    2      |
      |             2      *  2 *     11 2  21 1 1  21 2           |
      |2 21  21    1 1   22  2 2       21       1             1 11 |
      |  1     1      2                       2                 2  |
      |          2             1                        1 *       1|
      |        2        1               2   1                 2    |
      |                     1        2                   2  11     |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -914.54
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -904.27          -925.97
        2       -903.63          -927.56
      --------------------------------------
      TOTAL     -903.90          -927.05
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.639004    0.015990    0.419493    0.906505    0.625473   1348.01   1390.82    1.000
      r(A<->C){all}   0.018753    0.000276    0.000001    0.052068    0.013718    831.05    882.49    1.000
      r(A<->G){all}   0.230001    0.006063    0.089098    0.377989    0.218540    446.76    450.49    1.000
      r(A<->T){all}   0.036823    0.000523    0.000011    0.079758    0.032966    665.85    721.72    1.000
      r(C<->G){all}   0.009590    0.000093    0.000009    0.029294    0.006596    707.32    805.62    1.000
      r(C<->T){all}   0.683478    0.006952    0.508932    0.829203    0.693081    461.91    471.71    1.000
      r(G<->T){all}   0.021355    0.000200    0.000300    0.049219    0.018235    635.30    775.41    1.000
      pi(A){all}      0.243873    0.000431    0.204210    0.283840    0.243135   1097.04   1176.01    1.000
      pi(C){all}      0.216653    0.000377    0.177427    0.254164    0.216464   1185.07   1226.07    1.000
      pi(G){all}      0.311179    0.000510    0.267705    0.354263    0.311046   1228.84   1276.25    1.001
      pi(T){all}      0.228295    0.000374    0.192951    0.268616    0.227818   1202.69   1289.14    1.000
      alpha{1,2}      0.059861    0.001397    0.000124    0.121779    0.058562   1035.93   1208.68    1.003
      alpha{3}        2.104398    0.644336    0.770742    3.624669    1.975276   1501.00   1501.00    1.000
      pinvar{all}     0.307640    0.010609    0.089628    0.493936    0.314192    880.18    965.54    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8
      9 -- C9
     10 -- C10
     11 -- C11
     12 -- C12
     13 -- C13
     14 -- C14

   Key to taxon bipartitions (saved to file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   --------------------
    1 -- .*************
    2 -- .*............
    3 -- ..*...........
    4 -- ...*..........
    5 -- ....*.........
    6 -- .....*........
    7 -- ......*.......
    8 -- .......*......
    9 -- ........*.....
   10 -- .........*....
   11 -- ..........*...
   12 -- ...........*..
   13 -- ............*.
   14 -- .............*
   15 -- .*.*..........
   16 -- ....**........
   17 -- ..*...*******.
   18 -- .*.***........
   19 -- .***..*******.
   20 -- .************.
   21 -- ..*...********
   22 -- .*.***.......*
   23 -- .*.**.........
   24 -- ....**.......*
   25 -- .***..********
   --------------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
   15  3002    1.000000    0.000000    1.000000    1.000000    2
   16  2312    0.770153    0.001884    0.768821    0.771486    2
   17  2058    0.685543    0.010364    0.678215    0.692871    2
   18  1665    0.554630    0.006124    0.550300    0.558961    2
   19  1045    0.348101    0.014604    0.337775    0.358428    2
   20   914    0.304464    0.004711    0.301133    0.307795    2
   21   603    0.200866    0.002355    0.199201    0.202532    2
   22   593    0.197535    0.005182    0.193871    0.201199    2
   23   509    0.169554    0.006124    0.165223    0.173884    2
   24   453    0.150899    0.013662    0.141239    0.160560    2
   25   404    0.134577    0.000000    0.134577    0.134577    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.018304    0.000099    0.001834    0.037992    0.016587    1.000    2
   length{all}[2]     0.017432    0.000219    0.000000    0.046913    0.013876    1.000    2
   length{all}[3]     0.008769    0.000043    0.000011    0.021783    0.007150    1.000    2
   length{all}[4]     0.035669    0.000372    0.001185    0.071103    0.032869    1.000    2
   length{all}[5]     0.045809    0.000373    0.010438    0.083378    0.043234    1.000    2
   length{all}[6]     0.007696    0.000050    0.000003    0.021295    0.005830    1.000    2
   length{all}[7]     0.008422    0.000041    0.000006    0.021041    0.006844    1.000    2
   length{all}[8]     0.013024    0.000067    0.001253    0.029170    0.011345    1.000    2
   length{all}[9]     0.008633    0.000039    0.000126    0.020925    0.007128    1.000    2
   length{all}[10]    0.008647    0.000040    0.000050    0.020992    0.007057    1.000    2
   length{all}[11]    0.013080    0.000064    0.000700    0.029030    0.011518    1.000    2
   length{all}[12]    0.013420    0.000067    0.001577    0.029997    0.011747    1.000    2
   length{all}[13]    0.012931    0.000070    0.000697    0.029400    0.011276    1.000    2
   length{all}[14]    0.013124    0.000073    0.000657    0.029646    0.011386    1.000    2
   length{all}[15]    0.322088    0.009731    0.147119    0.511497    0.309103    1.000    2
   length{all}[16]    0.029714    0.000318    0.000019    0.061486    0.028026    1.000    2
   length{all}[17]    0.013383    0.000074    0.000518    0.029136    0.011706    1.000    2
   length{all}[18]    0.029446    0.000276    0.000082    0.059051    0.027599    0.999    2
   length{all}[19]    0.013470    0.000081    0.000070    0.031234    0.011574    1.001    2
   length{all}[20]    0.005189    0.000030    0.000005    0.015258    0.003765    1.000    2
   length{all}[21]    0.005775    0.000040    0.000003    0.018983    0.003793    0.999    2
   length{all}[22]    0.006054    0.000035    0.000011    0.017793    0.004441    1.006    2
   length{all}[23]    0.016112    0.000198    0.000005    0.045527    0.011810    0.999    2
   length{all}[24]    0.005638    0.000033    0.000005    0.015667    0.003859    0.998    2
   length{all}[25]    0.005299    0.000026    0.000002    0.013962    0.003888    1.002    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.005910
       Maximum standard deviation of split frequencies = 0.014604
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.006


   Clade credibility values:

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |---------------------------------------------------------------------- C14 (14)
   |                                                                               
   |                                              /----------------------- C3 (3)
   |                                              |                                
   |                                              |----------------------- C7 (7)
   |                                              |                                
   |                                              |----------------------- C8 (8)
   |                                              |                                
   |                                              |----------------------- C9 (9)
   |----------------------69----------------------+                                
   +                                              |----------------------- C10 (10)
   |                                              |                                
   |                                              |----------------------- C11 (11)
   |                                              |                                
   |                                              |----------------------- C12 (12)
   |                                              |                                
   |                                              \----------------------- C13 (13)
   |                                                                               
   |                                              /----------------------- C2 (2)
   |                      /----------100----------+                                
   |                      |                       \----------------------- C4 (4)
   \----------55----------+                                                        
                          |                       /----------------------- C5 (5)
                          \-----------77----------+                                
                                                  \----------------------- C6 (6)
                                                                                   

   Phylogram (based on average branch lengths):

   /--- C1 (1)
   |                                                                               
   |-- C14 (14)
   |                                                                               
   | /-- C3 (3)
   | |                                                                             
   | |-- C7 (7)
   | |                                                                             
   | |-- C8 (8)
   | |                                                                             
   | |-- C9 (9)
   |-+                                                                             
   + |-- C10 (10)
   | |                                                                             
   | |--- C11 (11)
   | |                                                                             
   | |--- C12 (12)
   | |                                                                             
   | \-- C13 (13)
   |                                                                               
   |                                                                 /-- C2 (2)
   |    /------------------------------------------------------------+             
   |    |                                                            \------ C4 (4)
   \----+                                                                          
        |     /-------- C5 (5)
        \-----+                                                                    
              \- C6 (6)
                                                                                   
   |--------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3001 trees sampled):
      50 % credible set contains 1500 trees
      90 % credible set contains 2701 trees
      95 % credible set contains 2851 trees
      99 % credible set contains 2971 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 14  	ls = 390
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Reading seq # 9: C9     
Reading seq #10: C10     
Reading seq #11: C11     
Reading seq #12: C12     
Reading seq #13: C13     
Reading seq #14: C14     
Sequences read..
Counting site patterns..  0:00

          87 patterns at      130 /      130 sites (100.0%),  0:00
Counting codons..
NG distances for seqs.:
   1   2   3   4   5   6   7   8   9  10  11  12  13  14

      728 bytes for distance
    84912 bytes for conP
    11832 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
   212280 bytes for conP, adjusted

    0.029099    0.021453    0.008791    0.008581    0.008693    0.014032    0.008706    0.008805    0.013115    0.018011    0.012957    0.049150    0.312398    0.013979    0.050403    0.009220    0.066863    0.005269    0.300000    1.300000

ntime & nrate & np:    18     2    20

Bounds (np=20):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    20
lnL0 = -1017.529617

