Back

A_M - Muscle

Download 
--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Nov 06 09:43:47 WET 2017
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS1/ZikaADOPSresults/M/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -887.53          -913.93
2       -887.57          -913.11
--------------------------------------
TOTAL     -887.55          -913.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         1.300527    0.043026    0.915982    1.704101    1.280521   1165.79   1316.67    1.000
r(A<->C){all}   0.058255    0.000512    0.019518    0.105700    0.055677    654.21    714.43    1.000
r(A<->G){all}   0.127391    0.001397    0.061657    0.201820    0.123346    808.09    815.21    1.000
r(A<->T){all}   0.051789    0.000687    0.006683    0.103001    0.048009    696.51    797.61    1.000
r(C<->G){all}   0.031111    0.000259    0.004645    0.063440    0.028918    966.08    979.90    1.000
r(C<->T){all}   0.675380    0.003695    0.558757    0.791371    0.679130    641.62    712.42    1.000
r(G<->T){all}   0.056074    0.000575    0.015137    0.104595    0.052951    807.70    873.45    1.000
pi(A){all}      0.259548    0.000681    0.203418    0.306126    0.258711    801.38    872.05    1.000
pi(C){all}      0.265909    0.000615    0.217328    0.313980    0.265031   1086.55   1130.95    1.000
pi(G){all}      0.234106    0.000622    0.183494    0.280000    0.233549   1019.79   1159.56    1.000
pi(T){all}      0.240437    0.000557    0.193100    0.286278    0.239537   1112.39   1132.00    1.000
alpha{1,2}      0.270047    0.005681    0.145839    0.412255    0.256582    989.21   1119.05    1.000
alpha{3}        2.172421    0.611152    0.921732    3.784606    2.050679   1429.54   1446.20    1.000
pinvar{all}     0.072886    0.003304    0.000048    0.183398    0.059947   1215.79   1321.85    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-846.030213
Model 2: PositiveSelection	-846.029786
Model 0: one-ratio	-846.029786
Model 3: discrete	-846.029786
Model 7: beta	-846.205842
Model 8: beta&w>1	-846.206268


Model 0 vs 1	8.54000000117594E-4

Model 2 vs 1	8.54000000117594E-4

Model 8 vs 7	8.520000001226435E-4
Download 
>C1
SVSLRYHYTRKLQTRSQTWLESREYKKHLIMVENWIFRNPGFAIVSVAIT
WLMGSLTSQKVIYLVMIVLIVPAYS
>C2
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C3
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C4
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
WLLGSSTSQKVIYLIMILLIAPAYS
>C5
AVTLPSHSTRKLQARSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C6
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAVIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C7
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSKKVIYLVMILLIAPAYS
>C8
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTRQKVIYLVMILLIAPAYS
>C9
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C10
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C11
AVTLPSHSTRKLQTRPQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C12
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLFGSSTSQKVIYLVMILLIAPAYS
>C13
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C14
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C15
AVTLPSHSTRELQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C16
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVICLVMILLIAPAYS
>C17
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIALAYS
>C18
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRIENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C19
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFTLVAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=19, Len=75 

C1              SVSLRYHYTRKLQTRSQTWLESREYKKHLIMVENWIFRNPGFAIVSVAIT
C2              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C3              AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
C4              AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
C5              AVTLPSHSTRKLQARSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C6              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAVIA
C7              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C8              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C9              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIA
C10             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIA
C11             AVTLPSHSTRKLQTRPQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C12             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C13             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIA
C14             AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIA
C15             AVTLPSHSTRELQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C16             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C17             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C18             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRIENWIFRNPGFALAAAAIA
C19             AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFTLVAVAIA
                :*:*  * **:**:*.*********.**** :***::****:::.:..*:

C1              WLMGSLTSQKVIYLVMIVLIVPAYS
C2              WLLGSSTSQKVIYLVMILLIAPAYS
C3              WLLGSSTSQKVIYLVMILLIAPAYS
C4              WLLGSSTSQKVIYLIMILLIAPAYS
C5              WLLGSSTSQKVIYLVMILLIAPAYS
C6              WLLGSSTSQKVIYLVMILLIAPAYS
C7              WLLGSSTSKKVIYLVMILLIAPAYS
C8              WLLGSSTRQKVIYLVMILLIAPAYS
C9              WLLGSSTSQKVIYLVMILLIAPAYS
C10             WLLGSSTSQKVIYLVMILLIAPAYS
C11             WLLGSSTSQKVIYLVMILLIAPAYS
C12             WLFGSSTSQKVIYLVMILLIAPAYS
C13             WLLGSSTSQKVIYLVMILLIAPAYS
C14             WLLGSSTSQKVIYLVMILLIAPAYS
C15             WLLGSSTSQKVIYLVMILLIAPAYS
C16             WLLGSSTSQKVICLVMILLIAPAYS
C17             WLLGSSTSQKVIYLVMILLIALAYS
C18             WLLGSSTSQKVIYLVMILLIAPAYS
C19             WLLGSSTSQKVIYLVMILLIAPAYS
                **:** * :*** *:**:**. ***




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 19 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C16 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C17 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C18 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C19 Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length   75 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length   75 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [25650]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [25650]--->[25650]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.932 Mb, Max= 31.659 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              SVSLRYHYTRKLQTRSQTWLESREYKKHLIMVENWIFRNPGFAIVSVAIT
C2              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C3              AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
C4              AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
C5              AVTLPSHSTRKLQARSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C6              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAVIA
C7              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C8              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C9              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIA
C10             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIA
C11             AVTLPSHSTRKLQTRPQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C12             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C13             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIA
C14             AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIA
C15             AVTLPSHSTRELQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C16             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C17             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
C18             AVTLPSHSTRKLQTRSQTWLESREYTKHLIRIENWIFRNPGFALAAAAIA
C19             AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFTLVAVAIA
                :*:*  * **:**:*.*********.**** :***::****:::.:..*:

C1              WLMGSLTSQKVIYLVMIVLIVPAYS
C2              WLLGSSTSQKVIYLVMILLIAPAYS
C3              WLLGSSTSQKVIYLVMILLIAPAYS
C4              WLLGSSTSQKVIYLIMILLIAPAYS
C5              WLLGSSTSQKVIYLVMILLIAPAYS
C6              WLLGSSTSQKVIYLVMILLIAPAYS
C7              WLLGSSTSKKVIYLVMILLIAPAYS
C8              WLLGSSTRQKVIYLVMILLIAPAYS
C9              WLLGSSTSQKVIYLVMILLIAPAYS
C10             WLLGSSTSQKVIYLVMILLIAPAYS
C11             WLLGSSTSQKVIYLVMILLIAPAYS
C12             WLFGSSTSQKVIYLVMILLIAPAYS
C13             WLLGSSTSQKVIYLVMILLIAPAYS
C14             WLLGSSTSQKVIYLVMILLIAPAYS
C15             WLLGSSTSQKVIYLVMILLIAPAYS
C16             WLLGSSTSQKVICLVMILLIAPAYS
C17             WLLGSSTSQKVIYLVMILLIALAYS
C18             WLLGSSTSQKVIYLVMILLIAPAYS
C19             WLLGSSTSQKVIYLVMILLIAPAYS
                **:** * :*** *:**:**. ***




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# SEQ_INDEX C15 14
# SEQ_INDEX C16 15
# SEQ_INDEX C17 16
# SEQ_INDEX C18 17
# SEQ_INDEX C19 18
# PW_SEQ_DISTANCES 
BOT	    0    1	 78.67  C1	  C2	 78.67
TOP	    1    0	 78.67  C2	  C1	 78.67
BOT	    0    2	 80.00  C1	  C3	 80.00
TOP	    2    0	 80.00  C3	  C1	 80.00
BOT	    0    3	 78.67  C1	  C4	 78.67
TOP	    3    0	 78.67  C4	  C1	 78.67
BOT	    0    4	 77.33  C1	  C5	 77.33
TOP	    4    0	 77.33  C5	  C1	 77.33
BOT	    0    5	 77.33  C1	  C6	 77.33
TOP	    5    0	 77.33  C6	  C1	 77.33
BOT	    0    6	 77.33  C1	  C7	 77.33
TOP	    6    0	 77.33  C7	  C1	 77.33
BOT	    0    7	 77.33  C1	  C8	 77.33
TOP	    7    0	 77.33  C8	  C1	 77.33
BOT	    0    8	 77.33  C1	  C9	 77.33
TOP	    8    0	 77.33  C9	  C1	 77.33
BOT	    0    9	 77.33  C1	 C10	 77.33
TOP	    9    0	 77.33 C10	  C1	 77.33
BOT	    0   10	 77.33  C1	 C11	 77.33
TOP	   10    0	 77.33 C11	  C1	 77.33
BOT	    0   11	 78.67  C1	 C12	 78.67
TOP	   11    0	 78.67 C12	  C1	 78.67
BOT	    0   12	 77.33  C1	 C13	 77.33
TOP	   12    0	 77.33 C13	  C1	 77.33
BOT	    0   13	 81.33  C1	 C14	 81.33
TOP	   13    0	 81.33 C14	  C1	 81.33
BOT	    0   14	 77.33  C1	 C15	 77.33
TOP	   14    0	 77.33 C15	  C1	 77.33
BOT	    0   15	 77.33  C1	 C16	 77.33
TOP	   15    0	 77.33 C16	  C1	 77.33
BOT	    0   16	 77.33  C1	 C17	 77.33
TOP	   16    0	 77.33 C17	  C1	 77.33
BOT	    0   17	 77.33  C1	 C18	 77.33
TOP	   17    0	 77.33 C18	  C1	 77.33
BOT	    0   18	 80.00  C1	 C19	 80.00
TOP	   18    0	 80.00 C19	  C1	 80.00
BOT	    1    2	 97.33  C2	  C3	 97.33
TOP	    2    1	 97.33  C3	  C2	 97.33
BOT	    1    3	 96.00  C2	  C4	 96.00
TOP	    3    1	 96.00  C4	  C2	 96.00
BOT	    1    4	 98.67  C2	  C5	 98.67
TOP	    4    1	 98.67  C5	  C2	 98.67
BOT	    1    5	 98.67  C2	  C6	 98.67
TOP	    5    1	 98.67  C6	  C2	 98.67
BOT	    1    6	 98.67  C2	  C7	 98.67
TOP	    6    1	 98.67  C7	  C2	 98.67
BOT	    1    7	 98.67  C2	  C8	 98.67
TOP	    7    1	 98.67  C8	  C2	 98.67
BOT	    1    8	 98.67  C2	  C9	 98.67
TOP	    8    1	 98.67  C9	  C2	 98.67
BOT	    1    9	 98.67  C2	 C10	 98.67
TOP	    9    1	 98.67 C10	  C2	 98.67
BOT	    1   10	 98.67  C2	 C11	 98.67
TOP	   10    1	 98.67 C11	  C2	 98.67
BOT	    1   11	 98.67  C2	 C12	 98.67
TOP	   11    1	 98.67 C12	  C2	 98.67
BOT	    1   12	 98.67  C2	 C13	 98.67
TOP	   12    1	 98.67 C13	  C2	 98.67
BOT	    1   13	 96.00  C2	 C14	 96.00
TOP	   13    1	 96.00 C14	  C2	 96.00
BOT	    1   14	 98.67  C2	 C15	 98.67
TOP	   14    1	 98.67 C15	  C2	 98.67
BOT	    1   15	 98.67  C2	 C16	 98.67
TOP	   15    1	 98.67 C16	  C2	 98.67
BOT	    1   16	 98.67  C2	 C17	 98.67
TOP	   16    1	 98.67 C17	  C2	 98.67
BOT	    1   17	 98.67  C2	 C18	 98.67
TOP	   17    1	 98.67 C18	  C2	 98.67
BOT	    1   18	 94.67  C2	 C19	 94.67
TOP	   18    1	 94.67 C19	  C2	 94.67
BOT	    2    3	 98.67  C3	  C4	 98.67
TOP	    3    2	 98.67  C4	  C3	 98.67
BOT	    2    4	 96.00  C3	  C5	 96.00
TOP	    4    2	 96.00  C5	  C3	 96.00
BOT	    2    5	 96.00  C3	  C6	 96.00
TOP	    5    2	 96.00  C6	  C3	 96.00
BOT	    2    6	 96.00  C3	  C7	 96.00
TOP	    6    2	 96.00  C7	  C3	 96.00
BOT	    2    7	 96.00  C3	  C8	 96.00
TOP	    7    2	 96.00  C8	  C3	 96.00
BOT	    2    8	 96.00  C3	  C9	 96.00
TOP	    8    2	 96.00  C9	  C3	 96.00
BOT	    2    9	 96.00  C3	 C10	 96.00
TOP	    9    2	 96.00 C10	  C3	 96.00
BOT	    2   10	 96.00  C3	 C11	 96.00
TOP	   10    2	 96.00 C11	  C3	 96.00
BOT	    2   11	 96.00  C3	 C12	 96.00
TOP	   11    2	 96.00 C12	  C3	 96.00
BOT	    2   12	 96.00  C3	 C13	 96.00
TOP	   12    2	 96.00 C13	  C3	 96.00
BOT	    2   13	 98.67  C3	 C14	 98.67
TOP	   13    2	 98.67 C14	  C3	 98.67
BOT	    2   14	 96.00  C3	 C15	 96.00
TOP	   14    2	 96.00 C15	  C3	 96.00
BOT	    2   15	 96.00  C3	 C16	 96.00
TOP	   15    2	 96.00 C16	  C3	 96.00
BOT	    2   16	 96.00  C3	 C17	 96.00
TOP	   16    2	 96.00 C17	  C3	 96.00
BOT	    2   17	 96.00  C3	 C18	 96.00
TOP	   17    2	 96.00 C18	  C3	 96.00
BOT	    2   18	 97.33  C3	 C19	 97.33
TOP	   18    2	 97.33 C19	  C3	 97.33
BOT	    3    4	 94.67  C4	  C5	 94.67
TOP	    4    3	 94.67  C5	  C4	 94.67
BOT	    3    5	 94.67  C4	  C6	 94.67
TOP	    5    3	 94.67  C6	  C4	 94.67
BOT	    3    6	 94.67  C4	  C7	 94.67
TOP	    6    3	 94.67  C7	  C4	 94.67
BOT	    3    7	 94.67  C4	  C8	 94.67
TOP	    7    3	 94.67  C8	  C4	 94.67
BOT	    3    8	 94.67  C4	  C9	 94.67
TOP	    8    3	 94.67  C9	  C4	 94.67
BOT	    3    9	 94.67  C4	 C10	 94.67
TOP	    9    3	 94.67 C10	  C4	 94.67
BOT	    3   10	 94.67  C4	 C11	 94.67
TOP	   10    3	 94.67 C11	  C4	 94.67
BOT	    3   11	 94.67  C4	 C12	 94.67
TOP	   11    3	 94.67 C12	  C4	 94.67
BOT	    3   12	 94.67  C4	 C13	 94.67
TOP	   12    3	 94.67 C13	  C4	 94.67
BOT	    3   13	 97.33  C4	 C14	 97.33
TOP	   13    3	 97.33 C14	  C4	 97.33
BOT	    3   14	 94.67  C4	 C15	 94.67
TOP	   14    3	 94.67 C15	  C4	 94.67
BOT	    3   15	 94.67  C4	 C16	 94.67
TOP	   15    3	 94.67 C16	  C4	 94.67
BOT	    3   16	 94.67  C4	 C17	 94.67
TOP	   16    3	 94.67 C17	  C4	 94.67
BOT	    3   17	 94.67  C4	 C18	 94.67
TOP	   17    3	 94.67 C18	  C4	 94.67
BOT	    3   18	 96.00  C4	 C19	 96.00
TOP	   18    3	 96.00 C19	  C4	 96.00
BOT	    4    5	 97.33  C5	  C6	 97.33
TOP	    5    4	 97.33  C6	  C5	 97.33
BOT	    4    6	 97.33  C5	  C7	 97.33
TOP	    6    4	 97.33  C7	  C5	 97.33
BOT	    4    7	 97.33  C5	  C8	 97.33
TOP	    7    4	 97.33  C8	  C5	 97.33
BOT	    4    8	 97.33  C5	  C9	 97.33
TOP	    8    4	 97.33  C9	  C5	 97.33
BOT	    4    9	 97.33  C5	 C10	 97.33
TOP	    9    4	 97.33 C10	  C5	 97.33
BOT	    4   10	 97.33  C5	 C11	 97.33
TOP	   10    4	 97.33 C11	  C5	 97.33
BOT	    4   11	 97.33  C5	 C12	 97.33
TOP	   11    4	 97.33 C12	  C5	 97.33
BOT	    4   12	 97.33  C5	 C13	 97.33
TOP	   12    4	 97.33 C13	  C5	 97.33
BOT	    4   13	 94.67  C5	 C14	 94.67
TOP	   13    4	 94.67 C14	  C5	 94.67
BOT	    4   14	 97.33  C5	 C15	 97.33
TOP	   14    4	 97.33 C15	  C5	 97.33
BOT	    4   15	 97.33  C5	 C16	 97.33
TOP	   15    4	 97.33 C16	  C5	 97.33
BOT	    4   16	 97.33  C5	 C17	 97.33
TOP	   16    4	 97.33 C17	  C5	 97.33
BOT	    4   17	 97.33  C5	 C18	 97.33
TOP	   17    4	 97.33 C18	  C5	 97.33
BOT	    4   18	 93.33  C5	 C19	 93.33
TOP	   18    4	 93.33 C19	  C5	 93.33
BOT	    5    6	 97.33  C6	  C7	 97.33
TOP	    6    5	 97.33  C7	  C6	 97.33
BOT	    5    7	 97.33  C6	  C8	 97.33
TOP	    7    5	 97.33  C8	  C6	 97.33
BOT	    5    8	 97.33  C6	  C9	 97.33
TOP	    8    5	 97.33  C9	  C6	 97.33
BOT	    5    9	 97.33  C6	 C10	 97.33
TOP	    9    5	 97.33 C10	  C6	 97.33
BOT	    5   10	 97.33  C6	 C11	 97.33
TOP	   10    5	 97.33 C11	  C6	 97.33
BOT	    5   11	 97.33  C6	 C12	 97.33
TOP	   11    5	 97.33 C12	  C6	 97.33
BOT	    5   12	 97.33  C6	 C13	 97.33
TOP	   12    5	 97.33 C13	  C6	 97.33
BOT	    5   13	 94.67  C6	 C14	 94.67
TOP	   13    5	 94.67 C14	  C6	 94.67
BOT	    5   14	 97.33  C6	 C15	 97.33
TOP	   14    5	 97.33 C15	  C6	 97.33
BOT	    5   15	 97.33  C6	 C16	 97.33
TOP	   15    5	 97.33 C16	  C6	 97.33
BOT	    5   16	 97.33  C6	 C17	 97.33
TOP	   16    5	 97.33 C17	  C6	 97.33
BOT	    5   17	 97.33  C6	 C18	 97.33
TOP	   17    5	 97.33 C18	  C6	 97.33
BOT	    5   18	 93.33  C6	 C19	 93.33
TOP	   18    5	 93.33 C19	  C6	 93.33
BOT	    6    7	 97.33  C7	  C8	 97.33
TOP	    7    6	 97.33  C8	  C7	 97.33
BOT	    6    8	 97.33  C7	  C9	 97.33
TOP	    8    6	 97.33  C9	  C7	 97.33
BOT	    6    9	 97.33  C7	 C10	 97.33
TOP	    9    6	 97.33 C10	  C7	 97.33
BOT	    6   10	 97.33  C7	 C11	 97.33
TOP	   10    6	 97.33 C11	  C7	 97.33
BOT	    6   11	 97.33  C7	 C12	 97.33
TOP	   11    6	 97.33 C12	  C7	 97.33
BOT	    6   12	 97.33  C7	 C13	 97.33
TOP	   12    6	 97.33 C13	  C7	 97.33
BOT	    6   13	 94.67  C7	 C14	 94.67
TOP	   13    6	 94.67 C14	  C7	 94.67
BOT	    6   14	 97.33  C7	 C15	 97.33
TOP	   14    6	 97.33 C15	  C7	 97.33
BOT	    6   15	 97.33  C7	 C16	 97.33
TOP	   15    6	 97.33 C16	  C7	 97.33
BOT	    6   16	 97.33  C7	 C17	 97.33
TOP	   16    6	 97.33 C17	  C7	 97.33
BOT	    6   17	 97.33  C7	 C18	 97.33
TOP	   17    6	 97.33 C18	  C7	 97.33
BOT	    6   18	 93.33  C7	 C19	 93.33
TOP	   18    6	 93.33 C19	  C7	 93.33
BOT	    7    8	 97.33  C8	  C9	 97.33
TOP	    8    7	 97.33  C9	  C8	 97.33
BOT	    7    9	 97.33  C8	 C10	 97.33
TOP	    9    7	 97.33 C10	  C8	 97.33
BOT	    7   10	 97.33  C8	 C11	 97.33
TOP	   10    7	 97.33 C11	  C8	 97.33
BOT	    7   11	 97.33  C8	 C12	 97.33
TOP	   11    7	 97.33 C12	  C8	 97.33
BOT	    7   12	 97.33  C8	 C13	 97.33
TOP	   12    7	 97.33 C13	  C8	 97.33
BOT	    7   13	 94.67  C8	 C14	 94.67
TOP	   13    7	 94.67 C14	  C8	 94.67
BOT	    7   14	 97.33  C8	 C15	 97.33
TOP	   14    7	 97.33 C15	  C8	 97.33
BOT	    7   15	 97.33  C8	 C16	 97.33
TOP	   15    7	 97.33 C16	  C8	 97.33
BOT	    7   16	 97.33  C8	 C17	 97.33
TOP	   16    7	 97.33 C17	  C8	 97.33
BOT	    7   17	 97.33  C8	 C18	 97.33
TOP	   17    7	 97.33 C18	  C8	 97.33
BOT	    7   18	 93.33  C8	 C19	 93.33
TOP	   18    7	 93.33 C19	  C8	 93.33
BOT	    8    9	 97.33  C9	 C10	 97.33
TOP	    9    8	 97.33 C10	  C9	 97.33
BOT	    8   10	 97.33  C9	 C11	 97.33
TOP	   10    8	 97.33 C11	  C9	 97.33
BOT	    8   11	 97.33  C9	 C12	 97.33
TOP	   11    8	 97.33 C12	  C9	 97.33
BOT	    8   12	 97.33  C9	 C13	 97.33
TOP	   12    8	 97.33 C13	  C9	 97.33
BOT	    8   13	 94.67  C9	 C14	 94.67
TOP	   13    8	 94.67 C14	  C9	 94.67
BOT	    8   14	 97.33  C9	 C15	 97.33
TOP	   14    8	 97.33 C15	  C9	 97.33
BOT	    8   15	 97.33  C9	 C16	 97.33
TOP	   15    8	 97.33 C16	  C9	 97.33
BOT	    8   16	 97.33  C9	 C17	 97.33
TOP	   16    8	 97.33 C17	  C9	 97.33
BOT	    8   17	 97.33  C9	 C18	 97.33
TOP	   17    8	 97.33 C18	  C9	 97.33
BOT	    8   18	 93.33  C9	 C19	 93.33
TOP	   18    8	 93.33 C19	  C9	 93.33
BOT	    9   10	 97.33 C10	 C11	 97.33
TOP	   10    9	 97.33 C11	 C10	 97.33
BOT	    9   11	 97.33 C10	 C12	 97.33
TOP	   11    9	 97.33 C12	 C10	 97.33
BOT	    9   12	 97.33 C10	 C13	 97.33
TOP	   12    9	 97.33 C13	 C10	 97.33
BOT	    9   13	 94.67 C10	 C14	 94.67
TOP	   13    9	 94.67 C14	 C10	 94.67
BOT	    9   14	 97.33 C10	 C15	 97.33
TOP	   14    9	 97.33 C15	 C10	 97.33
BOT	    9   15	 97.33 C10	 C16	 97.33
TOP	   15    9	 97.33 C16	 C10	 97.33
BOT	    9   16	 97.33 C10	 C17	 97.33
TOP	   16    9	 97.33 C17	 C10	 97.33
BOT	    9   17	 97.33 C10	 C18	 97.33
TOP	   17    9	 97.33 C18	 C10	 97.33
BOT	    9   18	 93.33 C10	 C19	 93.33
TOP	   18    9	 93.33 C19	 C10	 93.33
BOT	   10   11	 97.33 C11	 C12	 97.33
TOP	   11   10	 97.33 C12	 C11	 97.33
BOT	   10   12	 97.33 C11	 C13	 97.33
TOP	   12   10	 97.33 C13	 C11	 97.33
BOT	   10   13	 94.67 C11	 C14	 94.67
TOP	   13   10	 94.67 C14	 C11	 94.67
BOT	   10   14	 97.33 C11	 C15	 97.33
TOP	   14   10	 97.33 C15	 C11	 97.33
BOT	   10   15	 97.33 C11	 C16	 97.33
TOP	   15   10	 97.33 C16	 C11	 97.33
BOT	   10   16	 97.33 C11	 C17	 97.33
TOP	   16   10	 97.33 C17	 C11	 97.33
BOT	   10   17	 97.33 C11	 C18	 97.33
TOP	   17   10	 97.33 C18	 C11	 97.33
BOT	   10   18	 93.33 C11	 C19	 93.33
TOP	   18   10	 93.33 C19	 C11	 93.33
BOT	   11   12	 97.33 C12	 C13	 97.33
TOP	   12   11	 97.33 C13	 C12	 97.33
BOT	   11   13	 94.67 C12	 C14	 94.67
TOP	   13   11	 94.67 C14	 C12	 94.67
BOT	   11   14	 97.33 C12	 C15	 97.33
TOP	   14   11	 97.33 C15	 C12	 97.33
BOT	   11   15	 97.33 C12	 C16	 97.33
TOP	   15   11	 97.33 C16	 C12	 97.33
BOT	   11   16	 97.33 C12	 C17	 97.33
TOP	   16   11	 97.33 C17	 C12	 97.33
BOT	   11   17	 97.33 C12	 C18	 97.33
TOP	   17   11	 97.33 C18	 C12	 97.33
BOT	   11   18	 93.33 C12	 C19	 93.33
TOP	   18   11	 93.33 C19	 C12	 93.33
BOT	   12   13	 94.67 C13	 C14	 94.67
TOP	   13   12	 94.67 C14	 C13	 94.67
BOT	   12   14	 97.33 C13	 C15	 97.33
TOP	   14   12	 97.33 C15	 C13	 97.33
BOT	   12   15	 97.33 C13	 C16	 97.33
TOP	   15   12	 97.33 C16	 C13	 97.33
BOT	   12   16	 97.33 C13	 C17	 97.33
TOP	   16   12	 97.33 C17	 C13	 97.33
BOT	   12   17	 97.33 C13	 C18	 97.33
TOP	   17   12	 97.33 C18	 C13	 97.33
BOT	   12   18	 93.33 C13	 C19	 93.33
TOP	   18   12	 93.33 C19	 C13	 93.33
BOT	   13   14	 94.67 C14	 C15	 94.67
TOP	   14   13	 94.67 C15	 C14	 94.67
BOT	   13   15	 94.67 C14	 C16	 94.67
TOP	   15   13	 94.67 C16	 C14	 94.67
BOT	   13   16	 94.67 C14	 C17	 94.67
TOP	   16   13	 94.67 C17	 C14	 94.67
BOT	   13   17	 94.67 C14	 C18	 94.67
TOP	   17   13	 94.67 C18	 C14	 94.67
BOT	   13   18	 98.67 C14	 C19	 98.67
TOP	   18   13	 98.67 C19	 C14	 98.67
BOT	   14   15	 97.33 C15	 C16	 97.33
TOP	   15   14	 97.33 C16	 C15	 97.33
BOT	   14   16	 97.33 C15	 C17	 97.33
TOP	   16   14	 97.33 C17	 C15	 97.33
BOT	   14   17	 97.33 C15	 C18	 97.33
TOP	   17   14	 97.33 C18	 C15	 97.33
BOT	   14   18	 93.33 C15	 C19	 93.33
TOP	   18   14	 93.33 C19	 C15	 93.33
BOT	   15   16	 97.33 C16	 C17	 97.33
TOP	   16   15	 97.33 C17	 C16	 97.33
BOT	   15   17	 97.33 C16	 C18	 97.33
TOP	   17   15	 97.33 C18	 C16	 97.33
BOT	   15   18	 93.33 C16	 C19	 93.33
TOP	   18   15	 93.33 C19	 C16	 93.33
BOT	   16   17	 97.33 C17	 C18	 97.33
TOP	   17   16	 97.33 C18	 C17	 97.33
BOT	   16   18	 93.33 C17	 C19	 93.33
TOP	   18   16	 93.33 C19	 C17	 93.33
BOT	   17   18	 93.33 C18	 C19	 93.33
TOP	   18   17	 93.33 C19	 C18	 93.33
AVG	 0	  C1	   *	 78.07
AVG	 1	  C2	   *	 96.96
AVG	 2	  C3	   *	 95.56
AVG	 3	  C4	   *	 94.30
AVG	 4	  C5	   *	 95.70
AVG	 5	  C6	   *	 95.70
AVG	 6	  C7	   *	 95.70
AVG	 7	  C8	   *	 95.70
AVG	 8	  C9	   *	 95.70
AVG	 9	 C10	   *	 95.70
AVG	 10	 C11	   *	 95.70
AVG	 11	 C12	   *	 95.78
AVG	 12	 C13	   *	 95.70
AVG	 13	 C14	   *	 94.59
AVG	 14	 C15	   *	 95.70
AVG	 15	 C16	   *	 95.70
AVG	 16	 C17	   *	 95.70
AVG	 17	 C18	   *	 95.70
AVG	 18	 C19	   *	 93.33
TOT	 TOT	   *	 94.58
CLUSTAL W (1.83) multiple sequence alignment

C1              TCTGTGTCGCTCCGTTATCACTATACAAGGAAGTTGCAAACGCGGTCGCA
C2              GCTGTGACGCTTCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C3              GCTGTGACGCTCCCTTCTCACTCTACAAGGAAGTTGCAAACGCGGTCGCA
C4              GCTGTGACGCTCCCTTCTCACTCCACAAGGAAGTTGCAAACGCGGTCGCA
C5              GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAGCGCGGTCGCA
C6              GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C7              GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C8              GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C9              GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C10             GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C11             GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGCCGCA
C12             GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGCTCGCA
C13             GCTGTGACGCTCCCCTCCCATTCCACTAGAAAGCTGCAAACGCGGTCGCA
C14             GCCGTGACGCTTCCTTCTCACTCTACAAGGAAGTTGCAAACGCGATCGCA
C15             GCCGTGACGCTCCCCTCCCATTCCACTAGGGAGCTGCAAACGCGGTCGCA
C16             GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C17             GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C18             GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
C19             GCCGTCACGCTCCCATCTCACTCCACAAGGAAATTGCAAACGCGGTCGCA
                 * ** :**** *  *. ** *. **:**..*. *****.****  ****

C1              GACATGGTTAGAATCAAGAGAATACAAGAAGCACTTGATCATGGTCGAAA
C2              GACCTGGTTGGAATCAAGAGAATACACTAAGCACTTGATCAGAGTCGAAA
C3              GACCTGGTTAGAATCAAGAGAATACACGAAGCACCTGATCAAGGTTGAAA
C4              GACCTGGTTAGAATCAAGAGAATACACGAAGCACTTGATCAAGGTTGAAA
C5              AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C6              GACCTGGTTGGAATCAAGAGAATACACAAAGCACCTGATTAGAGTTGAAA
C7              AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C8              AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C9              AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C10             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C11             AACCTGGTTGGAATCAAGAGAATACACAAAGCATTTGATTAGAGTCGAAA
C12             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C13             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C14             GACTTGGCTAGAATCAAGAGAATACACAAAGCACCTGATCAAGGTTGAGA
C15             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C16             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C17             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
C18             AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAATCGAAA
C19             GACTTGGCTAGAATCAAGAGAATACACAAAGCACCTGATCAAGGTTGAAA
                .** *** *.****************. *****  **** * ..* **.*