Iterating by ming2
Initial: fx=  1017.529617
x=  0.02910  0.02145  0.00879  0.00858  0.00869  0.01403  0.00871  0.00881  0.01311  0.01801  0.01296  0.04915  0.31240  0.01398  0.05040  0.00922  0.06686  0.00527  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 229.7511 ++     1012.732484  m 0.0001    25 | 0/20
  2 h-m-p  0.0001 0.0005 366.0401 +YYCYYCCC   998.750217  7 0.0004    60 | 0/20
  3 h-m-p  0.0000 0.0001 2644.0916 +YYCCCC   989.771486  5 0.0001    92 | 0/20
  4 h-m-p  0.0001 0.0006 1698.6576 +CYC    967.273560  2 0.0004   119 | 0/20
  5 h-m-p  0.0000 0.0002 411.8732 +CCCC   962.453038  3 0.0001   149 | 0/20
  6 h-m-p  0.0000 0.0002 281.2312 YCCCC   961.164869  4 0.0001   179 | 0/20
  7 h-m-p  0.0000 0.0001 586.2625 YCCCC   960.574393  4 0.0000   209 | 0/20
  8 h-m-p  0.0001 0.0003 152.9504 YCCC    959.993420  3 0.0001   237 | 0/20
  9 h-m-p  0.0001 0.0009 235.4402 +YYCC   958.631390  3 0.0002   265 | 0/20
 10 h-m-p  0.0003 0.0013 139.7795 +YCYCCC   955.825655  5 0.0007   297 | 0/20
 11 h-m-p  0.0001 0.0005 299.1886 +CYCCC   952.950532  4 0.0004   328 | 0/20
 12 h-m-p  0.0000 0.0002 692.0480 +CCCC   950.603179  3 0.0001   358 | 0/20
 13 h-m-p  0.0000 0.0000 3340.5572 ++      948.458374  m 0.0000   381 | 0/20
 14 h-m-p -0.0000 -0.0000 1395.6684 
h-m-p:     -1.45795411e-22     -7.28977054e-22      1.39566838e+03   948.458374
..  | 0/20
 15 h-m-p  0.0000 0.0005 389.1796 ++YCCCC   943.573942  4 0.0001   433 | 0/20
 16 h-m-p  0.0001 0.0004 251.1734 +YYYYCYCCCC   933.536855  9 0.0003   470 | 0/20
 17 h-m-p  0.0000 0.0000 717.0486 ++      931.126784  m 0.0000   493 | 1/20
 18 h-m-p  0.0001 0.0005 271.7331 +CYYCCC   924.905708  5 0.0004   526 | 1/20
 19 h-m-p  0.0000 0.0001 1075.1413 YCYCCC   923.259936  5 0.0000   557 | 1/20
 20 h-m-p  0.0000 0.0002 246.1092 YCCCC   922.401448  4 0.0001   587 | 0/20
 21 h-m-p  0.0000 0.0001 299.4305 CYCC    921.905882  3 0.0000   615 | 0/20
 22 h-m-p  0.0001 0.0022 142.4145 +++     907.029537  m 0.0022   639 | 0/20
 23 h-m-p  0.0000 0.0000 11557.4544 +YYCYCCC   898.676976  6 0.0000   672 | 0/20
 24 h-m-p  0.0000 0.0001 1360.8646 CYCCC   897.577519  4 0.0000   702 | 0/20
 25 h-m-p  0.0001 0.0004 118.2655 CCCC    897.292064  3 0.0001   731 | 0/20
 26 h-m-p  0.0003 0.0013  40.6800 CYCCC   897.023897  4 0.0004   761 | 0/20
 27 h-m-p  0.0001 0.0012 121.8026 +YYCCC   896.293591  4 0.0004   791 | 0/20
 28 h-m-p  0.0001 0.0004 377.0031 +YCYCCC   895.140235  5 0.0002   823 | 0/20
 29 h-m-p  0.0001 0.0005 641.2215 +YYCCCC   892.359118  5 0.0003   855 | 0/20
 30 h-m-p  0.0001 0.0004 1296.2685 YCCCC   890.512401  4 0.0001   885 | 0/20
 31 h-m-p  0.0003 0.0013 452.8721 +YYCCC   886.730858  4 0.0008   915 | 0/20
 32 h-m-p  0.0007 0.0033 106.2136 YCYCCC   884.473094  5 0.0018   946 | 0/20
 33 h-m-p  0.0006 0.0032  68.7595 +YCYCC   883.022162  4 0.0020   976 | 0/20
 34 h-m-p  0.0008 0.0041 142.4312 +YYYCCC   877.863617  5 0.0029  1007 | 0/20
 35 h-m-p  0.0003 0.0013 312.7155 +CYCCC   874.440768  4 0.0010  1038 | 0/20
 36 h-m-p  0.0175 0.0876   1.8591 YCYCCC   873.772872  5 0.0469  1069 | 0/20
 37 h-m-p  0.0608 0.5957   1.4341 +CYYYCC   868.404754  5 0.5107  1101 | 0/20
 38 h-m-p  0.2212 1.1058   1.1426 +YYCCC   865.622805  4 0.6909  1131 | 0/20
 39 h-m-p  0.1473 0.7365   1.9234 YYCCC   864.662634  4 0.2363  1160 | 0/20
 40 h-m-p  0.4468 2.4078   1.0171 +YYYC   862.142193  3 1.6498  1187 | 0/20
 41 h-m-p  0.4777 2.3884   0.6214 +YCCC   861.332156  3 1.3609  1216 | 0/20
 42 h-m-p  0.7175 3.5873   0.6155 YCCC    860.744784  3 1.7423  1264 | 0/20
 43 h-m-p  1.0655 5.7932   1.0064 YCCC    860.128469  3 1.8846  1312 | 0/20
 44 h-m-p  1.6000 8.0000   0.5768 YCCC    859.797741  3 2.6098  1340 | 0/20
 45 h-m-p  1.6000 8.0000   0.4444 CCC     859.656468  2 2.0105  1387 | 0/20
 46 h-m-p  1.6000 8.0000   0.4255 CCC     859.541410  2 1.7171  1434 | 0/20
 47 h-m-p  1.5635 7.8176   0.2333 YCCC    859.250626  3 3.5349  1482 | 0/20
 48 h-m-p  1.5109 7.5544   0.0075 CC      859.165175  1 1.8635  1527 | 0/20
 49 h-m-p  0.0894 8.0000   0.1563 ++CC    859.130563  1 2.2001  1574 | 0/20
 50 h-m-p  0.9919 8.0000   0.3468 YC      859.111479  1 1.8202  1618 | 0/20
 51 h-m-p  1.6000 8.0000   0.1451 CC      859.096965  1 2.1484  1663 | 0/20
 52 h-m-p  1.6000 8.0000   0.0205 CC      859.088057  1 2.5115  1708 | 0/20
 53 h-m-p  1.5604 8.0000   0.0330 YC      859.078220  1 3.6184  1752 | 0/20
 54 h-m-p  1.6000 8.0000   0.0138 YC      859.070800  1 3.2872  1796 | 0/20
 55 h-m-p  0.6632 8.0000   0.0683 +YC     859.068000  1 1.7193  1841 | 0/20
 56 h-m-p  1.6000 8.0000   0.0255 C       859.067866  0 1.8139  1884 | 0/20
 57 h-m-p  1.6000 8.0000   0.0130 C       859.067822  0 1.8817  1927 | 0/20
 58 h-m-p  1.6000 8.0000   0.0025 C       859.067812  0 1.8130  1970 | 0/20
 59 h-m-p  1.6000 8.0000   0.0001 C       859.067806  0 2.2535  2013 | 0/20
 60 h-m-p  1.6000 8.0000   0.0002 C       859.067806  0 1.7147  2056 | 0/20
 61 h-m-p  0.5193 8.0000   0.0005 +Y      859.067805  0 1.6139  2100 | 0/20
 62 h-m-p  1.6000 8.0000   0.0002 C       859.067805  0 1.8154  2143 | 0/20
 63 h-m-p  1.6000 8.0000   0.0000 C       859.067805  0 1.9034  2186 | 0/20
 64 h-m-p  0.7242 8.0000   0.0000 Y       859.067805  0 1.3345  2229 | 0/20
 65 h-m-p  1.6000 8.0000   0.0000 ----------------..  | 0/20
 66 h-m-p  0.0160 8.0000   0.0005 ------------- | 0/20
 67 h-m-p  0.0160 8.0000   0.0005 -------------
Out..
lnL  =  -859.067805
2395 lfun, 2395 eigenQcodon, 43110 P(t)

Time used:  0:10


Model 1: NearlyNeutral

TREE #  1
(1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
    0.029099    0.021453    0.008791    0.008581    0.008693    0.014032    0.008706    0.008805    0.013115    0.018011    0.012957    0.049150    0.312398    0.013979    0.050403    0.009220    0.066863    0.005269   16.522844    0.652999    0.498354

ntime & nrate & np:    18     2    21

Bounds (np=21):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 1.127203

np =    21
lnL0 =  -888.726926

Iterating by ming2
Initial: fx=   888.726926
x=  0.02910  0.02145  0.00879  0.00858  0.00869  0.01403  0.00871  0.00881  0.01311  0.01801  0.01296  0.04915  0.31240  0.01398  0.05040  0.00922  0.06686  0.00527 16.52284  0.65300  0.49835

  1 h-m-p  0.0000 0.0002 136.4567 ++YCCC   887.899956  3 0.0001    54 | 0/21
  2 h-m-p  0.0002 0.0010  60.0014 YCCCCC   887.174372  5 0.0004   108 | 0/21
  3 h-m-p  0.0001 0.0010 199.1848 +YYCCC   884.980426  4 0.0004   160 | 0/21
  4 h-m-p  0.0000 0.0002 843.0930 +YYYCC   881.497337  4 0.0001   211 | 0/21
  5 h-m-p  0.0000 0.0001 2401.7376 +YCYCCC   869.738565  5 0.0001   265 | 0/21
  6 h-m-p  0.0000 0.0001  68.1701 ++      869.542249  m 0.0001   310 | 0/21
  7 h-m-p -0.0000 -0.0000 557.3437 
h-m-p:     -4.44428216e-23     -2.22214108e-22      5.57343733e+02   869.542249
..  | 0/21
  8 h-m-p  0.0000 0.0003 325.9338 ++CCCC   864.326040  3 0.0002   405 | 0/21
  9 h-m-p  0.0000 0.0001 131.6351 ++      863.608325  m 0.0001   450 | 1/21
 10 h-m-p  0.0000 0.0002 346.1479 +YCYCCC   861.015143  5 0.0002   504 | 1/21
 11 h-m-p  0.0000 0.0001 232.4665 YCCC    860.580026  3 0.0001   553 | 1/21
 12 h-m-p  0.0000 0.0001 180.5603 YCCC    860.376706  3 0.0000   602 | 1/21
 13 h-m-p  0.0001 0.0003  67.1902 CCCC    860.291371  3 0.0001   652 | 1/21
 14 h-m-p  0.0000 0.0004 107.4601 YCCC    860.145184  3 0.0001   701 | 1/21
 15 h-m-p  0.0001 0.0003 170.2508 CCCC    859.971061  3 0.0001   751 | 1/21
 16 h-m-p  0.0006 0.0035  20.9747 YC      859.912174  1 0.0004   796 | 1/21
 17 h-m-p  0.0004 0.0033  21.9321 YC      859.826040  1 0.0007   841 | 1/21
 18 h-m-p  0.0010 0.0048  15.0964 CC      859.810700  1 0.0003   887 | 1/21
 19 h-m-p  0.0010 0.0215   3.7381 YC      859.806544  1 0.0005   932 | 1/21
 20 h-m-p  0.0005 0.0225   3.9654 CC      859.803151  1 0.0004   978 | 1/21
 21 h-m-p  0.0009 0.0179   1.9664 CY      859.798548  1 0.0008  1024 | 1/21
 22 h-m-p  0.0004 0.0308   4.3210 +CYC    859.765607  2 0.0016  1072 | 1/21
 23 h-m-p  0.0006 0.0073  11.2150 CC      859.720998  1 0.0006  1118 | 1/21
 24 h-m-p  0.0005 0.0069  14.4350 +YYC    859.497905  2 0.0016  1165 | 0/21
 25 h-m-p  0.0007 0.0034  27.2031 YCCC    859.475176  3 0.0001  1214 | 0/21
 26 h-m-p  0.0004 0.0098   7.0996 +YCCC   859.203454  3 0.0036  1265 | 0/21
 27 h-m-p  0.0002 0.0012  25.5949 YYC     859.164534  2 0.0002  1312 | 0/21
 28 h-m-p  0.0059 0.0418   0.8056 CCC     859.102886  2 0.0066  1361 | 0/21
 29 h-m-p  0.0002 0.0027  22.1606 +CCC    858.798064  2 0.0009  1411 | 0/21
 30 h-m-p  1.0888 8.0000   0.0186 CCC     858.720051  2 0.9572  1460 | 0/21
 31 h-m-p  1.6000 8.0000   0.0041 CCC     858.706403  2 1.2341  1509 | 0/21
 32 h-m-p  1.5673 8.0000   0.0032 YC      858.704517  1 1.1452  1555 | 0/21
 33 h-m-p  1.2386 8.0000   0.0030 C       858.704199  0 1.3330  1600 | 0/21
 34 h-m-p  1.6000 8.0000   0.0024 C       858.704162  0 1.7066  1645 | 0/21
 35 h-m-p  1.4226 8.0000   0.0029 Y       858.704140  0 2.8349  1690 | 0/21
 36 h-m-p  1.6000 8.0000   0.0034 Y       858.704125  0 3.6914  1735 | 0/21
 37 h-m-p  1.6000 8.0000   0.0078 +Y      858.704075  0 6.7303  1781 | 0/21
 38 h-m-p  1.6000 8.0000   0.0095 C       858.704063  0 1.4939  1826 | 0/21
 39 h-m-p  1.6000 8.0000   0.0016 C       858.704060  0 2.1886  1871 | 0/21
 40 h-m-p  1.6000 8.0000   0.0008 C       858.704059  0 1.6350  1916 | 0/21
 41 h-m-p  1.6000 8.0000   0.0001 Y       858.704058  0 1.2363  1961 | 0/21
 42 h-m-p  1.6000 8.0000   0.0000 Y       858.704058  0 0.9660  2006 | 0/21
 43 h-m-p  1.6000 8.0000   0.0000 -----Y   858.704058  0 0.0004  2056
Out..
lnL  =  -858.704058
2057 lfun, 6171 eigenQcodon, 74052 P(t)

Time used:  0:26


Model 2: PositiveSelection

TREE #  1
(1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
initial w for M2:NSpselection reset.