C1              ACTGGATATTCAGGAACCCCGGGTTTGCCATAGTGTCCGTTGCCATTACC
C2              ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C3              ACTGGATATTTAGGAACCCCGGGTTTGCGCTCGCAGCTGTTGCCATTGCC
C4              ACTGGATATTCAGGAACCCCGGGTTTGCGCTAGCGGCTGTTGCCATTGCT
C5              ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C6              ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGTCATCGCT
C7              ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C8              ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C9              ATTGGATACTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C10             ACTGGATGTTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C11             ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C12             ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C13             ATTGGATATTCAGGAACCCTGGCCTCGCGTTAGCAGCAGCTGCCATCGCT
C14             ATTGGATATTCAGGAACCCCGGGTTTGCGCTAGTGGCTGTAGCTATTGCC
C15             ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCT
C16             ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCT
C17             ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCG
C18             ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
C19             ATTGGATATTCAGGAACCCTGGTTTTACGCTAGTGGCTGTCGCCATCGCC
                * *****. * ******** **  * .*  *.* . * *  *  ** .* 

C1              TGGCTGATGGGAAGCTTGACGAGCCAAAAAGTCATATACTTGGTCATGAT
C2              TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C3              TGGCTTTTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTTATGAT
C4              TGGCTTCTGGGAAGTTCGACGAGCCAAAAAGTCATATACTTGATCATGAT
C5              TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C6              TGGCTTTTGGGAAGTTCAACGAGCCAAAAAGTCATATATCTGGTCATGAT
C7              TGGCTTTTGGGAAGTTCAACGAGCAAAAAAGTCATATACTTGGTCATGAT
C8              TGGCTTTTGGGAAGCTCAACGCGCCAAAAAGTCATATACTTGGTCATGAT
C9              TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATATTTGGTCATGAT
C10             TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C11             TGGCTTTTGGGAAGCTCAACAAGCCAAAAAGTCATATACTTGGTCATGAT
C12             TGGCTTTTTGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C13             TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C14             TGGCTCCTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTCATGAT
C15             TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C16             TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATGCTTGGTCATGAT
C17             TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C18             TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
C19             TGGCTTTTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTCATGAT
                *****  * ***** * .**..**.************.  **.* *****

C1              AGTGTTGATTGTCCCGGCATACAGT
C2              ACTGCTGATCGCCCCGGCATACAGC
C3              ACTGCTGATTGCCCCGGCATACAGC
C4              ACTGCTGATTGCCCCGGCATACAGC
C5              ACTGCTGATTGCCCCGGCATATAGC
C6              ACTGCTGATTGCCCCGGCATACAGC
C7              ACTGCTGATTGCCCCGGCATACAGC
C8              ACTGCTGATTGCCCCGGCATACAGC
C9              ACTGCTGATTGCCCCGGCATACAGC
C10             ACTGCTGATTGCCCCGGCATACAGC
C11             ACTGCTGATTGCCCCGGCATACAGC
C12             ACTGCTGATTGCCCCGGCATACAGC
C13             ACTGCTGATTGCCCCGGCATACAGC
C14             ATTGTTGATTGCCCCGGCATACAGT
C15             ACTGCTGATTGCCCCGGCATACAGC
C16             ACTGCTGATTGCCCCGGCATACAGC
C17             ACTGCTGATTGCCCTGGCATACAGC
C18             ACTGCTGATTGCCCCGGCATACAGC
C19             ACTGCTGATTGCCCCGGCATACAGT
                * ** **** * ** ****** ** 



>C1
TCTGTGTCGCTCCGTTATCACTATACAAGGAAGTTGCAAACGCGGTCGCA
GACATGGTTAGAATCAAGAGAATACAAGAAGCACTTGATCATGGTCGAAA
ACTGGATATTCAGGAACCCCGGGTTTGCCATAGTGTCCGTTGCCATTACC
TGGCTGATGGGAAGCTTGACGAGCCAAAAAGTCATATACTTGGTCATGAT
AGTGTTGATTGTCCCGGCATACAGT
>C2
GCTGTGACGCTTCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
GACCTGGTTGGAATCAAGAGAATACACTAAGCACTTGATCAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATCGCCCCGGCATACAGC
>C3
GCTGTGACGCTCCCTTCTCACTCTACAAGGAAGTTGCAAACGCGGTCGCA
GACCTGGTTAGAATCAAGAGAATACACGAAGCACCTGATCAAGGTTGAAA
ACTGGATATTTAGGAACCCCGGGTTTGCGCTCGCAGCTGTTGCCATTGCC
TGGCTTTTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTTATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C4
GCTGTGACGCTCCCTTCTCACTCCACAAGGAAGTTGCAAACGCGGTCGCA
GACCTGGTTAGAATCAAGAGAATACACGAAGCACTTGATCAAGGTTGAAA
ACTGGATATTCAGGAACCCCGGGTTTGCGCTAGCGGCTGTTGCCATTGCT
TGGCTTCTGGGAAGTTCGACGAGCCAAAAAGTCATATACTTGATCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C5
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAGCGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATATAGC
>C6
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
GACCTGGTTGGAATCAAGAGAATACACAAAGCACCTGATTAGAGTTGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGTCATCGCT
TGGCTTTTGGGAAGTTCAACGAGCCAAAAAGTCATATATCTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C7
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGTTCAACGAGCAAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C8
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGCGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C9
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATACTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATATTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C10
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ACTGGATGTTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C11
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGCCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCATTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACAAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C12
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGCTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTTGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C13
GCTGTGACGCTCCCCTCCCATTCCACTAGAAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCCTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C14
GCCGTGACGCTTCCTTCTCACTCTACAAGGAAGTTGCAAACGCGATCGCA
GACTTGGCTAGAATCAAGAGAATACACAAAGCACCTGATCAAGGTTGAGA
ATTGGATATTCAGGAACCCCGGGTTTGCGCTAGTGGCTGTAGCTATTGCC
TGGCTCCTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTCATGAT
ATTGTTGATTGCCCCGGCATACAGT
>C15
GCCGTGACGCTCCCCTCCCATTCCACTAGGGAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C16
GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATGCTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C17
GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCG
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCTGGCATACAGC
>C18
GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAATCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>C19
GCCGTCACGCTCCCATCTCACTCCACAAGGAAATTGCAAACGCGGTCGCA
GACTTGGCTAGAATCAAGAGAATACACAAAGCACCTGATCAAGGTTGAAA
ATTGGATATTCAGGAACCCTGGTTTTACGCTAGTGGCTGTCGCCATCGCC
TGGCTTTTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGT
>C1
SVSLRYHYTRKLQTRSQTWLESREYKKHLIMVENWIFRNPGFAIVSVAIT
WLMGSLTSQKVIYLVMIVLIVPAYS
>C2
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C3
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C4
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
WLLGSSTSQKVIYLIMILLIAPAYS
>C5
AVTLPSHSTRKLQARSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C6
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAVIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C7
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSKKVIYLVMILLIAPAYS
>C8
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTRQKVIYLVMILLIAPAYS
>C9
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C10
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C11
AVTLPSHSTRKLQTRPQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C12
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLFGSSTSQKVIYLVMILLIAPAYS
>C13
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C14
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C15
AVTLPSHSTRELQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C16
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVICLVMILLIAPAYS
>C17
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIALAYS
>C18
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRIENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>C19
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFTLVAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 19 taxa and 225 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Taxon 13 -> C13
      Taxon 14 -> C14
      Taxon 15 -> C15
      Taxon 16 -> C16
      Taxon 17 -> C17
      Taxon 18 -> C18
      Taxon 19 -> C19
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1509960749
      Setting output file names to "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1022692964
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5127899372
      Seed = 1237345358
      Swapseed = 1509960749
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 25 unique site patterns
      Division 2 has 13 unique site patterns
      Division 3 has 44 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1686.164534 -- -29.736228
         Chain 2 -- -1687.957235 -- -29.736228
         Chain 3 -- -1669.761718 -- -29.736228
         Chain 4 -- -1685.171518 -- -29.736228

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1683.521879 -- -29.736228
         Chain 2 -- -1686.807385 -- -29.736228
         Chain 3 -- -1679.699437 -- -29.736228
         Chain 4 -- -1685.968170 -- -29.736228


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1686.165] (-1687.957) (-1669.762) (-1685.172) * [-1683.522] (-1686.807) (-1679.699) (-1685.968) 
        500 -- (-979.823) [-967.547] (-997.766) (-1034.259) * (-1001.755) (-984.614) (-964.774) [-969.374] -- 0:00:00
       1000 -- (-934.016) (-932.722) [-937.337] (-999.840) * (-957.082) (-944.963) (-939.201) [-916.918] -- 0:00:00
       1500 -- [-909.839] (-922.757) (-936.540) (-957.429) * (-953.582) (-926.249) (-933.986) [-905.181] -- 0:00:00
       2000 -- (-900.992) [-907.188] (-920.782) (-939.822) * (-937.524) (-936.135) (-907.623) [-902.620] -- 0:08:19
       2500 -- [-899.883] (-897.909) (-913.960) (-916.611) * (-937.435) [-905.784] (-911.537) (-900.054) -- 0:06:39
       3000 -- [-906.144] (-902.705) (-902.176) (-925.620) * (-919.373) (-902.248) (-911.961) [-891.428] -- 0:05:32
       3500 -- (-910.882) [-899.559] (-895.825) (-908.670) * (-931.201) [-902.418] (-930.529) (-894.480) -- 0:04:44
       4000 -- (-904.935) (-913.475) [-903.272] (-911.821) * (-914.247) [-894.354] (-918.322) (-916.616) -- 0:04:09
       4500 -- (-910.764) (-918.443) (-900.279) [-901.759] * (-918.405) [-894.461] (-916.564) (-901.444) -- 0:03:41
       5000 -- (-905.948) (-914.549) [-899.239] (-920.071) * (-911.943) [-890.177] (-922.691) (-899.679) -- 0:06:38

      Average standard deviation of split frequencies: 0.077006

       5500 -- (-907.839) (-899.385) [-909.571] (-918.485) * (-913.617) (-903.691) (-911.797) [-898.698] -- 0:06:01
       6000 -- (-909.250) [-903.353] (-922.959) (-915.607) * (-921.281) (-908.171) (-910.818) [-893.470] -- 0:05:31
       6500 -- (-900.319) [-896.666] (-901.454) (-904.025) * (-919.944) (-922.263) (-899.260) [-898.075] -- 0:05:05
       7000 -- (-916.643) (-909.547) [-895.321] (-904.923) * (-921.360) (-907.888) (-903.329) [-890.911] -- 0:04:43
       7500 -- (-904.970) (-908.948) [-901.997] (-895.026) * (-907.687) (-906.971) (-902.298) [-887.018] -- 0:06:37
       8000 -- (-920.546) (-902.265) (-916.187) [-890.368] * [-900.019] (-908.178) (-915.102) (-912.719) -- 0:06:12
       8500 -- (-899.809) (-920.029) (-922.706) [-893.650] * (-918.332) (-896.241) (-910.564) [-903.185] -- 0:05:49
       9000 -- (-909.086) (-898.799) (-920.997) [-897.755] * [-905.503] (-909.682) (-911.246) (-913.014) -- 0:05:30
       9500 -- (-902.809) [-887.285] (-927.283) (-907.378) * (-913.347) [-906.755] (-906.800) (-901.431) -- 0:05:12
      10000 -- (-909.357) [-893.231] (-907.978) (-921.297) * [-903.917] (-909.137) (-899.810) (-886.828) -- 0:06:36

      Average standard deviation of split frequencies: 0.081921

      10500 -- (-898.716) (-901.991) [-890.120] (-893.314) * (-911.476) [-896.841] (-910.027) (-894.771) -- 0:06:16
      11000 -- (-901.655) (-900.358) (-901.378) [-900.593] * (-909.009) [-902.153] (-912.062) (-902.388) -- 0:05:59
      11500 -- (-932.045) [-897.163] (-902.710) (-898.839) * (-900.159) (-925.035) [-902.664] (-901.829) -- 0:05:43
      12000 -- [-905.602] (-914.521) (-892.780) (-903.117) * (-906.647) [-895.962] (-913.664) (-905.535) -- 0:05:29
      12500 -- (-912.441) (-929.671) [-899.431] (-925.550) * (-911.233) [-903.929] (-912.068) (-907.112) -- 0:06:35
      13000 -- (-901.315) (-929.585) (-893.086) [-889.636] * (-904.183) (-900.170) (-900.206) [-895.848] -- 0:06:19
      13500 -- [-890.825] (-909.641) (-897.532) (-908.105) * (-890.890) (-904.774) [-890.062] (-914.712) -- 0:06:05
      14000 -- [-887.959] (-915.748) (-904.635) (-898.551) * (-889.967) (-897.128) (-894.617) [-894.757] -- 0:05:52
      14500 -- [-883.053] (-913.301) (-916.258) (-896.827) * (-902.150) [-899.412] (-888.267) (-913.022) -- 0:05:39
      15000 -- [-892.686] (-924.065) (-899.676) (-897.790) * (-913.102) (-916.485) [-897.475] (-904.554) -- 0:06:34

      Average standard deviation of split frequencies: 0.077340

      15500 -- (-903.875) [-907.978] (-903.152) (-909.671) * (-919.118) [-900.229] (-906.872) (-910.215) -- 0:06:21
      16000 -- (-895.365) [-899.149] (-906.190) (-912.135) * [-903.375] (-903.026) (-902.293) (-894.895) -- 0:06:09
      16500 -- [-898.725] (-914.265) (-897.701) (-914.924) * (-912.348) [-895.947] (-894.240) (-909.394) -- 0:05:57
      17000 -- (-895.898) (-897.209) (-909.363) [-887.848] * (-912.489) (-887.413) [-889.907] (-907.553) -- 0:05:46
      17500 -- [-891.412] (-916.951) (-912.458) (-909.486) * (-897.024) [-894.661] (-905.309) (-926.262) -- 0:06:33
      18000 -- [-899.179] (-910.168) (-919.186) (-901.363) * (-901.535) [-910.462] (-900.978) (-906.935) -- 0:06:21
      18500 -- (-891.593) (-905.606) (-931.315) [-907.485] * (-893.381) (-909.782) [-900.448] (-906.898) -- 0:06:11
      19000 -- [-899.825] (-906.894) (-927.215) (-913.285) * (-901.025) (-902.176) [-906.277] (-929.692) -- 0:06:01
      19500 -- (-912.944) (-908.183) (-908.014) [-894.275] * (-900.202) (-911.918) (-908.275) [-904.812] -- 0:05:51
      20000 -- (-913.700) (-905.780) (-931.274) [-901.122] * (-907.194) (-904.658) (-899.288) [-896.469] -- 0:06:32

      Average standard deviation of split frequencies: 0.064356

      20500 -- [-889.545] (-903.105) (-908.889) (-911.149) * (-904.083) (-896.584) (-904.825) [-896.681] -- 0:06:22
      21000 -- (-901.077) [-895.565] (-900.160) (-921.187) * [-891.136] (-891.214) (-910.989) (-899.718) -- 0:06:12
      21500 -- (-910.063) (-903.503) (-898.388) [-903.254] * (-902.125) [-895.002] (-904.155) (-917.722) -- 0:06:04
      22000 -- (-908.427) [-903.528] (-904.221) (-913.501) * (-902.947) (-895.528) (-892.113) [-911.081] -- 0:05:55
      22500 -- (-903.955) (-909.692) (-905.564) [-893.375] * (-907.517) (-906.763) [-888.839] (-901.177) -- 0:05:47
      23000 -- (-913.278) (-911.256) (-902.784) [-899.064] * [-900.223] (-913.745) (-893.553) (-914.475) -- 0:06:22
      23500 -- (-901.647) (-908.108) [-908.532] (-906.838) * [-899.374] (-899.464) (-896.299) (-911.794) -- 0:06:13
      24000 -- (-902.937) (-896.197) (-915.149) [-897.667] * [-885.943] (-921.486) (-898.678) (-905.914) -- 0:06:06
      24500 -- (-891.278) [-899.257] (-901.621) (-896.331) * (-894.338) [-904.590] (-903.543) (-909.352) -- 0:05:58
      25000 -- [-899.885] (-897.200) (-911.011) (-907.995) * [-895.481] (-903.943) (-898.249) (-907.684) -- 0:05:51