    0.029099    0.021453    0.008791    0.008581    0.008693    0.014032    0.008706    0.008805    0.013115    0.018011    0.012957    0.049150    0.312398    0.013979    0.050403    0.009220    0.066863    0.005269   16.625571    1.001601    0.301958    0.109127    2.014820

ntime & nrate & np:    18     3    23

Bounds (np=23):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 1.074666

np =    23
lnL0 =  -885.769443

Iterating by ming2
Initial: fx=   885.769443
x=  0.02910  0.02145  0.00879  0.00858  0.00869  0.01403  0.00871  0.00881  0.01311  0.01801  0.01296  0.04915  0.31240  0.01398  0.05040  0.00922  0.06686  0.00527 16.62557  1.00160  0.30196  0.10913  2.01482

  1 h-m-p  0.0000 0.0003 160.5036 ++CYCCC   884.521983  4 0.0001    60 | 0/23
  2 h-m-p  0.0002 0.0008  57.1655 ++      883.168726  m 0.0008   109 | 0/23
  3 h-m-p  0.0000 0.0000 188.0412 
h-m-p:      9.21296520e-21      4.60648260e-20      1.88041243e+02   883.168726
..  | 0/23
  4 h-m-p  0.0000 0.0013  69.2079 ++YCCC   882.538792  3 0.0003   211 | 0/23
  5 h-m-p  0.0002 0.0009  86.1505 YCCCC   881.601482  4 0.0004   267 | 0/23
  6 h-m-p  0.0000 0.0002 201.4240 ++      879.851695  m 0.0002   316 | 1/23
  7 h-m-p  0.0000 0.0014 567.8963 ++YYYCC   876.341875  4 0.0006   372 | 1/23
  8 h-m-p  0.0000 0.0001 745.8780 ++      875.541917  m 0.0001   420 | 2/23
  9 h-m-p  0.0001 0.0005 394.0259 YCCC    874.732330  3 0.0002   473 | 2/23
 10 h-m-p  0.0001 0.0004 179.7789 YCYCCC   874.309703  5 0.0002   528 | 2/23
 11 h-m-p  0.0001 0.0005 437.8583 +YCCC   873.245691  3 0.0002   581 | 2/23
 12 h-m-p  0.0001 0.0004 265.6839 ++      872.218475  m 0.0004   628 | 2/23
 13 h-m-p  0.0000 0.0000  51.4615 
h-m-p:      1.18040076e-20      5.90200379e-20      5.14615135e+01   872.218475
..  | 1/23
 14 h-m-p  0.0000 0.0004 139.5422 ++YYYC   871.410663  3 0.0001   724 | 1/23
 15 h-m-p  0.0001 0.0003  72.1341 CYCCC   871.092645  4 0.0001   779 | 1/23
 16 h-m-p  0.0003 0.0030  27.8510 CCC     870.936811  2 0.0005   831 | 1/23
 17 h-m-p  0.0002 0.0021  66.4358 +YYYYCCC   870.392050  6 0.0008   888 | 1/23
 18 h-m-p  0.0002 0.0008 216.4129 CCCCC   869.837766  4 0.0003   944 | 1/23
 19 h-m-p  0.0003 0.0013 122.0341 +YYCC   868.719523  3 0.0009   997 | 1/23
 20 h-m-p  0.0002 0.0011 362.6870 YCCCCC   867.148425  5 0.0004  1054 | 1/23
 21 h-m-p  0.0002 0.0008 173.7116 YCCCC   867.012211  4 0.0001  1109 | 1/23
 22 h-m-p  0.0004 0.0020  32.6783 YCCC    866.964483  3 0.0002  1162 | 1/23
 23 h-m-p  0.0003 0.0054  25.5611 +CCCC   866.659373  3 0.0022  1217 | 1/23
 24 h-m-p  0.0003 0.0014 226.4016 +YC     865.401939  1 0.0012  1267 | 1/23
 25 h-m-p  0.0004 0.0022 298.6678 CCCC    864.917045  3 0.0004  1321 | 1/23
 26 h-m-p  0.0004 0.0020 272.0971 YCCCC   863.796234  4 0.0008  1376 | 0/23
 27 h-m-p  0.0001 0.0004 816.2245 YCCC    862.262973  3 0.0002  1429 | 0/23
 28 h-m-p  0.0011 0.0054   7.8038 YC      862.257771  1 0.0002  1479 | 0/23
 29 h-m-p  0.0003 0.0196   5.2242 YC      862.252229  1 0.0005  1529 | 0/23
 30 h-m-p  0.0003 0.0090   8.7518 CC      862.245318  1 0.0004  1580 | 0/23
 31 h-m-p  0.0002 0.0069  15.3174 YC      862.233237  1 0.0004  1630 | 0/23
 32 h-m-p  0.0005 0.0293  13.4164 ++YYC   862.100174  2 0.0053  1683 | 0/23
 33 h-m-p  0.0001 0.0006 681.3972 ++      860.848445  m 0.0006  1732 | 1/23
 34 h-m-p  0.0002 0.0008 371.3779 CYC     860.675904  2 0.0002  1784 | 1/23
 35 h-m-p  0.1564 1.1454   0.3765 +CCC    859.784559  2 0.5843  1837 | 1/23
 36 h-m-p  0.2376 1.1882   0.3140 +CYC    859.301680  2 0.9384  1889 | 1/23
 37 h-m-p  1.0795 6.5377   0.2730 CYC     858.994735  2 1.2692  1940 | 1/23
 38 h-m-p  1.0792 5.3962   0.1456 CCCC    858.868517  3 1.2885  1994 | 1/23
 39 h-m-p  0.8119 4.0594   0.1515 CCC     858.797341  2 1.0569  2046 | 1/23
 40 h-m-p  1.5031 8.0000   0.1065 CCC     858.738656  2 1.6923  2098 | 1/23
 41 h-m-p  1.3209 6.6044   0.0906 CC      858.711617  1 1.0728  2148 | 1/23
 42 h-m-p  1.6000 8.0000   0.0554 YC      858.704717  1 0.9591  2197 | 1/23
 43 h-m-p  1.6000 8.0000   0.0164 YC      858.704154  1 0.7053  2246 | 1/23
 44 h-m-p  1.6000 8.0000   0.0048 YC      858.704098  1 1.0909  2295 | 1/23
 45 h-m-p  1.6000 8.0000   0.0021 C       858.704091  0 1.3307  2343 | 1/23
 46 h-m-p  1.6000 8.0000   0.0017 C       858.704088  0 2.2099  2391 | 1/23
 47 h-m-p  1.1395 8.0000   0.0033 +C      858.704078  0 4.8138  2440 | 1/23
 48 h-m-p  1.4820 8.0000   0.0108 Y       858.704063  0 2.5442  2488 | 1/23
 49 h-m-p  1.6000 8.0000   0.0059 Y       858.704059  0 1.1579  2536 | 1/23
 50 h-m-p  1.6000 8.0000   0.0007 Y       858.704058  0 1.0935  2584 | 1/23
 51 h-m-p  1.6000 8.0000   0.0000 Y       858.704058  0 1.1272  2632 | 1/23
 52 h-m-p  1.6000 8.0000   0.0000 C       858.704058  0 1.6000  2680 | 1/23
 53 h-m-p  1.6000 8.0000   0.0000 -Y      858.704058  0 0.1000  2729 | 1/23
 54 h-m-p  0.0559 8.0000   0.0000 C       858.704058  0 0.0140  2777
Out..
lnL  =  -858.704058
2778 lfun, 11112 eigenQcodon, 150012 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) =  -867.932141  S =  -833.320221   -26.163205
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  87 patterns   0:59
	did  20 /  87 patterns   0:59
	did  30 /  87 patterns   0:59
	did  40 /  87 patterns   0:59
	did  50 /  87 patterns   0:59
	did  60 /  87 patterns   0:59
	did  70 /  87 patterns   0:59
	did  80 /  87 patterns   0:59
	did  87 /  87 patterns   0:59
Time used:  0:59


Model 3: discrete

TREE #  1
(1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
    0.029099    0.021453    0.008791    0.008581    0.008693    0.014032    0.008706    0.008805    0.013115    0.018011    0.012957    0.049150    0.312398    0.013979    0.050403    0.009220    0.066863    0.005269   16.625572    0.898262    0.025525    0.043755    0.099155    0.152761

ntime & nrate & np:    18     4    24

Bounds (np=24):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 2.301229

np =    24
lnL0 =  -859.706791

Iterating by ming2
Initial: fx=   859.706791
x=  0.02910  0.02145  0.00879  0.00858  0.00869  0.01403  0.00871  0.00881  0.01311  0.01801  0.01296  0.04915  0.31240  0.01398  0.05040  0.00922  0.06686  0.00527 16.62557  0.89826  0.02553  0.04375  0.09916  0.15276

  1 h-m-p  0.0000 0.0002 126.2944 +YCCC   859.110711  3 0.0001    59 | 0/24
  2 h-m-p  0.0001 0.0006  32.2823 YCCC    859.003590  3 0.0002   115 | 0/24
  3 h-m-p  0.0003 0.0024  25.3394 CC      858.949218  1 0.0003   168 | 0/24
  4 h-m-p  0.0002 0.0011  41.6322 CCC     858.890218  2 0.0002   223 | 0/24
  5 h-m-p  0.0001 0.0005  25.8454 YC      858.858237  1 0.0002   275 | 0/24
  6 h-m-p  0.0002 0.0052  35.9291 YCC     858.812562  2 0.0003   329 | 0/24
  7 h-m-p  0.0002 0.0030  42.6296 +CC     858.593586  1 0.0013   383 | 0/24
  8 h-m-p  0.0002 0.0009  41.6731 YYC     858.571686  2 0.0001   436 | 0/24
  9 h-m-p  0.0002 0.0010  32.3374 YC      858.529427  1 0.0004   488 | 0/24
 10 h-m-p  0.0001 0.0004  45.9859 +C      858.482890  0 0.0003   540 | 0/24
 11 h-m-p  0.0001 0.0003  16.0730 ++      858.471718  m 0.0003   591 | 1/24
 12 h-m-p  0.0001 0.0036  26.9577 CC      858.456247  1 0.0002   644 | 1/24
 13 h-m-p  0.0002 0.0029  33.2495 +YC     858.410746  1 0.0006   696 | 1/24
 14 h-m-p  0.0007 0.0035  11.4479 CC      858.405873  1 0.0002   748 | 1/24
 15 h-m-p  0.0004 0.0079   6.1313 YC      858.403129  1 0.0003   799 | 1/24
 16 h-m-p  0.0001 0.0082  14.4307 YC      858.398034  1 0.0003   850 | 1/24
 17 h-m-p  0.0004 0.0140  10.2174 YC      858.394763  1 0.0003   901 | 1/24
 18 h-m-p  0.0019 0.0627   1.4585 YC      858.393728  1 0.0011   952 | 1/24
 19 h-m-p  0.0005 0.0251   3.4772 YC      858.393227  1 0.0003  1003 | 1/24
 20 h-m-p  0.0004 0.1190   2.1082 +++CCCC   858.355761  3 0.0341  1062 | 1/24
 21 h-m-p  0.0016 0.0080   8.4703 -CC     858.355233  1 0.0001  1115 | 1/24
 22 h-m-p  0.0144 7.2187   0.0961 +++CCCC   858.319283  3 1.2152  1174 | 1/24
 23 h-m-p  1.1644 8.0000   0.1003 YYYC    858.313112  3 1.0311  1227 | 1/24
 24 h-m-p  1.6000 8.0000   0.0274 C       858.310204  0 1.5219  1277 | 1/24
 25 h-m-p  1.6000 8.0000   0.0123 YC      858.309799  1 0.8685  1328 | 1/24
 26 h-m-p  0.7918 8.0000   0.0134 C       858.309699  0 0.6640  1378 | 1/24
 27 h-m-p  1.6000 8.0000   0.0006 C       858.309694  0 1.5934  1428 | 1/24
 28 h-m-p  1.6000 8.0000   0.0006 C       858.309693  0 1.9339  1478 | 1/24
 29 h-m-p  1.6000 8.0000   0.0002 C       858.309693  0 1.6247  1528 | 1/24
 30 h-m-p  1.6000 8.0000   0.0000 Y       858.309693  0 1.1273  1578 | 1/24
 31 h-m-p  1.6000 8.0000   0.0000 Y       858.309693  0 0.9867  1628 | 1/24
 32 h-m-p  0.5715 8.0000   0.0000 +Y      858.309693  0 3.8737  1679 | 1/24
 33 h-m-p  1.3785 8.0000   0.0000 ++      858.309693  m 8.0000  1729 | 1/24
 34 h-m-p  1.6000 8.0000   0.0000 C       858.309693  0 0.4000  1779 | 1/24
 35 h-m-p  0.6694 8.0000   0.0000 Y       858.309693  0 0.4927  1829 | 1/24
 36 h-m-p  1.6000 8.0000   0.0000 --------------Y   858.309693  0 0.0000  1893
Out..
lnL  =  -858.309693
1894 lfun, 7576 eigenQcodon, 102276 P(t)