      Average standard deviation of split frequencies: 0.060259

      25500 -- (-902.557) (-909.230) (-899.696) [-909.782] * [-889.676] (-903.303) (-902.005) (-916.962) -- 0:06:22
      26000 -- (-906.102) (-908.934) [-892.919] (-905.958) * (-900.892) [-907.856] (-901.320) (-907.297) -- 0:06:14
      26500 -- (-901.176) [-900.330] (-913.019) (-917.324) * (-904.912) (-903.223) [-904.967] (-906.754) -- 0:06:07
      27000 -- [-908.539] (-895.913) (-907.357) (-904.333) * (-905.277) (-900.147) (-908.448) [-905.344] -- 0:06:00
      27500 -- (-922.818) (-898.302) [-889.656] (-907.446) * (-910.627) [-892.551] (-906.939) (-911.855) -- 0:05:53
      28000 -- (-899.821) [-896.785] (-904.871) (-905.996) * (-896.673) (-909.068) (-898.471) [-893.329] -- 0:06:21
      28500 -- (-891.381) [-906.999] (-903.034) (-917.279) * (-900.025) [-895.029] (-909.533) (-904.905) -- 0:06:14
      29000 -- (-904.651) (-909.362) (-906.540) [-902.764] * (-916.301) (-906.256) [-896.269] (-918.514) -- 0:06:08
      29500 -- [-900.909] (-909.066) (-920.979) (-900.893) * [-894.788] (-894.459) (-914.846) (-901.301) -- 0:06:01
      30000 -- (-888.154) (-898.854) (-910.467) [-889.305] * (-902.523) (-899.516) (-922.708) [-895.996] -- 0:05:55

      Average standard deviation of split frequencies: 0.062000

      30500 -- (-906.133) [-897.775] (-907.028) (-896.493) * (-910.989) [-900.184] (-909.096) (-904.867) -- 0:06:21
      31000 -- (-908.608) (-899.297) (-908.651) [-901.461] * [-893.504] (-906.284) (-898.562) (-900.943) -- 0:06:15
      31500 -- (-901.804) (-911.154) [-909.774] (-897.889) * [-900.160] (-911.265) (-906.765) (-901.813) -- 0:06:08
      32000 -- (-915.995) [-900.193] (-920.247) (-911.243) * (-902.297) (-898.972) (-901.817) [-901.170] -- 0:06:03
      32500 -- (-913.862) [-897.488] (-914.018) (-897.002) * [-901.408] (-901.502) (-905.907) (-914.688) -- 0:05:57
      33000 -- (-892.625) [-881.859] (-910.183) (-901.152) * (-904.837) (-901.135) [-903.369] (-905.029) -- 0:06:20
      33500 -- (-898.696) (-900.500) (-913.108) [-897.795] * [-899.972] (-903.331) (-900.214) (-903.533) -- 0:06:15
      34000 -- (-902.605) (-905.981) [-906.073] (-907.121) * (-898.493) (-902.338) (-905.308) [-904.528] -- 0:06:09
      34500 -- (-902.338) (-893.618) (-909.356) [-897.423] * (-896.019) (-900.108) (-897.387) [-891.685] -- 0:06:03
      35000 -- (-925.329) [-899.381] (-901.130) (-911.545) * [-894.698] (-905.887) (-911.171) (-908.058) -- 0:05:58

      Average standard deviation of split frequencies: 0.057415

      35500 -- (-906.274) (-900.822) [-901.220] (-904.894) * [-900.356] (-924.253) (-899.924) (-909.607) -- 0:06:20
      36000 -- (-896.895) (-897.227) [-889.119] (-902.025) * [-906.436] (-899.134) (-910.237) (-919.720) -- 0:06:14
      36500 -- [-897.244] (-901.733) (-896.490) (-902.411) * (-893.108) [-898.440] (-908.555) (-899.237) -- 0:06:09
      37000 -- (-899.957) [-903.175] (-901.840) (-904.571) * (-893.812) [-889.415] (-921.232) (-902.811) -- 0:06:04
      37500 -- [-890.631] (-905.138) (-896.979) (-906.597) * [-885.194] (-902.327) (-911.624) (-903.682) -- 0:05:59
      38000 -- (-898.686) [-890.207] (-894.542) (-922.166) * (-907.265) (-902.189) (-897.927) [-900.068] -- 0:05:54
      38500 -- [-895.761] (-915.474) (-903.492) (-915.343) * (-896.232) (-910.091) [-900.349] (-908.850) -- 0:06:14
      39000 -- (-910.791) (-913.607) (-910.938) [-888.013] * (-891.554) [-900.571] (-901.990) (-912.483) -- 0:06:09
      39500 -- (-905.480) (-900.109) (-902.393) [-896.590] * (-909.010) [-898.961] (-902.458) (-904.401) -- 0:06:04
      40000 -- [-914.472] (-898.921) (-900.249) (-897.776) * [-896.365] (-915.596) (-906.366) (-890.910) -- 0:06:00

      Average standard deviation of split frequencies: 0.052416

      40500 -- (-915.987) (-906.121) (-904.544) [-892.055] * [-902.095] (-913.343) (-935.855) (-903.683) -- 0:05:55
      41000 -- (-911.674) (-901.305) (-895.826) [-896.093] * [-888.084] (-898.779) (-921.048) (-897.593) -- 0:06:14
      41500 -- (-895.307) [-896.294] (-902.519) (-906.905) * (-905.828) (-911.578) (-916.652) [-891.105] -- 0:06:09
      42000 -- (-907.087) [-896.509] (-901.960) (-911.286) * (-905.250) (-912.459) (-906.925) [-888.271] -- 0:06:04
      42500 -- [-902.916] (-897.310) (-915.067) (-921.793) * [-895.292] (-918.633) (-915.084) (-890.396) -- 0:06:00
      43000 -- (-902.809) (-903.491) [-908.899] (-912.662) * (-901.426) (-908.529) [-902.871] (-900.900) -- 0:05:56
      43500 -- (-903.189) (-895.852) (-910.056) [-904.301] * (-906.578) [-907.172] (-907.429) (-899.024) -- 0:05:51
      44000 -- (-893.461) [-893.065] (-916.546) (-935.354) * (-909.439) (-922.647) [-892.885] (-906.288) -- 0:06:09
      44500 -- [-898.125] (-927.693) (-901.480) (-902.918) * (-909.930) [-892.100] (-906.135) (-904.308) -- 0:06:05
      45000 -- (-918.010) (-894.734) [-904.348] (-905.931) * (-911.999) (-905.976) [-900.150] (-908.776) -- 0:06:00

      Average standard deviation of split frequencies: 0.051240

      45500 -- (-911.035) (-902.641) [-896.399] (-891.613) * (-899.172) (-897.775) (-903.608) [-900.375] -- 0:05:56
      46000 -- (-914.040) (-917.240) (-911.232) [-890.318] * (-913.874) (-895.265) (-913.991) [-899.239] -- 0:05:52
      46500 -- (-904.294) (-908.232) [-901.502] (-899.591) * (-905.346) (-903.227) (-916.099) [-896.738] -- 0:06:09
      47000 -- (-924.012) (-927.050) [-894.923] (-907.275) * [-895.007] (-905.001) (-903.549) (-897.905) -- 0:06:04
      47500 -- [-907.899] (-907.576) (-900.677) (-909.385) * (-907.031) [-897.591] (-918.083) (-898.773) -- 0:06:00
      48000 -- (-900.837) (-915.224) [-888.264] (-908.976) * [-898.984] (-915.842) (-919.874) (-895.911) -- 0:05:57
      48500 -- (-916.794) (-906.228) [-896.101] (-903.301) * [-894.271] (-905.476) (-907.058) (-897.404) -- 0:05:53
      49000 -- (-906.220) (-909.547) [-895.464] (-909.896) * (-903.769) [-899.514] (-906.249) (-902.467) -- 0:06:08
      49500 -- (-920.374) (-904.642) (-894.524) [-906.486] * (-908.192) [-898.269] (-898.872) (-913.270) -- 0:06:04
      50000 -- (-901.894) (-907.407) (-898.194) [-898.653] * (-918.802) (-897.696) [-887.052] (-913.615) -- 0:06:01

      Average standard deviation of split frequencies: 0.043074

      50500 -- (-905.735) (-898.467) [-896.060] (-899.213) * (-892.107) (-899.188) [-889.688] (-910.327) -- 0:05:57
      51000 -- (-916.180) (-892.451) [-896.870] (-903.557) * [-887.195] (-900.097) (-903.946) (-933.150) -- 0:05:53
      51500 -- [-905.700] (-897.477) (-910.310) (-908.250) * (-899.867) [-888.104] (-914.709) (-923.432) -- 0:06:08
      52000 -- (-904.655) (-900.491) [-895.268] (-914.721) * [-894.961] (-912.023) (-902.690) (-913.768) -- 0:06:04
      52500 -- (-904.666) (-913.863) [-892.053] (-893.211) * (-907.659) (-900.212) [-894.869] (-901.076) -- 0:06:00
      53000 -- (-909.904) (-921.307) [-890.149] (-902.789) * (-901.488) (-910.434) [-890.316] (-899.857) -- 0:05:57
      53500 -- [-889.802] (-896.527) (-892.825) (-912.588) * [-895.069] (-894.719) (-915.478) (-889.050) -- 0:05:53
      54000 -- (-912.897) [-899.910] (-911.854) (-907.810) * [-896.352] (-892.407) (-916.758) (-892.171) -- 0:06:07
      54500 -- (-912.971) (-911.098) (-910.324) [-899.114] * (-910.214) [-901.534] (-908.835) (-904.069) -- 0:06:04
      55000 -- (-895.253) (-919.750) (-895.044) [-892.874] * (-908.927) (-899.880) (-910.062) [-889.760] -- 0:06:00

      Average standard deviation of split frequencies: 0.043292

      55500 -- [-901.327] (-894.670) (-905.284) (-888.172) * [-901.924] (-907.702) (-896.629) (-912.376) -- 0:05:57
      56000 -- (-900.111) (-917.571) (-910.585) [-897.892] * (-913.491) (-900.290) [-893.631] (-896.200) -- 0:05:54
      56500 -- [-891.627] (-893.651) (-915.145) (-901.889) * (-907.244) (-918.528) (-898.004) [-903.055] -- 0:05:50
      57000 -- (-893.980) [-888.437] (-908.624) (-903.628) * [-896.887] (-916.206) (-909.401) (-896.266) -- 0:06:03
      57500 -- (-922.663) [-897.083] (-910.276) (-891.556) * (-894.515) (-920.519) (-902.914) [-902.105] -- 0:06:00
      58000 -- (-913.434) [-885.597] (-900.922) (-891.431) * (-900.201) (-915.888) (-904.709) [-895.777] -- 0:05:57
      58500 -- (-921.255) [-894.754] (-907.693) (-907.286) * [-892.523] (-893.339) (-910.903) (-904.684) -- 0:05:54
      59000 -- (-922.013) [-889.955] (-918.684) (-895.932) * [-895.650] (-910.212) (-908.082) (-896.321) -- 0:05:50
      59500 -- (-908.478) [-897.244] (-903.592) (-918.377) * (-896.630) (-907.651) (-908.091) [-900.828] -- 0:06:03
      60000 -- [-910.684] (-909.502) (-917.193) (-893.518) * [-892.652] (-923.146) (-902.335) (-891.009) -- 0:06:00

      Average standard deviation of split frequencies: 0.045916

      60500 -- (-907.790) (-911.082) [-892.754] (-893.219) * (-913.852) (-902.447) (-904.120) [-893.824] -- 0:05:57
      61000 -- [-902.768] (-921.053) (-906.896) (-904.078) * (-895.056) (-888.512) [-900.895] (-897.702) -- 0:05:54
      61500 -- (-908.017) (-906.230) [-894.218] (-903.931) * [-894.144] (-908.800) (-913.063) (-924.314) -- 0:05:50
      62000 -- (-901.267) (-925.188) [-903.349] (-915.975) * (-897.697) [-907.107] (-916.319) (-901.095) -- 0:05:47
      62500 -- [-898.669] (-912.763) (-917.649) (-919.183) * (-896.200) (-910.207) (-901.726) [-896.766] -- 0:06:00
      63000 -- (-908.402) (-897.760) (-906.588) [-902.627] * (-907.090) (-913.469) (-905.225) [-914.541] -- 0:05:56
      63500 -- (-918.012) (-905.585) [-897.739] (-897.918) * (-911.294) (-920.990) [-896.706] (-920.197) -- 0:05:53
      64000 -- (-907.284) (-908.065) [-897.943] (-917.021) * [-907.629] (-901.524) (-910.393) (-907.484) -- 0:05:51
      64500 -- [-909.389] (-903.301) (-919.065) (-898.496) * [-891.617] (-899.180) (-910.158) (-906.664) -- 0:05:48
      65000 -- [-900.404] (-913.433) (-906.666) (-900.032) * [-896.213] (-920.566) (-892.816) (-906.772) -- 0:05:59

      Average standard deviation of split frequencies: 0.045327

      65500 -- (-899.228) (-902.364) (-905.157) [-901.948] * [-900.588] (-913.962) (-920.081) (-891.362) -- 0:05:56
      66000 -- (-903.135) [-906.495] (-905.436) (-903.734) * (-905.721) (-895.605) (-905.377) [-901.400] -- 0:05:53
      66500 -- [-910.590] (-912.034) (-896.156) (-911.666) * (-900.771) (-909.819) [-886.380] (-907.652) -- 0:05:50
      67000 -- (-900.544) [-900.539] (-912.068) (-914.959) * (-903.252) (-904.606) [-894.520] (-904.481) -- 0:05:48
      67500 -- [-897.445] (-897.179) (-898.049) (-913.156) * (-900.367) [-903.176] (-896.461) (-898.906) -- 0:05:59
      68000 -- (-903.028) [-905.509] (-898.701) (-902.934) * (-903.991) (-907.104) [-892.285] (-900.018) -- 0:05:56
      68500 -- [-891.109] (-907.907) (-903.470) (-900.645) * (-905.854) (-927.188) (-902.940) [-901.710] -- 0:05:53
      69000 -- [-889.870] (-930.704) (-903.350) (-907.372) * [-897.960] (-906.831) (-907.594) (-906.297) -- 0:05:50
      69500 -- [-900.515] (-913.693) (-912.767) (-902.023) * (-910.871) [-903.011] (-905.237) (-910.056) -- 0:05:48
      70000 -- (-910.462) (-907.076) [-900.886] (-903.307) * (-907.587) [-901.542] (-892.948) (-906.420) -- 0:05:45