Time used:  1:22


Model 7: beta

TREE #  1
(1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
    0.029099    0.021453    0.008791    0.008581    0.008693    0.014032    0.008706    0.008805    0.013115    0.018011    0.012957    0.049150    0.312398    0.013979    0.050403    0.009220    0.066863    0.005269   16.625284    0.649633    1.679063

ntime & nrate & np:    18     1    21

Bounds (np=21):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 1.705747

np =    21
lnL0 =  -866.817907

Iterating by ming2
Initial: fx=   866.817907
x=  0.02910  0.02145  0.00879  0.00858  0.00869  0.01403  0.00871  0.00881  0.01311  0.01801  0.01296  0.04915  0.31240  0.01398  0.05040  0.00922  0.06686  0.00527 16.62528  0.64963  1.67906

  1 h-m-p  0.0000 0.0002 130.8892 ++YCCC   866.152332  3 0.0001    54 | 0/21
  2 h-m-p  0.0001 0.0005  36.6849 +YCCC   865.970699  3 0.0003   105 | 0/21
  3 h-m-p  0.0002 0.0022  45.7555 YCC     865.747898  2 0.0004   153 | 0/21
  4 h-m-p  0.0001 0.0010 129.0724 YCCC    865.400389  3 0.0003   203 | 0/21
  5 h-m-p  0.0000 0.0002 139.4889 ++      864.990351  m 0.0002   248 | 0/21
  6 h-m-p  0.0001 0.0013 348.0834 +YCYCCC   862.119353  5 0.0008   302 | 0/21
  7 h-m-p  0.0000 0.0002 607.1172 ++      860.831490  m 0.0002   347 | 1/21
  8 h-m-p  0.0001 0.0004 129.3321 YCCC    860.573399  3 0.0002   397 | 1/21
  9 h-m-p  0.0002 0.0008  28.7479 CCC     860.494735  2 0.0003   445 | 1/21
 10 h-m-p  0.0002 0.0022  37.8072 CCC     860.408543  2 0.0003   493 | 1/21
 11 h-m-p  0.0006 0.0036  15.5330 CC      860.394144  1 0.0002   539 | 1/21
 12 h-m-p  0.0004 0.0021   6.2599 CC      860.385573  1 0.0005   585 | 1/21
 13 h-m-p  0.0002 0.0012  18.0553 ++      860.333215  m 0.0012   629 | 0/21
 14 h-m-p  0.0000 0.0000  77.6873 
h-m-p:      2.39306990e-21      1.19653495e-20      7.76873100e+01   860.333215
..  | 0/21
 15 h-m-p  0.0000 0.0004  88.0564 ++YYYCCCC   859.622710  6 0.0002   726 | 0/21
 16 h-m-p  0.0001 0.0004 114.4001 CCCCC   859.111379  4 0.0001   779 | 0/21
 17 h-m-p  0.0002 0.0009  66.2380 CCCCC   858.823063  4 0.0002   832 | 0/21
 18 h-m-p  0.0002 0.0017  60.3909 CCCC    858.593547  3 0.0003   883 | 0/21
 19 h-m-p  0.0001 0.0007  52.8925 YCC     858.547727  2 0.0001   931 | 0/21
 20 h-m-p  0.0001 0.0007  10.1578 CYC     858.541870  2 0.0001   979 | 0/21
 21 h-m-p  0.0002 0.0118   8.1871 YC      858.533877  1 0.0004  1025 | 0/21
 22 h-m-p  0.0002 0.0074  13.1669 CC      858.523780  1 0.0004  1072 | 0/21
 23 h-m-p  0.0003 0.0036  14.1309 YC      858.520088  1 0.0001  1118 | 0/21
 24 h-m-p  0.0002 0.0033  13.2237 YC      858.513283  1 0.0003  1164 | 0/21
 25 h-m-p  0.0003 0.0065  12.1050 YC      858.501572  1 0.0007  1210 | 0/21
 26 h-m-p  0.0028 0.0296   3.0035 -C      858.501111  0 0.0002  1256 | 0/21
 27 h-m-p  0.0004 0.0257   1.1680 YC      858.500942  1 0.0003  1302 | 0/21
 28 h-m-p  0.0001 0.0180   3.8487 +YC     858.500437  1 0.0003  1349 | 0/21
 29 h-m-p  0.0009 0.0769   1.3151 YC      858.500177  1 0.0006  1395 | 0/21
 30 h-m-p  0.0002 0.0854   3.4050 +YC     858.499445  1 0.0007  1442 | 0/21
 31 h-m-p  0.0020 0.0197   1.1761 YC      858.499357  1 0.0003  1488 | 0/21
 32 h-m-p  0.0026 1.3226   0.3912 ++YC    858.496505  1 0.0277  1536 | 0/21
 33 h-m-p  0.0001 0.0230  75.8677 ++CCC   858.437158  2 0.0030  1587 | 0/21
 34 h-m-p  0.0052 0.0259   2.6460 --YC    858.437070  1 0.0001  1635 | 0/21
 35 h-m-p  0.0160 8.0000   0.2029 +++YC   858.395705  1 2.5375  1684 | 0/21
 36 h-m-p  1.6000 8.0000   0.2111 CC      858.368512  1 2.2598  1731 | 0/21
 37 h-m-p  1.6000 8.0000   0.1617 CC      858.364158  1 1.6175  1778 | 0/21
 38 h-m-p  1.6000 8.0000   0.0853 CC      858.363525  1 1.3528  1825 | 0/21
 39 h-m-p  1.6000 8.0000   0.0213 Y       858.363484  0 1.1332  1870 | 0/21
 40 h-m-p  1.6000 8.0000   0.0020 C       858.363480  0 2.0585  1915 | 0/21
 41 h-m-p  1.6000 8.0000   0.0020 C       858.363479  0 1.5930  1960 | 0/21
 42 h-m-p  1.6000 8.0000   0.0004 +C      858.363479  0 6.2564  2006 | 0/21
 43 h-m-p  1.5669 8.0000   0.0015 +C      858.363478  0 6.5106  2052 | 0/21
 44 h-m-p  1.6000 8.0000   0.0004 Y       858.363478  0 1.1866  2097 | 0/21
 45 h-m-p  1.6000 8.0000   0.0001 Y       858.363478  0 0.8202  2142 | 0/21
 46 h-m-p  1.6000 8.0000   0.0000 C       858.363478  0 0.4000  2187 | 0/21
 47 h-m-p  0.7776 8.0000   0.0000 ----------------..  | 0/21
 48 h-m-p  0.0160 8.0000   0.0004 -----------C   858.363478  0 0.0000  2302
Out..
lnL  =  -858.363478
2303 lfun, 25333 eigenQcodon, 414540 P(t)

Time used:  2:52


Model 8: beta&w>1

TREE #  1
(1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
initial w for M8:NSbetaw>1 reset.

    0.029099    0.021453    0.008791    0.008581    0.008693    0.014032    0.008706    0.008805    0.013115    0.018011    0.012957    0.049150    0.312398    0.013979    0.050403    0.009220    0.066863    0.005269   16.622417    0.900000    0.578325    1.546757    2.928793

ntime & nrate & np:    18     2    23

Bounds (np=23):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 1.271429

np =    23
lnL0 =  -876.085414

Iterating by ming2
Initial: fx=   876.085414
x=  0.02910  0.02145  0.00879  0.00858  0.00869  0.01403  0.00871  0.00881  0.01311  0.01801  0.01296  0.04915  0.31240  0.01398  0.05040  0.00922  0.06686  0.00527 16.62242  0.90000  0.57833  1.54676  2.92879

  1 h-m-p  0.0000 0.0004 192.1544 ++YCCC   873.090741  3 0.0002    58 | 0/23
  2 h-m-p  0.0001 0.0006 137.3981 ++      867.283709  m 0.0006   107 | 1/23
  3 h-m-p  0.0000 0.0002 136.1917 ++      866.727451  m 0.0002   156 | 2/23
  4 h-m-p  0.0001 0.0003 125.5830 CCCC    866.533876  3 0.0001   210 | 2/23
  5 h-m-p  0.0001 0.0005 139.1992 +YYCC   865.878919  3 0.0003   262 | 2/23
  6 h-m-p  0.0000 0.0001 296.5194 +YCCC   865.528877  3 0.0001   315 | 2/23
  7 h-m-p  0.0001 0.0007 165.7051 +YCYCCC   864.567287  5 0.0004   371 | 2/23
  8 h-m-p  0.0000 0.0001 967.1303 +CCC    863.399078  2 0.0001   423 | 2/23
  9 h-m-p  0.0001 0.0004 402.7646 YCCCC   862.334321  4 0.0002   477 | 2/23
 10 h-m-p  0.0001 0.0004  97.5747 +CCC    861.890046  2 0.0003   529 | 2/23
 11 h-m-p  0.0002 0.0014 145.7957 +YCCC   860.686310  3 0.0006   582 | 2/23
 12 h-m-p  0.0000 0.0000 341.0577 ++      860.511335  m 0.0000   629 | 2/23
 13 h-m-p  0.0002 0.0009  39.9126 CCC     860.442874  2 0.0002   680 | 1/23
 14 h-m-p  0.0002 0.0094  27.1951 CYC     860.414419  2 0.0001   730 | 1/23
 15 h-m-p  0.0002 0.0092  10.8656 +CCC    860.360985  2 0.0009   783 | 1/23
 16 h-m-p  0.0018 0.0102   5.3215 CC      860.346201  1 0.0006   833 | 1/23
 17 h-m-p  0.0002 0.0054  16.4479 +YC     860.214274  1 0.0016   883 | 1/23
 18 h-m-p  0.0001 0.0005  85.4729 +YCC    860.075404  2 0.0003   935 | 1/23
 19 h-m-p  0.0008 0.0045  36.9646 CYC     859.961529  2 0.0007   986 | 1/23
 20 h-m-p  0.0003 0.0015  46.0044 YC      859.937066  1 0.0001  1035 | 1/23
 21 h-m-p  0.0011 0.0195   5.7817 +CC     859.886696  1 0.0045  1086 | 1/23
 22 h-m-p  0.0096 0.3665   2.7243 ++CYC   859.235003  2 0.1656  1139 | 1/23
 23 h-m-p  0.5901 2.9503   0.1079 CCCC    858.763777  3 0.7392  1193 | 1/23
 24 h-m-p  0.9165 6.2863   0.0870 YCCC    858.497460  3 1.4984  1246 | 1/23
 25 h-m-p  0.8506 8.0000   0.1533 CCC     858.410539  2 1.2788  1298 | 1/23
 26 h-m-p  1.6000 8.0000   0.0687 YC      858.390801  1 1.1931  1347 | 1/23
 27 h-m-p  1.2789 8.0000   0.0641 CC      858.379766  1 1.4538  1397 | 1/23
 28 h-m-p  1.6000 8.0000   0.0355 CC      858.376251  1 1.7498  1447 | 1/23
 29 h-m-p  1.6000 8.0000   0.0208 YC      858.374270  1 3.3814  1496 | 1/23
 30 h-m-p  1.4623 8.0000   0.0481 +YC     858.369683  1 4.3989  1546 | 1/23
 31 h-m-p  1.6000 8.0000   0.1013 CC      858.366125  1 1.9459  1596 | 1/23
 32 h-m-p  1.6000 8.0000   0.0732 CC      858.364269  1 2.2553  1646 | 1/23
 33 h-m-p  1.6000 8.0000   0.0131 C       858.364076  0 1.4991  1694 | 1/23
 34 h-m-p  1.6000 8.0000   0.0005 C       858.364056  0 1.4429  1742 | 1/23
 35 h-m-p  1.1738 8.0000   0.0006 C       858.364053  0 1.2348  1790 | 1/23
 36 h-m-p  0.9080 8.0000   0.0008 Y       858.364052  0 2.0605  1838 | 1/23
 37 h-m-p  1.6000 8.0000   0.0007 ++      858.364051  m 8.0000  1886 | 1/23
 38 h-m-p  1.1866 8.0000   0.0047 +Y      858.364048  0 3.4995  1935 | 1/23
 39 h-m-p  1.6000 8.0000   0.0027 C       858.364046  0 2.3984  1983 | 1/23
 40 h-m-p  1.6000 8.0000   0.0017 C       858.364046  0 2.0817  2031 | 1/23
 41 h-m-p  1.6000 8.0000   0.0006 ++      858.364045  m 8.0000  2079 | 1/23
 42 h-m-p  0.0532 8.0000   0.0929 ++Y     858.364023  0 1.9654  2129 | 1/23
 43 h-m-p  1.6000 8.0000   0.0887 ++      858.363839  m 8.0000  2177 | 1/23
 44 h-m-p  0.1100 8.0000   6.4548 ------------Y   858.363839  0 0.0000  2237 | 1/23
 45 h-m-p  0.0004 0.2069   4.6973 +++++   858.363638  m 0.2069  2288 | 2/23
 46 h-m-p  0.6505 8.0000   0.0633 CC      858.363546  1 0.9907  2338 | 2/23
 47 h-m-p  1.6000 8.0000   0.0004 Y       858.363546  0 1.1912  2385 | 2/23
 48 h-m-p  1.6000 8.0000   0.0001 C       858.363546  0 1.3909  2432 | 2/23
 49 h-m-p  1.6000 8.0000   0.0000 Y       858.363546  0 0.8814  2479 | 2/23
 50 h-m-p  1.6000 8.0000   0.0000 Y       858.363546  0 2.7895  2526 | 2/23
 51 h-m-p  1.5363 8.0000   0.0000 Y       858.363546  0 0.3841  2573 | 2/23
 52 h-m-p  0.5523 8.0000   0.0000 C       858.363546  0 0.1381  2620 | 2/23
 53 h-m-p  0.0525 8.0000   0.0000 -----C   858.363546  0 0.0000  2672
Out..
lnL  =  -858.363546
2673 lfun, 32076 eigenQcodon, 529254 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) =  -867.538981  S =  -833.387867   -26.670951
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  87 patterns   4:48
	did  20 /  87 patterns   4:48
	did  30 /  87 patterns   4:49
	did  40 /  87 patterns   4:49
	did  50 /  87 patterns   4:49
	did  60 /  87 patterns   4:49
	did  70 /  87 patterns   4:49
	did  80 /  87 patterns   4:49
	did  87 /  87 patterns   4:49
Time used:  4:49
CodeML output code: -1
Download 
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=14, Len=130 

gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                      SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B     SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                         SWPPGEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B   SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVTGKSVD
gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                           SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B        SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                        SWPPSEVLTAVGLICVLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             SWPPSEVLTAVGLICALAGGFAKADIGMAGPMAAVGLLIVSYVVSGKSVD
gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                      SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                        SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYMVSGKSVD
gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                           SWPPSEVLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVD
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B               SWPPSEVLTAVGLICTLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                          SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLTVSYVVSGKSVD
                                                                                                                                                      ****.**********.********** ****:****** ***:*:*****

gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                      MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B     MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                         MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B   MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                           MYIERAGDITWEKDAEITGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B        MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                        MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             MYIERAGDITWEKDAEVTGNSPRLDVALDDSGDFSLVEDDGPPMREIILK
gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                      MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIMLK
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                        MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                           MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B               MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                          MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
                                                                                                                                                      ****************:************:********:********:**

gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                      VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B     VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                         VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B   VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                           VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B        VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                        VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                      VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                        VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                           VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B               VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                                          VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
                                                                                                                                                      ****:*************************
Download 
>gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGTTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTTGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTTAAA
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCTCCTAGTGAAGTGCTTACAGCTGTTGGCCTGATATGTGCACT
GGCCGGAGGGTTTGCCAAGGCAGACATAGAGATGGCTGGGCCCATGGCTG
CAGTGGGCCTGCTAATTGTCAGTTATGTGGTCTCGGGAAAGAGTGTGGAC
ATGTACATCGAAAGAGCAGGTGATATCACATGGGAAAAAGACGCGGAAGT
CACTGGAAACAGTCCTCGGCTTGACGTGGCACTAGATGAGAGTGGTGATT
TCTCCTTGGTAGAGGAGGATGGCCCACCCATGAGAGAGATCATACTCAAG
GTGGTTCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTCGC
TGCAGGAGCGTGGTATGTGTATGTAAAGACTGGAAAAAGG
>gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTGGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGTGAAGTGCTTACAGCTGTCGGCCTGATATGTGCACT
GGCCGGAGGGTTTGCCAAGGCAGACATAGAGATGGCTGGGCCCATGGCTG
CAGTAGGCCTGCTAATTGTCAGTTATGTGGTCACGGGAAAGAGTGTGGAC
ATGTACATCGAAAGAGCAGGTGATATTACATGGGAAAAAGACGCGGAAGT
CACTGGAAACAGTCCTCGGCTTGACGTGGCACTAGATGAGAGTGGTGATT
TCTCTTTGGTAGAGGAGGATGGCCCACCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTCGC
TGCAGGAGCGTGGTATGTGTATGTAAAGACTGGGAAAAGG
>gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGTGAAGTACTCACAGCTGTTGGCCTGATATGCGCGTT
GGCCGGAGGGTTCGCCAAGGCGGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAAT
CACTGGAAACAGTCCTCGGCTCGATGTGGCACTAGATGAGAGTGGTGACT
TCTCCCTAGTGGAGGATGATGGTCCCCCTATGAGAGAGATCATACTCAAA
GTGGTCCTGATGACCATCTGCGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTGTATGTGAAGACTGGGAAAAGG
>gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGTGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCGGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
TCTCCCTAGTGGAGGATGATGGTCCCCCCATGAGAGAGATCATACTCAAA
GTGGTCCTGATGGCCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTGTATGTGAAGACTGGAAAAAGG
>gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGTATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGGGATGGCTGGGCCCATGGCCG
CGGTTGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGATAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATGCTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACATGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTTGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATAGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCTTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCTAGCGAAGTACTCACAGCTGTTGGCCTGATATGCACATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAATTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGACGTGGCGCTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAG
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
>gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
AGCTGGCCCCCCAGCGAAGTACTCACAGCTGTTGGCCTGATATGCGCATT
GGCTGGAGGGTTCGCCAAGGCAGATATAGAGATGGCTGGGCCCATGGCCG
CGGTCGGTCTGCTAACTGTCAGTTACGTGGTCTCAGGAAAGAGTGTGGAC
ATGTACATTGAAAGAGCAGGTGACATCACATGGGAAAAAGATGCGGAAGT
CACTGGAAACAGTCCCCGGCTCGATGTGGCACTAGATGAGAGTGGTGATT
TCTCCCTGGTGGAGGATGACGGTCCCCCCATGAGAGAGATCATACTCAAA
GTGGTCCTGATGACCATCTGTGGCATGAACCCAATAGCCATACCCTTTGC
AGCTGGAGCGTGGTACGTATACGTGAAGACTGGAAAAAGG
Download 
>gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPGEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVTGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEITGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMAICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICVLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIGMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDDSGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIMLK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYMVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPIAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICTLAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
>gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B
SWPPSEVLTAVGLICALAGGFAKADIEMAGPMAAVGLLTVSYVVSGKSVD
MYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMREIILK
VVLMTICGMNPIAIPFAAGAWYVYVKTGKR
Download 
Reading sequence file aligned.fasta
Allocating space for 14 taxa and 390 sites
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig):  4.0%
Found 39 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to:      Phi.inf.list
Using a window size of 100 with k as 10

Calculating analytical mean and variance

Doing permutation test for PHI

Doing permutation test for NSS

Doing Permutation test for MAXCHI

 Writing  alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 42 polymorphic sites

       p-Value(s)
       ----------

NSS:                 1.00e-02  (1000 permutations)
Max Chi^2:           9.31e-01  (1000 permutations)
PHI (Permutation):   1.56e-01  (1000 permutations)
PHI (Normal):        1.12e-01
Download 
#NEXUS

[ID: 5506189968]
begin taxa;
	dimensions ntax=14;
	taxlabels
		gb_KY241783|Organism_Zika_virus|Strain_Name_ZIKV-SG-113|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KU955591|Organism_Zika_virus|Strain_Name_Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KX421195|Organism_Zika_virus|Strain_Name_Nica1-16|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KY553111|Organism_Zika_virus|Strain_Name_AFMC-U|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KU955593|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KX447514|Organism_Zika_virus|Strain_Name_1_0035_PF|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_MF574576|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_MF434516|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_MF098766|Organism_Zika_virus|Strain_Name_Dominican_Rep-Rus-5RMN-2016|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KY967711|Organism_Zika_virus|Strain_Name_SY01_2016|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KU926309|Organism_Zika_virus|Strain_Name_Rio-U1|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KY075932|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		gb_KU179098|Organism_Zika_virus|Strain_Name_JMB-185|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		;
end;
begin trees;
	translate
		1	gb_KY241783|Organism_Zika_virus|Strain_Name_ZIKV-SG-113|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		2	gb_KU955591|Organism_Zika_virus|Strain_Name_Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		3	gb_KX421195|Organism_Zika_virus|Strain_Name_Nica1-16|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		4	gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		5	gb_KY553111|Organism_Zika_virus|Strain_Name_AFMC-U|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		6	gb_KU955593|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		7	gb_KX447514|Organism_Zika_virus|Strain_Name_1_0035_PF|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		8	gb_MF574576|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		9	gb_MF434516|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		10	gb_MF098766|Organism_Zika_virus|Strain_Name_Dominican_Rep-Rus-5RMN-2016|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		11	gb_KY967711|Organism_Zika_virus|Strain_Name_SY01_2016|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		12	gb_KU926309|Organism_Zika_virus|Strain_Name_Rio-U1|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		13	gb_KY075932|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B,
		14	gb_KU179098|Organism_Zika_virus|Strain_Name_JMB-185|Protein_Name_nonstructural_protein_NS2B|Gene_Symbol_NS2B
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.01658665,14:0.01138619,(3:0.007149896,7:0.006844476,8:0.01134543,9:0.007127658,10:0.007056602,11:0.01151764,12:0.01174749,13:0.01127625)0.686:0.01170633,((2:0.01387578,4:0.0328691)1.000:0.3091025,(5:0.04323407,6:0.005829598)0.770:0.02802627)0.555:0.0275988);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.01658665,14:0.01138619,(3:0.007149896,7:0.006844476,8:0.01134543,9:0.007127658,10:0.007056602,11:0.01151764,12:0.01174749,13:0.01127625):0.01170633,((2:0.01387578,4:0.0328691):0.3091025,(5:0.04323407,6:0.005829598):0.02802627):0.0275988);
end;
Download 
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -904.27          -925.97
2       -903.63          -927.56
--------------------------------------
TOTAL     -903.90          -927.05
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.639004    0.015990    0.419493    0.906505    0.625473   1348.01   1390.82    1.000
r(A<->C){all}   0.018753    0.000276    0.000001    0.052068    0.013718    831.05    882.49    1.000
r(A<->G){all}   0.230001    0.006063    0.089098    0.377989    0.218540    446.76    450.49    1.000
r(A<->T){all}   0.036823    0.000523    0.000011    0.079758    0.032966    665.85    721.72    1.000
r(C<->G){all}   0.009590    0.000093    0.000009    0.029294    0.006596    707.32    805.62    1.000
r(C<->T){all}   0.683478    0.006952    0.508932    0.829203    0.693081    461.91    471.71    1.000
r(G<->T){all}   0.021355    0.000200    0.000300    0.049219    0.018235    635.30    775.41    1.000
pi(A){all}      0.243873    0.000431    0.204210    0.283840    0.243135   1097.04   1176.01    1.000
pi(C){all}      0.216653    0.000377    0.177427    0.254164    0.216464   1185.07   1226.07    1.000
pi(G){all}      0.311179    0.000510    0.267705    0.354263    0.311046   1228.84   1276.25    1.001
pi(T){all}      0.228295    0.000374    0.192951    0.268616    0.227818   1202.69   1289.14    1.000
alpha{1,2}      0.059861    0.001397    0.000124    0.121779    0.058562   1035.93   1208.68    1.003
alpha{3}        2.104398    0.644336    0.770742    3.624669    1.975276   1501.00   1501.00    1.000
pinvar{all}     0.307640    0.010609    0.089628    0.493936    0.314192    880.18    965.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
Download 
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS1/ZikaADOPSresults/NS2B/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =  14  ls = 130