      Average standard deviation of split frequencies: 0.046999

      70500 -- (-917.686) (-902.637) (-894.344) [-902.869] * [-903.828] (-915.872) (-909.283) (-912.344) -- 0:05:55
      71000 -- [-900.116] (-902.624) (-902.095) (-912.619) * (-921.275) (-899.074) (-908.043) [-893.335] -- 0:05:53
      71500 -- (-913.145) (-906.498) [-906.394] (-899.661) * [-899.094] (-904.531) (-913.703) (-883.136) -- 0:05:50
      72000 -- [-905.847] (-903.241) (-917.139) (-903.380) * (-906.876) (-910.739) (-894.422) [-894.150] -- 0:05:48
      72500 -- (-883.813) (-900.303) (-911.688) [-898.412] * (-901.011) [-908.665] (-891.073) (-895.257) -- 0:05:45
      73000 -- [-898.847] (-900.395) (-901.705) (-924.460) * (-917.170) [-903.939] (-892.955) (-916.698) -- 0:05:55
      73500 -- (-898.973) (-897.558) (-920.741) [-889.998] * (-922.059) (-908.549) (-908.225) [-899.847] -- 0:05:52
      74000 -- (-914.202) (-898.133) (-903.172) [-894.731] * (-901.923) [-907.448] (-903.337) (-905.621) -- 0:05:50
      74500 -- (-905.559) [-900.634] (-890.059) (-917.236) * (-911.138) (-908.834) [-903.895] (-901.117) -- 0:05:47
      75000 -- (-903.408) (-907.389) [-898.599] (-913.576) * (-896.230) (-901.290) [-896.838] (-907.669) -- 0:05:45

      Average standard deviation of split frequencies: 0.043419

      75500 -- (-908.767) [-890.405] (-903.949) (-904.179) * (-898.361) [-900.537] (-904.672) (-894.240) -- 0:05:55
      76000 -- (-889.046) [-899.068] (-905.006) (-903.321) * (-911.471) [-897.197] (-897.549) (-902.195) -- 0:05:52
      76500 -- (-898.787) (-907.914) [-890.179] (-898.908) * [-901.175] (-900.912) (-902.071) (-908.591) -- 0:05:50
      77000 -- (-908.551) (-917.655) (-895.115) [-893.754] * (-911.135) (-907.600) [-890.490] (-903.167) -- 0:05:47
      77500 -- (-909.782) (-915.474) [-898.218] (-897.185) * (-916.041) [-903.777] (-905.651) (-905.466) -- 0:05:45
      78000 -- (-905.865) (-907.019) (-913.560) [-892.584] * (-918.046) [-902.433] (-915.285) (-903.238) -- 0:05:54
      78500 -- (-898.836) (-906.787) (-911.794) [-889.096] * (-895.329) (-902.853) (-899.208) [-888.908] -- 0:05:52
      79000 -- [-891.150] (-915.355) (-910.214) (-909.313) * (-889.773) [-906.971] (-922.613) (-904.817) -- 0:05:49
      79500 -- [-895.921] (-904.806) (-903.739) (-904.732) * (-900.169) [-890.909] (-921.642) (-920.361) -- 0:05:47
      80000 -- [-896.280] (-904.893) (-902.838) (-914.281) * [-895.152] (-910.772) (-911.104) (-917.922) -- 0:05:45

      Average standard deviation of split frequencies: 0.040110

      80500 -- (-905.743) [-888.395] (-899.114) (-902.128) * [-897.560] (-909.787) (-906.503) (-910.502) -- 0:05:54
      81000 -- (-912.061) [-888.463] (-894.574) (-911.058) * (-908.677) [-903.610] (-906.383) (-905.716) -- 0:05:51
      81500 -- [-897.657] (-914.073) (-894.578) (-914.041) * [-909.930] (-909.131) (-912.570) (-906.855) -- 0:05:49
      82000 -- [-897.904] (-900.139) (-905.413) (-904.860) * (-907.713) (-922.395) [-893.599] (-910.771) -- 0:05:47
      82500 -- (-899.025) [-902.021] (-902.878) (-898.358) * [-902.209] (-910.449) (-901.378) (-916.429) -- 0:05:44
      83000 -- (-902.895) (-901.324) (-919.811) [-894.303] * (-900.546) (-909.878) [-881.574] (-902.681) -- 0:05:42
      83500 -- (-922.799) [-904.420] (-907.675) (-910.566) * [-904.119] (-907.401) (-898.983) (-905.555) -- 0:05:51
      84000 -- (-915.875) (-904.597) [-897.703] (-911.098) * (-905.799) (-902.058) [-901.787] (-899.852) -- 0:05:48
      84500 -- (-907.563) (-907.355) [-889.840] (-899.814) * [-908.870] (-894.748) (-905.365) (-908.444) -- 0:05:46
      85000 -- (-896.810) [-894.242] (-883.766) (-899.789) * [-898.811] (-895.806) (-894.744) (-897.927) -- 0:05:44

      Average standard deviation of split frequencies: 0.041339

      85500 -- [-895.484] (-920.598) (-920.637) (-897.516) * [-910.146] (-905.570) (-901.959) (-905.580) -- 0:05:42
      86000 -- [-888.197] (-912.329) (-920.254) (-905.652) * (-900.351) (-905.292) [-899.468] (-921.715) -- 0:05:50
      86500 -- (-903.194) (-907.697) (-904.148) [-900.443] * (-917.188) (-891.427) [-905.185] (-907.820) -- 0:05:48
      87000 -- [-900.306] (-915.554) (-893.993) (-894.040) * (-911.299) (-896.378) [-910.088] (-915.815) -- 0:05:46
      87500 -- (-907.398) (-907.502) [-891.592] (-901.296) * [-908.270] (-898.136) (-913.906) (-895.540) -- 0:05:44
      88000 -- [-901.843] (-916.489) (-891.134) (-909.392) * (-899.391) (-899.288) (-906.604) [-893.644] -- 0:05:42
      88500 -- (-906.876) [-901.563] (-903.794) (-897.019) * (-925.337) (-888.054) [-898.774] (-896.380) -- 0:05:50
      89000 -- (-916.072) (-915.381) [-897.093] (-907.097) * [-910.219] (-914.625) (-898.409) (-912.166) -- 0:05:48
      89500 -- (-915.588) (-896.971) [-902.588] (-912.327) * (-890.573) [-910.454] (-917.815) (-926.891) -- 0:05:45
      90000 -- (-910.973) (-899.863) [-905.859] (-913.836) * [-891.166] (-909.537) (-906.835) (-921.990) -- 0:05:43

      Average standard deviation of split frequencies: 0.040177

      90500 -- (-914.835) [-898.217] (-915.673) (-903.793) * (-914.414) [-904.303] (-912.236) (-906.568) -- 0:05:41
      91000 -- (-927.346) (-910.101) (-903.943) [-890.029] * (-915.817) [-893.202] (-906.658) (-906.214) -- 0:05:49
      91500 -- (-920.810) (-907.710) [-903.979] (-914.050) * (-908.236) [-903.681] (-900.936) (-917.454) -- 0:05:47
      92000 -- (-909.847) (-893.969) [-916.539] (-897.827) * [-887.841] (-915.757) (-901.540) (-922.063) -- 0:05:45
      92500 -- (-903.559) (-901.308) [-903.006] (-898.831) * [-883.963] (-924.795) (-917.891) (-899.110) -- 0:05:43
      93000 -- (-921.893) (-901.790) (-906.644) [-890.701] * [-891.648] (-909.627) (-910.689) (-899.370) -- 0:05:41
      93500 -- (-918.115) [-892.966] (-914.230) (-905.424) * (-894.449) [-907.710] (-920.978) (-919.542) -- 0:05:49
      94000 -- (-903.075) [-906.958] (-914.653) (-900.066) * (-920.856) (-910.452) (-912.561) [-905.783] -- 0:05:46
      94500 -- [-906.148] (-907.825) (-914.860) (-906.876) * (-905.814) [-892.527] (-904.960) (-895.419) -- 0:05:44
      95000 -- (-908.116) (-916.380) (-934.654) [-902.932] * [-902.767] (-914.171) (-897.397) (-913.196) -- 0:05:42

      Average standard deviation of split frequencies: 0.039953

      95500 -- [-905.518] (-912.633) (-940.109) (-905.644) * (-909.775) [-906.445] (-908.002) (-900.587) -- 0:05:40
      96000 -- (-913.573) (-912.716) (-911.354) [-894.472] * [-893.614] (-904.005) (-902.523) (-903.733) -- 0:05:48
      96500 -- (-896.750) (-909.364) (-915.282) [-885.736] * (-905.700) (-908.743) (-922.368) [-907.576] -- 0:05:46
      97000 -- [-898.411] (-896.355) (-923.752) (-900.113) * (-911.123) (-894.378) [-901.177] (-900.036) -- 0:05:44
      97500 -- (-897.863) (-899.895) (-915.375) [-896.357] * (-907.964) (-914.943) [-906.796] (-894.827) -- 0:05:42
      98000 -- (-920.963) (-899.790) (-908.292) [-901.069] * (-904.817) (-919.978) [-898.596] (-901.297) -- 0:05:40
      98500 -- (-920.170) (-920.825) [-899.170] (-908.932) * (-904.699) [-897.103] (-910.339) (-901.138) -- 0:05:47
      99000 -- (-912.210) (-903.446) (-892.385) [-905.200] * (-896.896) (-901.133) [-895.151] (-909.399) -- 0:05:45
      99500 -- (-900.816) (-905.064) (-909.363) [-890.598] * (-903.992) (-913.248) [-890.073] (-909.714) -- 0:05:43
      100000 -- [-886.137] (-904.123) (-908.746) (-898.897) * (-905.380) (-921.335) (-898.077) [-906.612] -- 0:05:42

      Average standard deviation of split frequencies: 0.041922

      100500 -- (-915.035) (-898.313) [-893.922] (-899.456) * (-908.945) (-906.268) (-912.449) [-909.238] -- 0:05:40
      101000 -- [-900.372] (-907.526) (-900.725) (-913.873) * (-896.316) (-900.081) (-914.885) [-893.560] -- 0:05:47
      101500 -- (-911.672) (-920.017) [-898.889] (-919.035) * (-893.520) (-907.409) [-907.009] (-894.447) -- 0:05:45
      102000 -- (-894.843) (-910.218) [-910.140] (-910.880) * (-911.198) (-916.955) [-895.315] (-896.326) -- 0:05:43
      102500 -- (-907.004) (-902.571) (-900.669) [-904.288] * [-898.428] (-914.270) (-902.569) (-889.608) -- 0:05:41
      103000 -- (-905.985) (-898.741) (-902.468) [-909.926] * (-898.417) (-901.638) (-899.274) [-897.650] -- 0:05:39
      103500 -- (-895.907) [-896.681] (-899.679) (-909.743) * (-906.968) [-890.548] (-896.798) (-910.008) -- 0:05:46
      104000 -- (-911.000) [-902.026] (-897.310) (-903.906) * (-923.292) [-897.509] (-901.347) (-902.407) -- 0:05:44
      104500 -- (-904.527) (-912.505) (-905.432) [-898.857] * [-897.141] (-912.168) (-904.468) (-907.023) -- 0:05:42
      105000 -- (-904.714) (-923.538) (-895.547) [-886.955] * [-884.984] (-905.622) (-910.530) (-900.646) -- 0:05:40

      Average standard deviation of split frequencies: 0.040025

      105500 -- (-909.041) [-892.194] (-894.243) (-915.837) * [-901.415] (-921.714) (-901.305) (-905.955) -- 0:05:39
      106000 -- (-915.017) (-907.307) (-893.636) [-905.232] * (-910.396) (-911.306) (-898.088) [-898.121] -- 0:05:45
      106500 -- (-908.718) (-911.228) [-898.728] (-897.528) * (-913.148) [-901.113] (-893.625) (-911.085) -- 0:05:43
      107000 -- (-897.256) (-911.997) (-905.808) [-897.716] * (-901.000) [-894.302] (-898.063) (-911.901) -- 0:05:42
      107500 -- [-900.654] (-912.228) (-918.543) (-910.593) * (-906.566) (-901.348) (-906.205) [-897.557] -- 0:05:40
      108000 -- (-903.047) [-903.337] (-913.992) (-908.889) * (-896.161) [-902.130] (-918.161) (-908.152) -- 0:05:38
      108500 -- (-904.453) (-919.006) (-905.337) [-895.577] * [-905.286] (-908.676) (-904.330) (-903.589) -- 0:05:45
      109000 -- [-897.542] (-911.492) (-899.959) (-905.101) * [-897.125] (-902.061) (-912.624) (-910.761) -- 0:05:43
      109500 -- (-911.385) (-900.004) (-923.808) [-890.377] * (-901.508) (-897.151) [-908.714] (-905.188) -- 0:05:41
      110000 -- [-887.827] (-895.079) (-917.403) (-903.810) * [-891.599] (-899.993) (-911.034) (-914.801) -- 0:05:39

      Average standard deviation of split frequencies: 0.037485

      110500 -- (-904.527) (-897.425) [-894.718] (-902.495) * [-883.805] (-893.556) (-920.016) (-929.387) -- 0:05:46
      111000 -- [-904.949] (-903.675) (-896.030) (-903.360) * (-891.559) (-895.121) (-920.963) [-903.637] -- 0:05:44
      111500 -- (-888.494) [-893.623] (-899.674) (-901.652) * (-910.154) [-905.072] (-899.328) (-907.013) -- 0:05:42
      112000 -- (-893.060) [-898.169] (-913.970) (-904.297) * (-903.849) [-891.877] (-905.519) (-902.016) -- 0:05:40
      112500 -- (-899.100) (-911.058) (-898.537) [-899.984] * (-907.705) (-905.219) [-904.427] (-912.968) -- 0:05:39
      113000 -- (-916.445) (-913.515) (-899.346) [-907.550] * (-909.999) (-913.632) (-914.821) [-894.926] -- 0:05:45
      113500 -- (-899.727) [-898.382] (-899.874) (-913.330) * (-918.194) [-898.955] (-916.329) (-897.261) -- 0:05:43
      114000 -- (-908.640) [-894.863] (-901.136) (-910.917) * [-897.101] (-890.084) (-906.049) (-908.840) -- 0:05:41
      114500 -- (-897.656) [-890.044] (-908.354) (-908.010) * [-893.601] (-902.306) (-921.703) (-907.165) -- 0:05:40
      115000 -- (-913.682) (-909.948) (-906.083) [-912.077] * (-889.157) [-895.544] (-920.173) (-911.241) -- 0:05:46

      Average standard deviation of split frequencies: 0.031088

      115500 -- (-911.658) (-902.095) (-905.005) [-897.053] * [-898.708] (-900.503) (-911.183) (-891.868) -- 0:05:44
      116000 -- (-915.772) [-889.214] (-913.052) (-904.748) * (-897.482) [-900.224] (-900.335) (-893.729) -- 0:05:42
      116500 -- [-902.991] (-902.780) (-905.686) (-902.377) * (-894.453) (-892.141) [-908.900] (-908.511) -- 0:05:41
      117000 -- (-901.736) (-909.309) [-900.486] (-906.659) * (-901.836) [-897.480] (-917.154) (-906.782) -- 0:05:39
      117500 -- (-888.071) (-901.161) [-899.192] (-901.405) * (-907.110) [-901.984] (-909.211) (-901.520) -- 0:05:45
      118000 -- [-893.539] (-926.404) (-895.578) (-902.285) * (-893.805) [-892.395] (-931.021) (-912.724) -- 0:05:43
      118500 -- (-918.762) (-905.474) [-901.154] (-909.221) * [-895.524] (-911.976) (-920.127) (-923.155) -- 0:05:42
      119000 -- [-896.846] (-904.079) (-914.453) (-911.020) * (-912.738) [-901.063] (-903.078) (-920.199) -- 0:05:40
      119500 -- (-899.121) [-892.967] (-896.694) (-894.217) * (-902.151) (-909.886) (-911.537) [-902.798] -- 0:05:38
      120000 -- (-898.662) [-907.589] (-903.890) (-897.708) * (-900.638) (-925.107) (-901.981) [-892.728] -- 0:05:44