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   1   1   1   1   1 | Ser TCT   0   0   0   1   0   0 | Tyr TAT   0   3   0   3   1   1 | Cys TGT   1   2   1   2   0   1
    TTC   2   2   2   2   2   2 |     TCC   1   1   1   0   1   1 |     TAC   4   1   4   1   3   3 |     TGC   1   0   1   0   2   1
Leu TTA   0   0   0   0   0   0 |     TCA   1   0   1   0   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   1   1   1   1   1   1 |     TCG   0   1   0   0   0   0 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   1   2   0   2   0   0 | Pro CCT   1   3   1   2   3   1 | His CAT   0   0   0   0   0   0 | Arg CGT   0   0   0   0   0   0
    CTC   2   1   3   1   3   3 |     CCC   6   3   6   4   4   6 |     CAC   0   0   0   0   0   0 |     CGC   0   0   0   0   0   0
    CTA   2   2   2   2   3   3 |     CCA   1   2   1   2   1   1 | Gln CAA   0   0   0   0   0   0 |     CGA   0   0   0   0   0   0
    CTG   4   4   4   4   3   3 |     CCG   0   0   0   0   0   0 |     CAG   0   0   0   0   0   0 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   1   2   2   2   2 | Thr ACT   2   2   2   2   2   2 | Asn AAT   0   0   0   0   0   0 | Ser AGT   5   5   4   5   5   5
    ATC   3   4   3   3   4   3 |     ACC   1   0   1   0   1   0 |     AAC   2   2   2   2   2   2 |     AGC   1   1   1   1   1   1
    ATA   5   5   5   5   5   5 |     ACA   2   2   2   2   2   2 | Lys AAA   3   2   2   2   3   3 | Arg AGA   2   2   2   2   2   2
Met ATG   6   6   6   6   6   6 |     ACG   0   0   0   1   0   0 |     AAG   3   4   4   4   3   3 |     AGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   2   2   1   0   1   1 | Ala GCT   4   4   4   4   3   4 | Asp GAT   6   4   6   4   6   7 | Gly GGT   4   2   4   2   4   4
    GTC   4   3   5   5   4   5 |     GCC   3   4   3   4   4   4 |     GAC   3   4   3   4   3   2 |     GGC   2   4   3   4   2   2
    GTA   2   2   2   3   1   1 |     GCA   5   6   4   6   3   4 | Glu GAA   4   4   4   4   4   4 |     GGA   5   5   5   4   4   5
    GTG   6   7   6   6   7   7 |     GCG   3   2   4   2   5   4 |     GAG   4   5   4   5   4   4 |     GGG   2   2   2   3   3   2
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   1   1   1   1   1 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   1   1   1   1   1   1
    TTC   2   2   2   2   2   2 |     TCC   1   1   1   1   1   1 |     TAC   4   4   4   4   4   4 |     TGC   1   1   1   1   1   1
Leu TTA   0   0   0   0   0   0 |     TCA   1   1   1   1   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   1   1   1   1   1   1 |     TCG   0   0   0   0   0   0 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   0   0   0   0   1   0 | Pro CCT   1   1   1   1   1   2 | His CAT   0   0   0   0   0   0 | Arg CGT   0   0   0   0   0   0
    CTC   3   3   3   3   2   3 |     CCC   6   6   6   6   6   5 |     CAC   0   0   0   0   0   0 |     CGC   0   0   0   0   0   0
    CTA   2   2   2   2   2   2 |     CCA   1   1   1   1   1   1 | Gln CAA   0   0   0   0   0   0 |     CGA   0   0   0   0   0   0
    CTG   4   4   4   4   4   4 |     CCG   0   0   0   0   0   0 |     CAG   0   0   0   0   0   0 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   2   2   2   2   2 | Thr ACT   2   2   2   2   2   2 | Asn AAT   0   0   0   0   0   0 | Ser AGT   4   4   4   4   4   4
    ATC   3   3   3   3   3   3 |     ACC   1   1   1   1   1   1 |     AAC   2   2   2   2   2   2 |     AGC   2   2   2   2   2   2
    ATA   5   5   5   4   5   6 |     ACA   2   2   2   2   2   2 | Lys AAA   2   2   2   2   2   2 | Arg AGA   2   2   2   2   2   2
Met ATG   6   6   6   7   7   5 |     ACG   0   0   0   0   0   0 |     AAG   4   4   4   4   4   4 |     AGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   2   1   1   1   1 | Ala GCT   4   4   4   4   4   4 | Asp GAT   6   6   7   6   6   6 | Gly GGT   4   4   4   4   4   4
    GTC   5   4   5   5   5   5 |     GCC   3   3   3   3   3   3 |     GAC   3   3   3   3   3   3 |     GGC   2   2   2   2   2   2
    GTA   3   2   2   2   2   2 |     GCA   3   4   4   4   4   4 | Glu GAA   4   4   4   4   4   4 |     GGA   5   5   5   5   5   5
    GTG   6   6   6   6   5   6 |     GCG   4   4   4   4   4   4 |     GAG   4   3   3   4   4   4 |     GGG   2   3   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------

----------------------------------------------------------------------
Phe TTT   1   1 | Ser TCT   0   0 | Tyr TAT   0   0 | Cys TGT   1   1
    TTC   2   2 |     TCC   1   1 |     TAC   4   4 |     TGC   1   1
Leu TTA   0   0 |     TCA   1   1 | *** TAA   0   0 | *** TGA   0   0
    TTG   1   1 |     TCG   0   0 |     TAG   0   0 | Trp TGG   3   3
----------------------------------------------------------------------
Leu CTT   0   0 | Pro CCT   1   0 | His CAT   0   0 | Arg CGT   0   0
    CTC   3   3 |     CCC   6   7 |     CAC   0   0 |     CGC   0   0
    CTA   2   2 |     CCA   1   1 | Gln CAA   0   0 |     CGA   0   0
    CTG   4   4 |     CCG   0   0 |     CAG   0   0 |     CGG   1   1
----------------------------------------------------------------------
Ile ATT   2   1 | Thr ACT   2   3 | Asn AAT   0   0 | Ser AGT   4   4
    ATC   3   3 |     ACC   1   1 |     AAC   2   2 |     AGC   2   2
    ATA   5   5 |     ACA   3   2 | Lys AAA   2   3 | Arg AGA   2   2
Met ATG   6   6 |     ACG   0   0 |     AAG   4   3 |     AGG   1   1
----------------------------------------------------------------------
Val GTT   1   1 | Ala GCT   4   4 | Asp GAT   5   6 | Gly GGT   4   4
    GTC   5   5 |     GCC   3   3 |     GAC   4   3 |     GGC   2   2
    GTA   2   2 |     GCA   3   5 | Glu GAA   4   4 |     GGA   5   5
    GTG   6   6 |     GCG   4   3 |     GAG   4   4 |     GGG   2   2
----------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.22308    C:0.26923    A:0.24615    G:0.26154
Average         T:0.22308    C:0.21282    A:0.25385    G:0.31026

#2: gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.28462    G:0.46154
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.23846    C:0.23077    A:0.24615    G:0.28462
Average         T:0.22821    C:0.20000    A:0.25128    G:0.32051

#3: gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.28462    G:0.46154
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.20000    C:0.29231    A:0.23077    G:0.27692
Average         T:0.21538    C:0.22051    A:0.24615    G:0.31795

#4: gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.10769    C:0.13846    A:0.29231    G:0.46154
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.23077    C:0.23846    A:0.24615    G:0.28462
Average         T:0.22308    C:0.20256    A:0.25385    G:0.32051

#5: gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.30000    G:0.44615
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.21538    C:0.27692    A:0.22308    G:0.28462
Average         T:0.22051    C:0.21538    A:0.24872    G:0.31538

#6: gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.28462    G:0.46154
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.22308    C:0.26923    A:0.23846    G:0.26923
Average         T:0.22308    C:0.21282    A:0.24872    G:0.31538

#7: gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.33846    C:0.22308    A:0.22308    G:0.21538
position  3:    T:0.20000    C:0.29231    A:0.23077    G:0.27692
Average         T:0.21795    C:0.21795    A:0.24872    G:0.31538

#8: gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.33077    C:0.23077    A:0.21538    G:0.22308
position  3:    T:0.20769    C:0.28462    A:0.23077    G:0.27692
Average         T:0.21795    C:0.21795    A:0.24615    G:0.31795

#9: gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B             
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.20769    C:0.29231    A:0.23077    G:0.26923
Average         T:0.21795    C:0.22051    A:0.24872    G:0.31282

#10: gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B            
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.20000    C:0.29231    A:0.22308    G:0.28462
Average         T:0.21538    C:0.22051    A:0.24615    G:0.31795

#11: gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B            
position  1:    T:0.11538    C:0.13846    A:0.30000    G:0.44615
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.20769    C:0.28462    A:0.23077    G:0.27692
Average         T:0.21795    C:0.21795    A:0.25128    G:0.31282

#12: gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B            
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.20769    C:0.28462    A:0.23846    G:0.26923
Average         T:0.21795    C:0.21795    A:0.25128    G:0.31282

#13: gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B            
position  1:    T:0.11538    C:0.13846    A:0.30000    G:0.44615
position  2:    T:0.33077    C:0.23077    A:0.22308    G:0.21538
position  3:    T:0.19231    C:0.30000    A:0.23077    G:0.27692
Average         T:0.21282    C:0.22308    A:0.25128    G:0.31282

#14: gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B            
position  1:    T:0.11538    C:0.13846    A:0.29231    G:0.45385
position  2:    T:0.32308    C:0.23846    A:0.22308    G:0.21538
position  3:    T:0.19231    C:0.30000    A:0.24615    G:0.26154
Average         T:0.21026    C:0.22564    A:0.25385    G:0.31026

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      14 | Ser S TCT       1 | Tyr Y TAT       8 | Cys C TGT      15
      TTC      28 |       TCC      13 |       TAC      48 |       TGC      13
Leu L TTA       0 |       TCA      12 | *** * TAA       0 | *** * TGA       0
      TTG      14 |       TCG       1 |       TAG       0 | Trp W TGG      42
------------------------------------------------------------------------------
Leu L CTT       6 | Pro P CCT      19 | His H CAT       0 | Arg R CGT       0
      CTC      36 |       CCC      77 |       CAC       0 |       CGC       0
      CTA      30 |       CCA      16 | Gln Q CAA       0 |       CGA       0
      CTG      54 |       CCG       0 |       CAG       0 |       CGG      14
------------------------------------------------------------------------------
Ile I ATT      26 | Thr T ACT      29 | Asn N AAT       0 | Ser S AGT      61
      ATC      44 |       ACC      11 |       AAC      28 |       AGC      22
      ATA      70 |       ACA      29 | Lys K AAA      32 | Arg R AGA      28
Met M ATG      85 |       ACG       1 |       AAG      52 |       AGG      14
------------------------------------------------------------------------------
Val V GTT      16 | Ala A GCT      55 | Asp D GAT      81 | Gly G GGT      52
      GTC      65 |       GCC      46 |       GAC      44 |       GGC      33
      GTA      28 |       GCA      59 | Glu E GAA      56 |       GGA      68
      GTG      86 |       GCG      51 |       GAG      56 |       GGG      31
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.11484    C:0.13846    A:0.29231    G:0.45440
position  2:    T:0.33077    C:0.23077    A:0.22253    G:0.21593
position  3:    T:0.21044    C:0.27912    A:0.23516    G:0.27527
Average         T:0.21868    C:0.21612    A:0.25000    G:0.31520