      Average standard deviation of split frequencies: 0.029495

      120500 -- [-898.415] (-901.837) (-899.744) (-894.335) * (-899.255) (-925.347) [-889.356] (-912.579) -- 0:05:43
      121000 -- (-906.128) (-905.757) (-919.052) [-903.005] * (-893.173) (-908.503) (-904.254) [-899.153] -- 0:05:41
      121500 -- (-910.006) (-888.634) [-904.181] (-913.940) * (-910.633) (-913.048) [-895.519] (-913.837) -- 0:05:39
      122000 -- [-894.992] (-905.851) (-903.157) (-903.333) * [-896.395] (-909.803) (-914.705) (-898.900) -- 0:05:38
      122500 -- (-897.565) (-903.127) [-898.871] (-910.901) * [-892.303] (-926.030) (-911.821) (-908.061) -- 0:05:43
      123000 -- [-902.143] (-904.969) (-916.654) (-904.557) * [-896.992] (-935.620) (-904.727) (-904.533) -- 0:05:42
      123500 -- (-890.372) [-889.231] (-905.577) (-912.225) * (-898.170) (-930.206) [-895.283] (-892.961) -- 0:05:40
      124000 -- [-889.813] (-894.308) (-903.965) (-893.512) * [-907.288] (-925.853) (-903.565) (-895.603) -- 0:05:39
      124500 -- (-890.033) (-902.320) [-889.040] (-912.458) * (-898.798) (-908.429) [-892.716] (-901.636) -- 0:05:37
      125000 -- (-894.455) (-914.550) (-893.059) [-892.644] * [-900.271] (-919.834) (-905.673) (-908.011) -- 0:05:43

      Average standard deviation of split frequencies: 0.029743

      125500 -- (-895.740) (-904.540) [-892.273] (-905.019) * (-913.223) [-902.521] (-920.335) (-899.707) -- 0:05:41
      126000 -- (-896.201) (-892.106) (-912.846) [-894.320] * (-922.322) (-916.633) (-894.612) [-892.185] -- 0:05:39
      126500 -- (-910.793) (-901.208) (-908.146) [-889.468] * (-908.963) (-910.663) (-912.680) [-893.306] -- 0:05:38
      127000 -- [-902.083] (-915.407) (-908.088) (-897.844) * (-899.644) (-914.236) (-904.076) [-890.782] -- 0:05:36
      127500 -- (-891.870) (-925.822) (-902.836) [-909.280] * (-908.320) (-920.875) (-906.788) [-893.753] -- 0:05:42
      128000 -- (-909.009) (-915.953) [-900.327] (-914.343) * (-911.164) (-912.954) [-909.255] (-898.564) -- 0:05:40
      128500 -- [-891.772] (-912.254) (-899.894) (-914.445) * (-917.573) (-899.760) [-902.086] (-910.004) -- 0:05:39
      129000 -- [-891.480] (-910.014) (-905.010) (-918.376) * (-897.291) (-912.422) [-901.511] (-903.576) -- 0:05:37
      129500 -- [-896.185] (-916.021) (-915.036) (-908.542) * [-904.159] (-900.452) (-904.375) (-906.088) -- 0:05:36
      130000 -- [-893.675] (-911.787) (-922.225) (-908.884) * [-890.076] (-909.438) (-897.971) (-909.562) -- 0:05:41

      Average standard deviation of split frequencies: 0.028681

      130500 -- (-906.567) (-909.125) (-920.504) [-889.400] * [-900.796] (-922.731) (-905.505) (-914.772) -- 0:05:39
      131000 -- (-913.142) [-889.428] (-906.048) (-897.825) * [-901.340] (-899.174) (-900.131) (-909.084) -- 0:05:38
      131500 -- (-903.691) (-905.105) (-897.697) [-895.898] * (-909.960) (-916.955) (-899.949) [-897.568] -- 0:05:36
      132000 -- (-922.832) (-903.965) [-895.560] (-903.793) * (-915.308) [-892.816] (-894.765) (-923.953) -- 0:05:35
      132500 -- [-904.323] (-902.796) (-904.296) (-926.012) * [-896.518] (-900.545) (-904.360) (-906.107) -- 0:05:40
      133000 -- (-932.156) (-896.046) [-896.437] (-911.315) * (-899.292) (-905.868) [-888.147] (-909.778) -- 0:05:38
      133500 -- (-900.902) [-897.533] (-904.212) (-896.766) * (-901.266) (-901.906) [-891.861] (-905.480) -- 0:05:37
      134000 -- [-897.461] (-904.647) (-900.202) (-908.917) * (-898.823) [-895.828] (-900.758) (-910.472) -- 0:05:36
      134500 -- (-911.593) (-907.175) (-901.296) [-901.952] * (-922.721) [-894.519] (-910.864) (-908.019) -- 0:05:34
      135000 -- (-901.878) [-894.702] (-907.934) (-908.688) * [-899.805] (-893.518) (-908.726) (-913.919) -- 0:05:39

      Average standard deviation of split frequencies: 0.028250

      135500 -- (-911.261) [-886.885] (-907.805) (-911.421) * (-901.170) [-900.924] (-919.959) (-921.955) -- 0:05:38
      136000 -- (-907.224) [-911.966] (-915.341) (-910.243) * [-901.976] (-886.839) (-901.778) (-905.352) -- 0:05:36
      136500 -- [-908.719] (-903.781) (-902.029) (-902.120) * (-906.523) [-903.081] (-905.412) (-917.323) -- 0:05:35
      137000 -- (-903.320) [-902.864] (-908.045) (-910.278) * [-890.462] (-912.971) (-898.202) (-904.934) -- 0:05:33
      137500 -- (-907.495) (-916.169) [-895.476] (-910.639) * [-897.770] (-910.449) (-891.207) (-900.552) -- 0:05:38
      138000 -- (-894.628) (-904.936) [-893.168] (-917.531) * (-900.400) (-916.943) (-906.760) [-897.147] -- 0:05:37
      138500 -- [-901.318] (-909.319) (-917.804) (-919.375) * (-902.550) (-907.412) [-907.156] (-909.021) -- 0:05:35
      139000 -- (-897.813) (-906.773) (-900.967) [-908.028] * (-900.027) (-907.770) [-891.548] (-895.013) -- 0:05:34
      139500 -- [-888.175] (-895.441) (-888.554) (-908.053) * (-911.745) (-897.693) (-914.482) [-893.679] -- 0:05:33
      140000 -- (-901.536) [-896.852] (-906.793) (-920.311) * (-899.134) [-897.964] (-915.281) (-914.357) -- 0:05:37

      Average standard deviation of split frequencies: 0.025637

      140500 -- (-916.561) [-893.394] (-888.948) (-909.747) * (-914.319) (-897.207) [-888.255] (-898.990) -- 0:05:36
      141000 -- (-920.352) (-896.018) [-896.971] (-915.571) * (-911.696) (-895.429) (-913.313) [-900.950] -- 0:05:35
      141500 -- (-907.240) (-897.145) [-892.728] (-906.710) * (-916.999) [-891.354] (-909.859) (-896.119) -- 0:05:33
      142000 -- [-909.365] (-892.118) (-900.542) (-903.214) * (-895.052) [-897.695] (-911.783) (-916.445) -- 0:05:32
      142500 -- (-918.336) (-897.652) [-910.616] (-923.109) * (-891.139) [-888.160] (-908.871) (-907.793) -- 0:05:30
      143000 -- (-919.089) (-900.058) (-904.233) [-903.067] * (-893.862) (-908.733) (-929.567) [-910.263] -- 0:05:35
      143500 -- (-907.251) (-915.040) [-898.412] (-910.227) * (-904.417) [-902.912] (-906.742) (-921.398) -- 0:05:34
      144000 -- (-894.168) (-899.296) [-890.202] (-919.070) * [-902.269] (-901.892) (-913.621) (-915.610) -- 0:05:32
      144500 -- (-915.400) (-903.901) [-890.575] (-928.642) * (-902.641) (-919.119) [-908.101] (-910.945) -- 0:05:31
      145000 -- (-906.042) (-907.044) [-890.141] (-900.665) * [-904.106] (-910.790) (-901.197) (-908.524) -- 0:05:30

      Average standard deviation of split frequencies: 0.027283

      145500 -- (-897.861) (-902.116) (-908.657) [-893.146] * (-899.963) (-933.602) [-901.889] (-917.234) -- 0:05:34
      146000 -- (-900.859) (-906.026) (-925.979) [-911.347] * (-914.822) (-931.673) [-894.769] (-900.521) -- 0:05:33
      146500 -- (-901.041) [-904.312] (-919.614) (-905.131) * [-900.891] (-907.996) (-924.266) (-894.730) -- 0:05:32
      147000 -- (-899.050) (-893.456) (-914.381) [-896.222] * (-899.102) (-906.292) (-902.686) [-902.930] -- 0:05:30
      147500 -- (-905.655) (-919.447) [-902.734] (-895.360) * (-905.002) (-916.352) (-906.175) [-908.404] -- 0:05:29
      148000 -- (-895.230) (-937.321) [-897.735] (-904.100) * (-908.352) (-920.837) (-905.505) [-900.666] -- 0:05:33
      148500 -- (-890.908) (-920.194) (-907.164) [-895.252] * (-894.000) [-891.706] (-907.168) (-906.051) -- 0:05:32
      149000 -- (-906.651) (-906.529) (-911.512) [-908.970] * (-899.552) (-925.499) [-901.447] (-893.379) -- 0:05:31
      149500 -- [-898.341] (-921.865) (-898.741) (-906.500) * (-917.456) (-903.156) (-897.547) [-894.569] -- 0:05:29
      150000 -- (-903.193) (-905.267) [-898.330] (-911.890) * (-911.072) (-895.534) [-894.669] (-907.617) -- 0:05:28

      Average standard deviation of split frequencies: 0.025343

      150500 -- (-911.110) [-899.272] (-897.994) (-910.246) * (-903.879) [-892.468] (-902.839) (-917.691) -- 0:05:33
      151000 -- [-896.422] (-917.964) (-903.270) (-902.885) * (-904.481) [-899.170] (-899.891) (-922.646) -- 0:05:31
      151500 -- (-897.399) (-922.868) [-907.886] (-893.776) * (-900.568) (-906.641) (-899.731) [-910.950] -- 0:05:30
      152000 -- (-910.471) [-910.667] (-912.419) (-896.083) * (-896.752) (-898.740) [-882.814] (-906.790) -- 0:05:29
      152500 -- [-899.160] (-925.726) (-895.631) (-905.443) * (-902.006) (-926.408) [-896.232] (-905.123) -- 0:05:27
      153000 -- (-908.663) (-907.857) [-899.335] (-900.400) * (-907.667) (-917.309) [-884.178] (-908.481) -- 0:05:32
      153500 -- (-905.723) (-915.519) [-896.055] (-904.736) * (-919.482) (-909.561) [-887.362] (-919.976) -- 0:05:30
      154000 -- (-902.754) (-897.852) [-893.547] (-917.722) * [-890.365] (-908.813) (-906.562) (-900.840) -- 0:05:29
      154500 -- (-915.941) (-910.094) [-891.775] (-923.231) * (-919.134) [-895.753] (-910.772) (-895.442) -- 0:05:28
      155000 -- (-905.231) (-911.580) [-894.066] (-903.001) * (-914.979) (-894.871) (-910.171) [-891.033] -- 0:05:27

      Average standard deviation of split frequencies: 0.023872

      155500 -- [-897.626] (-909.186) (-894.887) (-914.825) * (-909.778) [-902.074] (-908.708) (-881.158) -- 0:05:31
      156000 -- [-885.505] (-914.211) (-908.650) (-908.675) * [-894.818] (-901.155) (-896.025) (-900.796) -- 0:05:30
      156500 -- [-901.118] (-918.365) (-912.888) (-903.105) * [-886.110] (-902.490) (-914.259) (-922.256) -- 0:05:28
      157000 -- [-892.443] (-919.223) (-896.190) (-906.918) * (-896.133) (-893.919) (-914.784) [-906.807] -- 0:05:27
      157500 -- (-908.098) (-897.444) [-894.099] (-910.348) * [-898.410] (-898.870) (-909.734) (-894.635) -- 0:05:26
      158000 -- (-901.850) (-901.913) [-892.140] (-912.792) * (-907.798) (-924.519) (-904.724) [-892.344] -- 0:05:30
      158500 -- (-902.001) [-901.591] (-901.018) (-913.675) * [-911.962] (-911.894) (-911.061) (-928.789) -- 0:05:29
      159000 -- [-898.116] (-924.443) (-889.489) (-899.891) * (-897.264) (-899.224) [-894.111] (-902.982) -- 0:05:27
      159500 -- (-899.955) (-913.358) [-894.878] (-902.184) * (-906.107) [-893.550] (-926.215) (-899.556) -- 0:05:26
      160000 -- (-895.807) (-905.585) [-897.135] (-904.548) * (-908.320) [-898.043] (-906.776) (-908.323) -- 0:05:25

      Average standard deviation of split frequencies: 0.024646

      160500 -- (-903.445) (-913.671) (-909.080) [-892.957] * (-895.006) (-903.817) [-895.745] (-913.107) -- 0:05:24
      161000 -- (-898.228) (-907.745) (-919.585) [-892.847] * [-900.431] (-917.029) (-907.874) (-909.060) -- 0:05:28
      161500 -- (-906.287) [-905.581] (-931.318) (-889.080) * (-909.079) (-920.767) (-916.538) [-898.793] -- 0:05:27
      162000 -- (-899.193) (-899.676) (-913.168) [-891.242] * (-918.306) (-911.734) [-902.062] (-901.005) -- 0:05:25
      162500 -- (-897.807) (-903.459) [-902.043] (-914.642) * (-918.051) [-900.419] (-903.383) (-908.021) -- 0:05:24
      163000 -- (-896.297) (-915.331) (-913.056) [-891.797] * (-910.025) (-903.851) (-895.732) [-898.893] -- 0:05:23
      163500 -- (-897.752) (-911.292) (-898.641) [-901.904] * (-896.975) (-914.545) [-896.410] (-902.416) -- 0:05:27
      164000 -- (-895.478) (-898.620) [-892.677] (-910.681) * (-895.736) [-912.461] (-905.346) (-912.742) -- 0:05:26
      164500 -- (-905.973) [-907.773] (-903.767) (-908.630) * (-911.297) [-899.153] (-906.797) (-901.471) -- 0:05:25
      165000 -- (-893.275) (-902.139) [-891.681] (-908.869) * (-910.833) (-912.785) (-905.836) [-905.276] -- 0:05:23

      Average standard deviation of split frequencies: 0.022718

      165500 -- [-900.878] (-900.955) (-907.088) (-925.505) * [-903.472] (-909.971) (-907.982) (-920.435) -- 0:05:22
      166000 -- (-911.186) (-898.518) [-898.824] (-916.255) * (-905.512) (-900.615) (-902.770) [-893.259] -- 0:05:26
      166500 -- (-896.843) [-897.027] (-901.339) (-905.924) * (-896.940) (-900.703) [-890.991] (-922.054) -- 0:05:25
      167000 -- (-894.635) [-898.847] (-903.488) (-908.452) * (-909.995) (-904.664) [-894.446] (-914.415) -- 0:05:24
      167500 -- (-895.795) [-893.917] (-908.253) (-920.174) * (-906.612) (-906.487) (-903.726) [-897.693] -- 0:05:23
      168000 -- [-900.580] (-901.883) (-904.195) (-909.187) * (-902.785) (-904.400) (-919.056) [-904.925] -- 0:05:21
      168500 -- (-904.244) [-915.458] (-908.400) (-910.517) * (-912.562) [-897.944] (-914.337) (-896.633) -- 0:05:25
      169000 -- (-902.460) (-892.832) (-908.539) [-902.280] * (-908.578) (-908.032) (-904.233) [-896.212] -- 0:05:24
      169500 -- (-900.292) [-894.216] (-909.123) (-898.291) * (-924.284) (-905.773) (-894.234) [-892.733] -- 0:05:23
      170000 -- (-913.430) [-894.527] (-900.883) (-915.879) * [-902.985] (-903.745) (-908.421) (-901.689) -- 0:05:22