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                  
gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0125 (0.0068 0.5472)
gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0628 (0.0034 0.0542) 0.0204 (0.0103 0.5023)
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0173 (0.0102 0.5929) 0.0439 (0.0034 0.0774) 0.0252 (0.0137 0.5450)
gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0178 (0.0034 0.1906) 0.0194 (0.0102 0.5275) 0.0386 (0.0068 0.1765) 0.0259 (0.0137 0.5281)
gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0337 (0.0034 0.1010) 0.0073 (0.0034 0.4648) 0.0769 (0.0068 0.0887) 0.0135 (0.0068 0.5055) 0.0879 (0.0068 0.0775)
gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0625 (0.0034 0.0544) 0.0203 (0.0102 0.5049)-1.0000 (0.0068 0.0000) 0.0250 (0.0137 0.5479) 0.0384 (0.0068 0.1772) 0.0765 (0.0068 0.0891)
gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0790 (0.0034 0.0431) 0.0204 (0.0103 0.5026) 0.6506 (0.0068 0.0105) 0.0251 (0.0137 0.5454) 0.0359 (0.0068 0.1900) 0.0678 (0.0068 0.1006) 0.6475 (0.0068 0.0105)
gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                   0.0625 (0.0034 0.0544) 0.0203 (0.0102 0.5052)-1.0000 (0.0068 0.0000) 0.0250 (0.0137 0.5483) 0.0384 (0.0068 0.1773) 0.0765 (0.0068 0.0891)-1.0000 (0.0068 0.0000) 0.6471 (0.0068 0.0105)
gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                  0.0622 (0.0034 0.0546) 0.0202 (0.0102 0.5075)-1.0000 (0.0068 0.0000) 0.0248 (0.0137 0.5509) 0.0382 (0.0068 0.1779) 0.0761 (0.0068 0.0894)-1.0000 (0.0068 0.0000) 0.6444 (0.0068 0.0106)-1.0000 (0.0068 0.0000)
gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                  0.0513 (0.0034 0.0662) 0.0210 (0.0102 0.4883) 0.6432 (0.0068 0.0106) 0.0258 (0.0137 0.5306) 0.0354 (0.0068 0.1918) 0.0670 (0.0068 0.1016) 0.6401 (0.0068 0.0106) 0.3191 (0.0068 0.0213) 0.6397 (0.0068 0.0106) 0.6370 (0.0068 0.0107)
gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                  0.0519 (0.0034 0.0655) 0.0196 (0.0103 0.5230) 0.6510 (0.0068 0.0105) 0.0242 (0.0137 0.5670) 0.0359 (0.0068 0.1899) 0.0678 (0.0068 0.1006) 0.6479 (0.0068 0.0105) 0.3230 (0.0068 0.0211) 0.6475 (0.0068 0.0105) 0.6448 (0.0068 0.0106) 0.3193 (0.0068 0.0213)
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                  0.0517 (0.0034 0.0658) 0.0211 (0.0102 0.4846) 0.6479 (0.0068 0.0105) 0.0260 (0.0137 0.5264) 0.0357 (0.0068 0.1906) 0.0675 (0.0068 0.1010) 0.6448 (0.0068 0.0106) 0.3215 (0.0068 0.0212) 0.6444 (0.0068 0.0106) 0.6416 (0.0068 0.0106) 0.3178 (0.0068 0.0214) 0.3216 (0.0068 0.0212)
gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B                  0.0789 (0.0034 0.0431) 0.0196 (0.0103 0.5244) 0.2134 (0.0068 0.0320) 0.0241 (0.0137 0.5685) 0.0416 (0.0068 0.1637) 0.0884 (0.0068 0.0772) 0.2124 (0.0068 0.0321) 0.1588 (0.0068 0.0430) 0.2123 (0.0068 0.0321) 0.2113 (0.0068 0.0322) 0.1570 (0.0068 0.0434) 0.1589 (0.0068 0.0430) 0.1581 (0.0068 0.0431)


Model 0: one-ratio


TREE #  1:  (1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
check convergence..
lnL(ntime: 18  np: 20):   -859.067805      +0.000000
  15..1    15..14   15..16   16..3    16..7    16..8    16..9    16..10   16..11   16..12   16..13   15..17   17..18   18..2    18..4    17..19   19..5    19..6  
 0.024825 0.016549 0.016506 0.008193 0.008189 0.016484 0.008270 0.008210 0.016605 0.016506 0.016561 0.045767 0.349591 0.010478 0.057650 0.010599 0.074766 0.003094 16.522844 0.087510

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.70884

(1: 0.024825, 14: 0.016549, (3: 0.008193, 7: 0.008189, 8: 0.016484, 9: 0.008270, 10: 0.008210, 11: 0.016605, 12: 0.016506, 13: 0.016561): 0.016506, ((2: 0.010478, 4: 0.057650): 0.349591, (5: 0.074766, 6: 0.003094): 0.010599): 0.045767);

(gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.024825, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016549, (gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008193, gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008189, gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016484, gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008270, gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008210, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016605, gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016506, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016561): 0.016506, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.010478, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.057650): 0.349591, (gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.074766, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.003094): 0.010599): 0.045767);

Detailed output identifying parameters

kappa (ts/tv) = 16.52284

omega (dN/dS) =  0.08751

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  15..1      0.025   263.3   126.7  0.0875  0.0019  0.0216   0.5   2.7
  15..14     0.017   263.3   126.7  0.0875  0.0013  0.0144   0.3   1.8
  15..16     0.017   263.3   126.7  0.0875  0.0013  0.0143   0.3   1.8
  16..3      0.008   263.3   126.7  0.0875  0.0006  0.0071   0.2   0.9
  16..7      0.008   263.3   126.7  0.0875  0.0006  0.0071   0.2   0.9
  16..8      0.016   263.3   126.7  0.0875  0.0013  0.0143   0.3   1.8
  16..9      0.008   263.3   126.7  0.0875  0.0006  0.0072   0.2   0.9
  16..10     0.008   263.3   126.7  0.0875  0.0006  0.0071   0.2   0.9
  16..11     0.017   263.3   126.7  0.0875  0.0013  0.0144   0.3   1.8
  16..12     0.017   263.3   126.7  0.0875  0.0013  0.0143   0.3   1.8
  16..13     0.017   263.3   126.7  0.0875  0.0013  0.0144   0.3   1.8
  15..17     0.046   263.3   126.7  0.0875  0.0035  0.0397   0.9   5.0
  17..18     0.350   263.3   126.7  0.0875  0.0266  0.3036   7.0  38.5
  18..2      0.010   263.3   126.7  0.0875  0.0008  0.0091   0.2   1.2
  18..4      0.058   263.3   126.7  0.0875  0.0044  0.0501   1.2   6.3
  17..19     0.011   263.3   126.7  0.0875  0.0008  0.0092   0.2   1.2
  19..5      0.075   263.3   126.7  0.0875  0.0057  0.0649   1.5   8.2
  19..6      0.003   263.3   126.7  0.0875  0.0002  0.0027   0.1   0.3

tree length for dN:       0.0539
tree length for dS:       0.6155


Time used:  0:10


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
lnL(ntime: 18  np: 21):   -858.704058      +0.000000
  15..1    15..14   15..16   16..3    16..7    16..8    16..9    16..10   16..11   16..12   16..13   15..17   17..18   18..2    18..4    17..19   19..5    19..6  
 0.024768 0.016507 0.016466 0.008172 0.008171 0.016444 0.008249 0.008187 0.016556 0.016466 0.016527 0.045085 0.354041 0.010430 0.057539 0.011442 0.074896 0.002802 16.625571 0.967605 0.064506

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.71275

(1: 0.024768, 14: 0.016507, (3: 0.008172, 7: 0.008171, 8: 0.016444, 9: 0.008249, 10: 0.008187, 11: 0.016556, 12: 0.016466, 13: 0.016527): 0.016466, ((2: 0.010430, 4: 0.057539): 0.354041, (5: 0.074896, 6: 0.002802): 0.011442): 0.045085);

(gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.024768, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016507, (gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008172, gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008171, gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016444, gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008249, gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008187, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016556, gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016466, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016527): 0.016466, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.010430, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.057539): 0.354041, (gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.074896, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.002802): 0.011442): 0.045085);

Detailed output identifying parameters

kappa (ts/tv) = 16.62557


dN/dS (w) for site classes (K=2)

p:   0.96760  0.03240
w:   0.06451  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  15..1       0.025    263.3    126.7   0.0948   0.0020   0.0212    0.5    2.7
  15..14      0.017    263.3    126.7   0.0948   0.0013   0.0142    0.4    1.8
  15..16      0.016    263.3    126.7   0.0948   0.0013   0.0141    0.4    1.8
  16..3       0.008    263.3    126.7   0.0948   0.0007   0.0070    0.2    0.9
  16..7       0.008    263.3    126.7   0.0948   0.0007   0.0070    0.2    0.9
  16..8       0.016    263.3    126.7   0.0948   0.0013   0.0141    0.4    1.8
  16..9       0.008    263.3    126.7   0.0948   0.0007   0.0071    0.2    0.9
  16..10      0.008    263.3    126.7   0.0948   0.0007   0.0070    0.2    0.9
  16..11      0.017    263.3    126.7   0.0948   0.0013   0.0142    0.4    1.8
  16..12      0.016    263.3    126.7   0.0948   0.0013   0.0141    0.4    1.8
  16..13      0.017    263.3    126.7   0.0948   0.0013   0.0142    0.4    1.8
  15..17      0.045    263.3    126.7   0.0948   0.0037   0.0386    1.0    4.9
  17..18      0.354    263.3    126.7   0.0948   0.0288   0.3035    7.6   38.4
  18..2       0.010    263.3    126.7   0.0948   0.0008   0.0089    0.2    1.1
  18..4       0.058    263.3    126.7   0.0948   0.0047   0.0493    1.2    6.2
  17..19      0.011    263.3    126.7   0.0948   0.0009   0.0098    0.2    1.2
  19..5       0.075    263.3    126.7   0.0948   0.0061   0.0642    1.6    8.1
  19..6       0.003    263.3    126.7   0.0948   0.0002   0.0024    0.1    0.3


Time used:  0:26


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
lnL(ntime: 18  np: 23):   -858.704058      +0.000000
  15..1    15..14   15..16   16..3    16..7    16..8    16..9    16..10   16..11   16..12   16..13   15..17   17..18   18..2    18..4    17..19   19..5    19..6  
 0.024768 0.016507 0.016466 0.008172 0.008171 0.016444 0.008249 0.008187 0.016556 0.016466 0.016527 0.045085 0.354042 0.010430 0.057539 0.011442 0.074896 0.002802 16.625572 0.967605 0.009428 0.064506 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.71275

(1: 0.024768, 14: 0.016507, (3: 0.008172, 7: 0.008171, 8: 0.016444, 9: 0.008249, 10: 0.008187, 11: 0.016556, 12: 0.016466, 13: 0.016527): 0.016466, ((2: 0.010430, 4: 0.057539): 0.354042, (5: 0.074896, 6: 0.002802): 0.011442): 0.045085);

(gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.024768, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016507, (gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008172, gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008171, gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016444, gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008249, gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008187, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016556, gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016466, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016527): 0.016466, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.010430, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.057539): 0.354042, (gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.074896, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.002802): 0.011442): 0.045085);

Detailed output identifying parameters

kappa (ts/tv) = 16.62557


dN/dS (w) for site classes (K=3)

p:   0.96760  0.00943  0.02297
w:   0.06451  1.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  15..1       0.025    263.3    126.7   0.0948   0.0020   0.0212    0.5    2.7
  15..14      0.017    263.3    126.7   0.0948   0.0013   0.0142    0.4    1.8
  15..16      0.016    263.3    126.7   0.0948   0.0013   0.0141    0.4    1.8
  16..3       0.008    263.3    126.7   0.0948   0.0007   0.0070    0.2    0.9
  16..7       0.008    263.3    126.7   0.0948   0.0007   0.0070    0.2    0.9
  16..8       0.016    263.3    126.7   0.0948   0.0013   0.0141    0.4    1.8
  16..9       0.008    263.3    126.7   0.0948   0.0007   0.0071    0.2    0.9
  16..10      0.008    263.3    126.7   0.0948   0.0007   0.0070    0.2    0.9
  16..11      0.017    263.3    126.7   0.0948   0.0013   0.0142    0.4    1.8
  16..12      0.016    263.3    126.7   0.0948   0.0013   0.0141    0.4    1.8
  16..13      0.017    263.3    126.7   0.0948   0.0013   0.0142    0.4    1.8
  15..17      0.045    263.3    126.7   0.0948   0.0037   0.0386    1.0    4.9
  17..18      0.354    263.3    126.7   0.0948   0.0288   0.3035    7.6   38.4
  18..2       0.010    263.3    126.7   0.0948   0.0008   0.0089    0.2    1.1
  18..4       0.058    263.3    126.7   0.0948   0.0047   0.0493    1.2    6.2
  17..19      0.011    263.3    126.7   0.0948   0.0009   0.0098    0.2    1.2
  19..5       0.075    263.3    126.7   0.0948   0.0061   0.0642    1.6    8.1
  19..6       0.003    263.3    126.7   0.0948   0.0002   0.0024    0.1    0.3


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.992  0.008  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.528  0.194  0.092  0.053  0.035  0.026  0.021  0.018  0.016  0.015

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.041
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.048 0.907

sum of density on p0-p1 =   1.000000

Time used:  0:59


Model 3: discrete (3 categories)


TREE #  1:  (1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
lnL(ntime: 18  np: 24):   -858.309693      +0.000000
  15..1    15..14   15..16   16..3    16..7    16..8    16..9    16..10   16..11   16..12   16..13   15..17   17..18   18..2    18..4    17..19   19..5    19..6  
 0.024787 0.016524 0.016480 0.008180 0.008176 0.016459 0.008258 0.008194 0.016568 0.016484 0.016537 0.045539 0.352731 0.010404 0.057632 0.010746 0.074711 0.003113 16.625284 0.612192 0.187987 0.000001 0.228606 0.228606

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.71152

(1: 0.024787, 14: 0.016524, (3: 0.008180, 7: 0.008176, 8: 0.016459, 9: 0.008258, 10: 0.008194, 11: 0.016568, 12: 0.016484, 13: 0.016537): 0.016480, ((2: 0.010404, 4: 0.057632): 0.352731, (5: 0.074711, 6: 0.003113): 0.010746): 0.045539);

(gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.024787, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016524, (gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008180, gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008176, gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016459, gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008258, gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008194, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016568, gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016484, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016537): 0.016480, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.010404, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.057632): 0.352731, (gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.074711, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.003113): 0.010746): 0.045539);

Detailed output identifying parameters

kappa (ts/tv) = 16.62528


dN/dS (w) for site classes (K=3)

p:   0.61219  0.18799  0.19982
w:   0.00000  0.22861  0.22861

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  15..1       0.025    263.3    126.7   0.0887   0.0019   0.0215    0.5    2.7
  15..14      0.017    263.3    126.7   0.0887   0.0013   0.0143    0.3    1.8
  15..16      0.016    263.3    126.7   0.0887   0.0013   0.0143    0.3    1.8
  16..3       0.008    263.3    126.7   0.0887   0.0006   0.0071    0.2    0.9
  16..7       0.008    263.3    126.7   0.0887   0.0006   0.0071    0.2    0.9
  16..8       0.016    263.3    126.7   0.0887   0.0013   0.0143    0.3    1.8
  16..9       0.008    263.3    126.7   0.0887   0.0006   0.0072    0.2    0.9
  16..10      0.008    263.3    126.7   0.0887   0.0006   0.0071    0.2    0.9
  16..11      0.017    263.3    126.7   0.0887   0.0013   0.0144    0.3    1.8
  16..12      0.016    263.3    126.7   0.0887   0.0013   0.0143    0.3    1.8
  16..13      0.017    263.3    126.7   0.0887   0.0013   0.0143    0.3    1.8
  15..17      0.046    263.3    126.7   0.0887   0.0035   0.0395    0.9    5.0
  17..18      0.353    263.3    126.7   0.0887   0.0271   0.3056    7.1   38.7
  18..2       0.010    263.3    126.7   0.0887   0.0008   0.0090    0.2    1.1
  18..4       0.058    263.3    126.7   0.0887   0.0044   0.0499    1.2    6.3
  17..19      0.011    263.3    126.7   0.0887   0.0008   0.0093    0.2    1.2
  19..5       0.075    263.3    126.7   0.0887   0.0057   0.0647    1.5    8.2
  19..6       0.003    263.3    126.7   0.0887   0.0002   0.0027    0.1    0.3


Naive Empirical Bayes (NEB) analysis
Time used:  1:22


Model 7: beta (10 categories)


TREE #  1:  (1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
lnL(ntime: 18  np: 21):   -858.363478      +0.000000
  15..1    15..14   15..16   16..3    16..7    16..8    16..9    16..10   16..11   16..12   16..13   15..17   17..18   18..2    18..4    17..19   19..5    19..6  
 0.024787 0.016523 0.016480 0.008179 0.008176 0.016458 0.008258 0.008194 0.016569 0.016483 0.016538 0.045458 0.353019 0.010400 0.057633 0.010849 0.074727 0.003089 16.622417 0.356970 3.488428

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.71182

(1: 0.024787, 14: 0.016523, (3: 0.008179, 7: 0.008176, 8: 0.016458, 9: 0.008258, 10: 0.008194, 11: 0.016569, 12: 0.016483, 13: 0.016538): 0.016480, ((2: 0.010400, 4: 0.057633): 0.353019, (5: 0.074727, 6: 0.003089): 0.010849): 0.045458);

(gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.024787, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016523, (gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008179, gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008176, gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016458, gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008258, gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008194, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016569, gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016483, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016538): 0.016480, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.010400, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.057633): 0.353019, (gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.074727, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.003089): 0.010849): 0.045458);

Detailed output identifying parameters

kappa (ts/tv) = 16.62242

Parameters in M7 (beta):
 p =   0.35697  q =   3.48843


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00005  0.00112  0.00472  0.01228  0.02543  0.04635  0.07844  0.12798  0.20981  0.38322

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  15..1       0.025    263.3    126.7   0.0889   0.0019   0.0215    0.5    2.7
  15..14      0.017    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  15..16      0.016    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..3       0.008    263.3    126.7   0.0889   0.0006   0.0071    0.2    0.9
  16..7       0.008    263.3    126.7   0.0889   0.0006   0.0071    0.2    0.9
  16..8       0.016    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..9       0.008    263.3    126.7   0.0889   0.0006   0.0072    0.2    0.9
  16..10      0.008    263.3    126.7   0.0889   0.0006   0.0071    0.2    0.9
  16..11      0.017    263.3    126.7   0.0889   0.0013   0.0144    0.3    1.8
  16..12      0.016    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..13      0.017    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  15..17      0.045    263.3    126.7   0.0889   0.0035   0.0394    0.9    5.0
  17..18      0.353    263.3    126.7   0.0889   0.0272   0.3057    7.2   38.7
  18..2       0.010    263.3    126.7   0.0889   0.0008   0.0090    0.2    1.1
  18..4       0.058    263.3    126.7   0.0889   0.0044   0.0499    1.2    6.3
  17..19      0.011    263.3    126.7   0.0889   0.0008   0.0094    0.2    1.2
  19..5       0.075    263.3    126.7   0.0889   0.0058   0.0647    1.5    8.2
  19..6       0.003    263.3    126.7   0.0889   0.0002   0.0027    0.1    0.3


Time used:  2:52


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 14, (3, 7, 8, 9, 10, 11, 12, 13), ((2, 4), (5, 6)));   MP score: 73
lnL(ntime: 18  np: 23):   -858.363546      +0.000000
  15..1    15..14   15..16   16..3    16..7    16..8    16..9    16..10   16..11   16..12   16..13   15..17   17..18   18..2    18..4    17..19   19..5    19..6  
 0.024787 0.016523 0.016480 0.008179 0.008176 0.016458 0.008258 0.008194 0.016569 0.016483 0.016538 0.045458 0.353019 0.010400 0.057633 0.010849 0.074727 0.003089 16.622436 0.999990 0.357006 3.489053 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.71182

(1: 0.024787, 14: 0.016523, (3: 0.008179, 7: 0.008176, 8: 0.016458, 9: 0.008258, 10: 0.008194, 11: 0.016569, 12: 0.016483, 13: 0.016538): 0.016480, ((2: 0.010400, 4: 0.057633): 0.353019, (5: 0.074727, 6: 0.003089): 0.010849): 0.045458);

(gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.024787, gb:KU179098|Organism:Zika_virus|Strain_Name:JMB-185|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016523, (gb:KX421195|Organism:Zika_virus|Strain_Name:Nica1-16|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008179, gb:KX447514|Organism:Zika_virus|Strain_Name:1_0035_PF|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008176, gb:MF574576|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00014/2015|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016458, gb:MF434516|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NIC/1304_13A1/2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008258, gb:MF098766|Organism:Zika_virus|Strain_Name:Dominican_Rep-Rus-5RMN-2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.008194, gb:KY967711|Organism:Zika_virus|Strain_Name:SY01_2016|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016569, gb:KU926309|Organism:Zika_virus|Strain_Name:Rio-U1|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016483, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.016538): 0.016480, ((gb:KU955591|Organism:Zika_virus|Strain_Name:Zika_virus/A.africanus-tc/SEN/1984/41525-DAK|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.010400, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.057633): 0.353019, (gb:KY553111|Organism:Zika_virus|Strain_Name:AFMC-U|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.074727, gb:KU955593|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/KHM/2010/FSS13025|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B: 0.003089): 0.010849): 0.045458);

Detailed output identifying parameters

kappa (ts/tv) = 16.62244

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =   0.35701 q =   3.48905
 (p1 =   0.00001) w =   1.00000


dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.00005  0.00112  0.00472  0.01228  0.02543  0.04635  0.07843  0.12797  0.20979  0.38318  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  15..1       0.025    263.3    126.7   0.0889   0.0019   0.0215    0.5    2.7
  15..14      0.017    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  15..16      0.016    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..3       0.008    263.3    126.7   0.0889   0.0006   0.0071    0.2    0.9
  16..7       0.008    263.3    126.7   0.0889   0.0006   0.0071    0.2    0.9
  16..8       0.016    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..9       0.008    263.3    126.7   0.0889   0.0006   0.0072    0.2    0.9
  16..10      0.008    263.3    126.7   0.0889   0.0006   0.0071    0.2    0.9
  16..11      0.017    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..12      0.016    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  16..13      0.017    263.3    126.7   0.0889   0.0013   0.0143    0.3    1.8
  15..17      0.045    263.3    126.7   0.0889   0.0035   0.0394    0.9    5.0
  17..18      0.353    263.3    126.7   0.0889   0.0272   0.3057    7.2   38.7
  18..2       0.010    263.3    126.7   0.0889   0.0008   0.0090    0.2    1.1
  18..4       0.058    263.3    126.7   0.0889   0.0044   0.0499    1.2    6.3
  17..19      0.011    263.3    126.7   0.0889   0.0008   0.0094    0.2    1.2
  19..5       0.075    263.3    126.7   0.0889   0.0058   0.0647    1.5    8.2
  19..6       0.003    263.3    126.7   0.0889   0.0002   0.0027    0.1    0.3


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KY241783|Organism:Zika_virus|Strain_Name:ZIKV-SG-113|Protein_Name:nonstructural_protein_NS2B|Gene_Symbol:NS2B)

            Pr(w>1)     post mean +- SE for w

    16 A      0.509         1.281 +- 1.173



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.001  0.999
p :   0.981  0.019  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.002  0.015  0.047  0.092  0.142  0.190  0.235  0.277
ws:   0.649  0.174  0.068  0.035  0.021  0.015  0.012  0.010  0.008  0.008

Time used:  4:49
Download 
Model 1: NearlyNeutral	-858.704058
Model 2: PositiveSelection	-858.704058
Model 0: one-ratio	-859.067805
Model 3: discrete	-858.309693
Model 7: beta	-858.363478
Model 8: beta&w>1	-858.363546


Model 0 vs 1	0.7274939999999788

Model 2 vs 1	0.0

Model 8 vs 7	1.3600000011138036E-4

i3S

Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal

If you use B+, please cite us:

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3

IBMC INEB IPATIMUP UPORTO