      Average standard deviation of split frequencies: 0.020578

      170500 -- (-900.612) (-906.412) (-891.807) [-890.645] * (-898.052) [-903.914] (-917.367) (-908.186) -- 0:05:21
      171000 -- [-903.999] (-904.635) (-916.527) (-896.369) * [-886.273] (-903.749) (-905.196) (-897.566) -- 0:05:24
      171500 -- (-916.411) [-898.906] (-906.584) (-902.684) * [-901.048] (-899.260) (-894.314) (-900.591) -- 0:05:23
      172000 -- (-907.383) (-921.225) (-912.753) [-903.296] * (-920.396) [-895.848] (-893.449) (-913.446) -- 0:05:22
      172500 -- [-900.500] (-915.140) (-907.337) (-892.197) * (-907.824) (-906.635) [-910.926] (-895.462) -- 0:05:21
      173000 -- [-888.150] (-915.204) (-897.804) (-890.156) * [-889.145] (-913.154) (-915.361) (-900.992) -- 0:05:20
      173500 -- [-895.361] (-913.311) (-896.670) (-912.487) * (-906.093) (-911.884) (-907.368) [-894.784] -- 0:05:19
      174000 -- (-907.583) (-914.383) [-908.381] (-913.235) * (-912.072) (-909.493) [-889.061] (-897.661) -- 0:05:22
      174500 -- [-890.057] (-907.107) (-904.207) (-905.400) * [-902.753] (-920.018) (-912.858) (-911.379) -- 0:05:21
      175000 -- (-903.996) [-900.370] (-922.219) (-928.226) * (-909.132) (-910.352) (-910.321) [-892.308] -- 0:05:20

      Average standard deviation of split frequencies: 0.020490

      175500 -- [-897.937] (-909.685) (-917.982) (-903.175) * (-899.659) (-908.137) [-890.530] (-906.702) -- 0:05:19
      176000 -- (-901.627) (-907.380) (-901.053) [-896.491] * (-897.062) (-911.336) [-909.451] (-906.290) -- 0:05:18
      176500 -- (-911.707) (-909.939) [-892.715] (-897.686) * (-906.024) (-907.518) [-892.847] (-897.333) -- 0:05:21
      177000 -- (-910.226) [-898.920] (-893.130) (-896.024) * (-904.912) (-904.622) (-911.728) [-899.810] -- 0:05:20
      177500 -- (-902.597) [-892.302] (-900.858) (-901.921) * (-899.407) (-906.766) [-899.635] (-907.289) -- 0:05:19
      178000 -- (-899.213) (-906.068) [-904.708] (-900.886) * (-900.387) (-908.915) [-886.371] (-921.490) -- 0:05:18
      178500 -- (-904.590) (-910.663) (-908.135) [-902.801] * [-899.697] (-915.155) (-901.195) (-904.715) -- 0:05:17
      179000 -- [-890.619] (-907.155) (-903.345) (-902.809) * (-900.542) (-900.548) [-897.102] (-915.986) -- 0:05:21
      179500 -- (-902.820) (-898.737) (-918.937) [-891.918] * (-911.821) (-911.212) [-895.211] (-899.478) -- 0:05:19
      180000 -- (-921.402) (-887.908) (-913.439) [-890.565] * (-902.134) (-913.360) [-893.858] (-913.171) -- 0:05:18

      Average standard deviation of split frequencies: 0.020222

      180500 -- (-917.072) (-901.444) (-914.295) [-898.549] * [-922.897] (-905.608) (-892.374) (-907.185) -- 0:05:17
      181000 -- (-909.076) (-906.732) (-904.312) [-889.751] * (-917.508) (-896.332) [-899.706] (-911.093) -- 0:05:16
      181500 -- (-907.484) (-901.184) [-899.355] (-899.893) * (-891.160) [-891.655] (-899.360) (-913.414) -- 0:05:20
      182000 -- (-893.387) (-906.482) [-891.567] (-897.813) * [-898.209] (-904.834) (-896.654) (-902.230) -- 0:05:19
      182500 -- (-895.022) (-909.997) (-901.342) [-906.250] * (-911.709) (-911.967) [-897.961] (-914.345) -- 0:05:18
      183000 -- (-902.598) (-902.829) (-902.771) [-891.785] * (-907.993) (-906.816) [-899.978] (-908.502) -- 0:05:16
      183500 -- (-907.327) (-922.551) [-894.201] (-901.533) * (-912.738) (-909.271) (-896.048) [-904.517] -- 0:05:15
      184000 -- (-910.386) (-909.132) [-898.550] (-908.296) * (-915.708) (-901.644) [-902.222] (-921.277) -- 0:05:19
      184500 -- (-898.933) [-902.388] (-905.136) (-925.760) * (-915.782) [-904.563] (-907.345) (-902.608) -- 0:05:18
      185000 -- (-922.135) (-922.767) [-892.461] (-900.431) * (-905.019) (-898.721) [-899.927] (-905.821) -- 0:05:17

      Average standard deviation of split frequencies: 0.020782

      185500 -- (-895.880) (-917.320) [-902.870] (-914.818) * (-917.438) [-894.622] (-896.746) (-921.432) -- 0:05:16
      186000 -- (-897.593) (-903.076) [-905.365] (-916.370) * (-929.730) [-901.121] (-900.455) (-902.050) -- 0:05:15
      186500 -- [-897.022] (-904.582) (-908.614) (-913.027) * [-898.038] (-901.230) (-903.773) (-916.521) -- 0:05:18
      187000 -- [-923.444] (-900.980) (-898.273) (-911.489) * (-922.622) (-914.377) [-905.270] (-906.138) -- 0:05:17
      187500 -- (-905.010) (-912.442) [-896.299] (-911.685) * (-916.101) (-909.142) (-909.932) [-901.961] -- 0:05:16
      188000 -- [-906.551] (-894.616) (-900.993) (-918.132) * [-900.446] (-903.670) (-912.978) (-914.727) -- 0:05:15
      188500 -- (-901.743) (-896.191) (-900.561) [-905.981] * (-900.256) (-917.298) (-910.786) [-900.671] -- 0:05:14
      189000 -- (-900.482) [-895.646] (-900.963) (-926.321) * [-899.571] (-904.272) (-898.870) (-909.493) -- 0:05:17
      189500 -- (-899.220) [-895.523] (-905.899) (-911.593) * (-899.035) (-920.778) [-908.995] (-907.314) -- 0:05:16
      190000 -- (-890.558) [-897.711] (-907.123) (-915.480) * (-914.887) (-921.725) (-916.398) [-894.654] -- 0:05:15

      Average standard deviation of split frequencies: 0.019779

      190500 -- [-891.436] (-902.558) (-918.975) (-906.109) * (-923.833) (-920.061) (-909.014) [-888.686] -- 0:05:14
      191000 -- (-909.568) [-895.005] (-899.882) (-894.028) * [-908.850] (-892.523) (-915.556) (-902.617) -- 0:05:13
      191500 -- (-900.400) [-892.877] (-902.926) (-899.131) * (-902.818) (-883.877) (-908.738) [-899.542] -- 0:05:12
      192000 -- (-906.398) (-908.784) [-897.215] (-899.431) * (-915.461) [-899.418] (-910.117) (-905.902) -- 0:05:15
      192500 -- (-920.758) [-904.394] (-898.511) (-903.259) * (-902.227) (-909.107) (-919.670) [-897.239] -- 0:05:14
      193000 -- (-911.453) (-926.926) (-899.269) [-893.359] * (-909.725) (-910.193) [-903.552] (-901.931) -- 0:05:13
      193500 -- (-906.792) (-901.291) (-917.363) [-892.499] * (-900.063) (-927.918) (-906.781) [-894.990] -- 0:05:12
      194000 -- (-909.348) [-894.115] (-910.664) (-901.483) * (-915.460) (-906.838) [-899.848] (-911.750) -- 0:05:11
      194500 -- (-909.233) (-915.624) (-907.569) [-912.022] * [-892.591] (-898.813) (-898.546) (-912.609) -- 0:05:14
      195000 -- (-893.778) (-904.800) (-910.936) [-893.078] * (-895.470) (-906.669) (-896.464) [-894.624] -- 0:05:13

      Average standard deviation of split frequencies: 0.018760

      195500 -- [-901.635] (-909.698) (-909.933) (-898.093) * (-917.208) (-907.168) (-900.876) [-895.232] -- 0:05:12
      196000 -- (-911.949) (-917.388) (-894.925) [-905.713] * (-905.272) (-909.041) [-894.526] (-900.283) -- 0:05:11
      196500 -- [-901.322] (-926.208) (-906.824) (-913.708) * (-897.498) (-915.748) [-895.061] (-910.545) -- 0:05:10
      197000 -- (-894.206) (-906.350) [-895.181] (-904.498) * (-898.401) (-902.383) [-886.724] (-921.944) -- 0:05:13
      197500 -- (-901.486) [-889.404] (-909.351) (-911.796) * (-892.967) (-915.730) [-894.144] (-918.083) -- 0:05:12
      198000 -- (-914.119) [-903.954] (-904.950) (-912.263) * (-888.622) [-901.813] (-902.439) (-918.164) -- 0:05:11
      198500 -- (-912.231) (-903.776) (-905.095) [-894.564] * [-894.317] (-920.492) (-908.730) (-926.170) -- 0:05:10
      199000 -- (-908.769) [-913.935] (-903.181) (-897.856) * [-900.543] (-903.439) (-898.208) (-916.136) -- 0:05:09
      199500 -- (-904.097) (-907.825) (-899.282) [-899.892] * (-919.593) [-901.858] (-895.481) (-929.819) -- 0:05:12
      200000 -- (-909.229) (-926.845) [-908.924] (-899.125) * (-906.557) (-923.962) [-898.751] (-913.936) -- 0:05:12

      Average standard deviation of split frequencies: 0.018794

      200500 -- (-912.107) (-920.464) (-901.041) [-898.891] * [-898.875] (-918.875) (-899.026) (-910.019) -- 0:05:11
      201000 -- (-910.668) (-905.364) [-894.147] (-923.763) * (-900.305) (-915.265) (-907.231) [-895.527] -- 0:05:10
      201500 -- (-904.024) (-898.742) (-912.338) [-907.012] * [-895.424] (-897.651) (-901.343) (-898.688) -- 0:05:09
      202000 -- (-896.856) (-908.013) [-900.596] (-901.479) * (-899.622) (-912.985) [-899.876] (-904.906) -- 0:05:08
      202500 -- (-902.029) [-895.444] (-905.767) (-899.084) * [-890.882] (-902.058) (-915.488) (-907.921) -- 0:05:11
      203000 -- (-902.642) (-913.609) (-906.222) [-892.902] * (-908.589) [-907.004] (-919.087) (-905.536) -- 0:05:10
      203500 -- (-914.899) (-899.770) (-912.270) [-896.746] * (-900.883) (-905.482) [-915.209] (-898.696) -- 0:05:09
      204000 -- (-927.933) (-905.867) (-893.085) [-896.756] * (-909.662) (-902.602) (-903.850) [-902.736] -- 0:05:08
      204500 -- (-912.056) (-909.442) (-907.432) [-896.887] * (-901.601) (-891.296) (-922.436) [-887.283] -- 0:05:07
      205000 -- (-915.950) (-909.588) [-888.884] (-905.198) * (-905.564) [-901.274] (-897.163) (-904.296) -- 0:05:10

      Average standard deviation of split frequencies: 0.018765

      205500 -- (-933.499) [-898.165] (-909.913) (-913.541) * (-914.106) [-908.300] (-900.730) (-901.920) -- 0:05:09
      206000 -- (-917.285) (-911.947) [-894.038] (-897.202) * [-922.298] (-928.359) (-917.064) (-910.228) -- 0:05:08
      206500 -- (-903.870) (-893.652) (-909.488) [-896.046] * [-900.623] (-913.105) (-925.114) (-911.687) -- 0:05:07
      207000 -- (-915.910) (-905.761) [-903.209] (-912.189) * [-892.157] (-906.588) (-911.363) (-897.054) -- 0:05:06
      207500 -- [-918.788] (-929.326) (-919.664) (-916.905) * (-898.397) (-910.111) (-913.428) [-886.232] -- 0:05:09
      208000 -- (-910.338) (-926.838) [-897.488] (-910.718) * [-907.968] (-904.762) (-905.752) (-898.169) -- 0:05:08
      208500 -- (-896.543) (-902.618) [-891.531] (-903.894) * [-887.272] (-923.129) (-921.679) (-896.404) -- 0:05:07
      209000 -- [-898.469] (-896.506) (-892.522) (-899.577) * (-897.843) (-906.751) (-918.310) [-894.339] -- 0:05:06
      209500 -- (-894.615) (-894.479) (-904.582) [-893.796] * [-904.279] (-909.949) (-905.154) (-904.100) -- 0:05:05
      210000 -- (-891.389) [-889.612] (-897.590) (-912.282) * (-898.309) (-906.099) (-897.634) [-895.582] -- 0:05:08

      Average standard deviation of split frequencies: 0.018797

      210500 -- [-894.247] (-904.851) (-905.036) (-910.641) * (-904.379) (-903.799) (-902.790) [-904.779] -- 0:05:07
      211000 -- (-906.304) (-903.045) (-903.641) [-893.113] * [-894.791] (-901.768) (-901.861) (-900.354) -- 0:05:06
      211500 -- (-898.738) (-912.999) (-899.155) [-900.725] * [-897.910] (-902.558) (-903.742) (-895.503) -- 0:05:05
      212000 -- [-900.782] (-894.845) (-902.107) (-902.208) * (-908.051) (-910.609) (-899.798) [-885.374] -- 0:05:04
      212500 -- (-909.037) [-898.076] (-902.859) (-910.946) * (-918.175) (-911.446) (-912.996) [-887.134] -- 0:05:07
      213000 -- (-906.237) (-898.893) (-918.276) [-898.755] * (-924.227) (-918.241) (-911.136) [-884.513] -- 0:05:06
      213500 -- (-898.740) [-896.850] (-911.190) (-905.648) * [-892.403] (-908.572) (-917.604) (-897.957) -- 0:05:05
      214000 -- [-904.125] (-904.290) (-905.727) (-894.191) * (-887.277) (-914.272) (-903.968) [-903.943] -- 0:05:04
      214500 -- (-904.305) (-916.106) [-901.970] (-910.969) * [-892.040] (-909.149) (-903.725) (-906.375) -- 0:05:03
      215000 -- (-908.288) (-917.199) [-908.464] (-908.656) * (-911.619) (-911.041) [-891.335] (-898.628) -- 0:05:06

      Average standard deviation of split frequencies: 0.019533

      215500 -- (-905.662) [-905.323] (-912.764) (-894.719) * (-902.278) (-911.062) [-887.519] (-908.037) -- 0:05:05
      216000 -- (-906.296) [-893.523] (-911.250) (-910.537) * (-904.695) (-926.697) [-905.120] (-907.949) -- 0:05:04
      216500 -- [-900.300] (-904.689) (-906.278) (-913.966) * (-924.535) (-930.576) (-898.201) [-907.118] -- 0:05:03
      217000 -- [-896.149] (-908.162) (-906.965) (-918.296) * (-918.124) (-924.575) (-903.677) [-895.158] -- 0:05:03
      217500 -- (-916.304) [-892.787] (-918.154) (-901.575) * (-905.645) [-899.671] (-911.020) (-904.355) -- 0:05:05
      218000 -- (-921.096) (-902.463) (-893.141) [-909.050] * (-917.667) (-909.336) (-900.985) [-897.784] -- 0:05:04
      218500 -- [-906.428] (-899.815) (-908.569) (-905.435) * (-918.900) (-915.306) (-910.358) [-899.044] -- 0:05:04
      219000 -- [-896.341] (-918.671) (-926.528) (-894.532) * (-920.241) (-904.955) (-906.177) [-897.058] -- 0:05:03
      219500 -- [-898.230] (-913.608) (-910.451) (-900.124) * (-902.525) [-903.155] (-903.235) (-904.203) -- 0:05:02
      220000 -- (-915.257) [-901.101] (-902.237) (-904.386) * (-901.368) [-898.055] (-904.684) (-906.693) -- 0:05:04

      Average standard deviation of split frequencies: 0.018479

      220500 -- (-895.649) (-902.751) (-902.484) [-890.994] * (-907.101) (-901.327) (-900.535) [-888.961] -- 0:05:04
      221000 -- (-913.678) [-887.722] (-912.694) (-907.724) * (-904.695) [-895.713] (-915.965) (-903.353) -- 0:05:03
      221500 -- (-901.180) [-901.245] (-920.290) (-910.058) * (-903.376) [-897.674] (-899.972) (-898.605) -- 0:05:02
      222000 -- (-912.017) [-899.095] (-909.190) (-913.997) * (-924.802) [-902.086] (-900.110) (-903.919) -- 0:05:01
      222500 -- (-897.942) [-899.625] (-919.418) (-910.761) * [-905.913] (-904.858) (-906.754) (-903.689) -- 0:05:04
      223000 -- (-908.477) [-904.733] (-907.317) (-905.094) * (-892.529) [-892.810] (-916.375) (-906.583) -- 0:05:03
      223500 -- (-906.395) [-907.983] (-896.234) (-908.350) * (-888.335) (-909.426) [-901.055] (-919.465) -- 0:05:02
      224000 -- (-893.875) (-896.811) [-891.783] (-906.557) * (-901.869) (-907.525) [-912.052] (-901.310) -- 0:05:01
      224500 -- (-891.971) (-901.811) [-899.620] (-906.394) * (-919.447) (-903.104) (-907.275) [-909.955] -- 0:05:00
      225000 -- [-901.345] (-900.617) (-902.716) (-906.858) * [-896.803] (-917.942) (-899.189) (-916.663) -- 0:05:03

      Average standard deviation of split frequencies: 0.018877

      225500 -- (-897.814) (-899.744) [-901.022] (-899.817) * (-910.597) (-902.723) [-888.806] (-894.165) -- 0:05:02
      226000 -- (-911.467) [-887.201] (-900.101) (-907.578) * (-905.774) (-904.079) [-896.310] (-899.377) -- 0:05:01
      226500 -- (-909.842) [-900.679] (-912.523) (-910.674) * (-910.125) [-897.400] (-893.368) (-906.088) -- 0:05:00
      227000 -- [-902.786] (-916.703) (-918.760) (-903.816) * (-919.968) [-898.771] (-918.792) (-903.734) -- 0:04:59
      227500 -- (-913.027) (-907.853) (-908.159) [-902.155] * (-925.374) (-905.274) [-884.319] (-902.764) -- 0:05:02
      228000 -- (-918.525) (-912.054) [-899.045] (-897.515) * [-899.905] (-904.499) (-894.017) (-927.824) -- 0:05:01
      228500 -- (-923.744) [-901.791] (-898.411) (-907.124) * [-894.509] (-900.750) (-910.353) (-939.009) -- 0:05:00
      229000 -- (-908.227) (-909.141) [-899.287] (-906.123) * (-892.192) (-894.475) (-902.318) [-914.421] -- 0:04:59
      229500 -- (-900.387) (-910.560) (-900.969) [-898.176] * (-894.973) [-888.181] (-912.550) (-911.594) -- 0:04:58
      230000 -- (-902.259) (-902.516) [-899.784] (-903.132) * (-902.514) [-886.786] (-909.007) (-902.164) -- 0:05:01

      Average standard deviation of split frequencies: 0.016247

      230500 -- (-896.384) [-895.330] (-909.552) (-891.054) * [-899.501] (-912.491) (-901.579) (-919.602) -- 0:05:00
      231000 -- [-892.217] (-898.285) (-908.769) (-891.337) * [-900.464] (-913.474) (-894.148) (-912.460) -- 0:04:59
      231500 -- (-904.856) (-909.552) (-903.178) [-894.692] * (-910.833) [-906.585] (-892.415) (-907.384) -- 0:04:58
      232000 -- (-909.245) (-917.816) (-908.966) [-896.184] * (-910.763) (-908.420) (-904.553) [-902.431] -- 0:04:57
      232500 -- [-888.260] (-910.366) (-908.214) (-904.663) * (-909.465) [-904.404] (-912.569) (-904.230) -- 0:05:00
      233000 -- (-888.091) (-930.902) [-907.597] (-908.135) * (-914.931) [-895.261] (-905.854) (-903.172) -- 0:04:59
      233500 -- [-886.907] (-898.521) (-922.940) (-913.445) * (-904.990) [-879.404] (-903.713) (-896.226) -- 0:04:58
      234000 -- (-902.982) (-903.592) [-899.052] (-899.794) * (-903.262) [-894.942] (-908.100) (-892.641) -- 0:04:57
      234500 -- (-911.716) (-904.564) [-893.394] (-898.464) * [-892.867] (-907.395) (-911.049) (-901.559) -- 0:04:57
      235000 -- (-905.704) (-920.563) (-897.435) [-894.200] * (-908.984) (-905.851) (-904.222) [-908.554] -- 0:04:59

      Average standard deviation of split frequencies: 0.016379

      235500 -- (-904.369) (-902.171) (-894.315) [-900.061] * (-899.302) (-898.480) [-897.643] (-911.873) -- 0:04:58
      236000 -- (-908.002) (-895.912) (-905.902) [-891.224] * (-902.680) (-903.866) [-899.611] (-920.111) -- 0:04:57
      236500 -- (-898.007) (-897.092) (-903.718) [-890.239] * [-888.455] (-903.828) (-909.679) (-920.386) -- 0:04:57
      237000 -- (-910.485) (-891.643) (-909.807) [-906.742] * (-901.243) [-892.407] (-918.021) (-895.484) -- 0:04:56
      237500 -- (-909.288) [-901.357] (-910.405) (-917.354) * (-914.396) (-905.166) (-917.624) [-893.258] -- 0:04:55
      238000 -- (-918.516) [-895.275] (-918.092) (-904.843) * (-907.678) [-906.854] (-914.093) (-900.155) -- 0:04:57
      238500 -- (-901.979) [-896.858] (-909.446) (-910.637) * (-903.779) (-916.270) (-896.891) [-898.584] -- 0:04:56
      239000 -- [-908.623] (-905.122) (-919.170) (-906.879) * (-902.159) (-926.664) [-898.361] (-898.756) -- 0:04:56
      239500 -- (-911.155) (-912.671) [-896.727] (-912.621) * [-905.489] (-913.670) (-901.410) (-901.874) -- 0:04:55
      240000 -- (-904.176) (-912.485) [-904.019] (-905.446) * (-903.045) (-896.336) [-893.795] (-898.419) -- 0:04:54

      Average standard deviation of split frequencies: 0.015866

      240500 -- (-907.529) (-905.038) [-897.709] (-913.446) * (-907.232) (-908.576) (-896.649) [-893.846] -- 0:04:56
      241000 -- (-899.767) (-921.799) [-899.132] (-912.097) * [-901.715] (-921.660) (-905.117) (-907.578) -- 0:04:56
      241500 -- (-895.443) (-908.729) [-889.728] (-907.344) * (-899.678) (-896.839) [-900.391] (-888.767) -- 0:04:55
      242000 -- [-901.086] (-907.316) (-920.997) (-898.744) * (-903.626) (-904.101) (-901.226) [-890.801] -- 0:04:54
      242500 -- (-906.224) [-896.613] (-926.649) (-907.687) * (-910.399) [-902.418] (-900.985) (-903.611) -- 0:04:53
      243000 -- (-901.154) [-911.774] (-927.205) (-910.102) * (-938.197) (-895.030) [-887.813] (-902.757) -- 0:04:55
      243500 -- (-908.592) (-900.792) [-908.566] (-908.696) * (-908.656) (-896.218) [-891.472] (-921.594) -- 0:04:55
      244000 -- (-904.632) [-893.410] (-900.277) (-918.644) * (-904.350) (-899.897) [-892.862] (-891.069) -- 0:04:54
      244500 -- (-897.443) (-901.492) (-917.394) [-903.456] * [-886.945] (-910.343) (-907.002) (-904.829) -- 0:04:53
      245000 -- (-895.915) [-903.831] (-902.386) (-907.834) * [-890.880] (-914.745) (-914.362) (-899.535) -- 0:04:52

      Average standard deviation of split frequencies: 0.014085

      245500 -- [-897.564] (-911.560) (-914.886) (-907.251) * (-892.289) (-902.886) (-907.013) [-888.055] -- 0:04:55
      246000 -- [-894.721] (-928.208) (-900.848) (-900.716) * (-892.489) [-900.181] (-922.134) (-895.486) -- 0:04:54
      246500 -- (-905.610) [-904.804] (-903.217) (-902.184) * (-909.061) (-897.978) [-909.890] (-898.164) -- 0:04:53
      247000 -- (-915.340) (-921.356) (-908.060) [-894.333] * (-912.061) (-896.582) (-908.023) [-894.249] -- 0:04:52
      247500 -- (-909.758) (-908.455) [-900.110] (-896.724) * (-921.423) [-904.340] (-909.047) (-908.324) -- 0:04:51
      248000 -- (-905.853) [-899.727] (-923.913) (-901.933) * [-897.132] (-898.293) (-904.187) (-898.341) -- 0:04:54
      248500 -- (-912.815) (-908.474) [-898.759] (-916.503) * (-905.384) [-894.315] (-903.887) (-927.077) -- 0:04:53
      249000 -- [-905.863] (-905.411) (-902.105) (-906.421) * [-893.020] (-900.792) (-903.045) (-925.482) -- 0:04:52
      249500 -- (-903.577) (-887.682) [-901.427] (-898.365) * [-887.913] (-905.971) (-895.199) (-908.834) -- 0:04:51
      250000 -- (-905.449) (-892.885) [-898.662] (-911.537) * [-895.687] (-904.994) (-904.492) (-923.267) -- 0:04:51

      Average standard deviation of split frequencies: 0.013258

      250500 -- (-896.926) (-905.238) [-894.756] (-905.124) * (-913.882) [-905.487] (-915.124) (-918.908) -- 0:04:53
      251000 -- (-899.284) (-912.695) (-909.984) [-898.028] * [-893.905] (-908.465) (-914.765) (-905.388) -- 0:04:52
      251500 -- (-919.950) (-911.890) [-913.813] (-904.194) * (-903.670) [-889.617] (-923.528) (-902.142) -- 0:04:51
      252000 -- (-919.580) [-895.950] (-906.194) (-906.677) * [-899.082] (-899.332) (-900.426) (-919.521) -- 0:04:50
      252500 -- (-917.930) (-895.223) (-904.748) [-902.295] * (-909.957) (-890.328) [-894.207] (-900.032) -- 0:04:50
      253000 -- (-905.132) [-889.660] (-919.097) (-914.056) * (-913.817) [-897.216] (-911.696) (-903.204) -- 0:04:52
      253500 -- (-908.963) (-909.805) (-916.478) [-901.970] * [-891.864] (-900.355) (-916.845) (-900.003) -- 0:04:51
      254000 -- (-906.597) (-906.534) [-899.069] (-903.734) * [-898.155] (-905.670) (-915.070) (-904.575) -- 0:04:50
      254500 -- (-897.002) (-935.074) [-906.242] (-909.519) * (-906.396) (-906.502) (-903.804) [-890.080] -- 0:04:49
      255000 -- (-900.612) (-902.700) [-898.959] (-903.289) * (-923.000) [-897.303] (-894.667) (-898.932) -- 0:04:49

      Average standard deviation of split frequencies: 0.013995

      255500 -- (-904.427) [-892.891] (-912.958) (-896.482) * (-910.881) (-923.221) (-919.737) [-893.042] -- 0:04:48
      256000 -- (-904.576) [-895.870] (-911.635) (-896.720) * [-892.710] (-912.118) (-915.360) (-894.835) -- 0:04:50
      256500 -- [-895.936] (-900.915) (-910.473) (-903.175) * [-896.606] (-908.366) (-896.656) (-897.348) -- 0:04:49
      257000 -- (-910.771) (-914.356) (-926.622) [-900.517] * (-929.182) [-902.829] (-902.518) (-901.424) -- 0:04:49
      257500 -- [-897.619] (-902.813) (-916.130) (-910.207) * (-920.486) (-892.225) [-895.816] (-924.920) -- 0:04:48
      258000 -- [-895.222] (-921.688) (-904.052) (-905.359) * (-898.050) (-899.203) [-903.897] (-905.712) -- 0:04:47
      258500 -- (-903.181) (-919.938) [-906.810] (-902.987) * (-892.246) (-921.583) [-890.568] (-909.743) -- 0:04:49
      259000 -- [-904.076] (-913.385) (-910.875) (-927.763) * (-903.714) (-907.653) [-895.606] (-899.584) -- 0:04:48
      259500 -- (-914.162) (-904.249) [-909.542] (-913.235) * [-891.810] (-910.317) (-906.236) (-898.300) -- 0:04:48
      260000 -- (-903.807) [-897.234] (-895.490) (-905.645) * (-906.836) [-898.907] (-913.185) (-896.784) -- 0:04:47

      Average standard deviation of split frequencies: 0.013021

      260500 -- (-901.763) (-904.742) (-901.898) [-892.889] * [-894.584] (-905.565) (-906.098) (-904.584) -- 0:04:46
      261000 -- (-896.276) (-891.282) (-907.064) [-887.496] * (-914.850) (-926.309) [-889.411] (-902.403) -- 0:04:48
      261500 -- (-905.476) (-903.582) (-899.200) [-896.655] * (-889.955) [-903.520] (-906.719) (-901.366) -- 0:04:48
      262000 -- (-900.532) [-908.876] (-915.974) (-911.490) * (-905.950) (-901.806) (-902.597) [-891.404] -- 0:04:47
      262500 -- (-905.277) (-899.009) (-910.507) [-901.320] * (-903.781) (-918.019) [-902.943] (-914.964) -- 0:04:46
      263000 -- [-898.292] (-899.505) (-907.572) (-899.069) * [-904.946] (-902.676) (-913.365) (-906.893) -- 0:04:45
      263500 -- (-898.823) (-893.460) (-911.499) [-904.555] * (-943.799) (-914.312) (-905.721) [-892.515] -- 0:04:45
      264000 -- (-892.844) (-885.932) (-924.756) [-899.693] * (-919.446) (-899.512) [-905.930] (-902.421) -- 0:04:47
      264500 -- (-920.520) (-895.735) [-909.373] (-898.176) * [-903.050] (-907.634) (-911.505) (-902.130) -- 0:04:46
      265000 -- (-896.781) (-909.778) (-910.400) [-898.193] * [-895.201] (-912.266) (-906.164) (-901.433) -- 0:04:45

      Average standard deviation of split frequencies: 0.013114

      265500 -- (-897.208) (-907.746) (-915.667) [-895.803] * [-899.032] (-892.633) (-906.676) (-898.588) -- 0:04:44
      266000 -- (-900.312) [-893.166] (-912.420) (-907.711) * (-898.914) [-895.526] (-899.503) (-904.678) -- 0:04:44
      266500 -- (-912.618) (-912.158) (-913.836) [-899.269] * (-935.262) (-930.050) [-896.643] (-894.518) -- 0:04:46
      267000 -- (-917.703) (-909.191) (-925.283) [-895.848] * (-913.937) (-902.630) (-903.972) [-897.331] -- 0:04:45
      267500 -- (-890.903) [-908.465] (-901.769) (-901.303) * [-897.729] (-900.517) (-907.597) (-904.810) -- 0:04:44
      268000 -- (-907.435) (-901.221) (-898.302) [-895.925] * [-905.803] (-903.666) (-909.463) (-903.892) -- 0:04:44
      268500 -- (-915.920) (-910.906) [-902.247] (-912.533) * (-908.217) [-900.710] (-903.709) (-919.438) -- 0:04:43
      269000 -- (-905.978) (-885.242) (-915.025) [-897.816] * (-908.443) [-916.082] (-897.531) (-920.508) -- 0:04:45
      269500 -- (-918.055) [-898.480] (-906.028) (-913.729) * (-904.272) (-915.922) (-916.227) [-892.131] -- 0:04:44
      270000 -- (-913.995) [-895.284] (-909.768) (-909.401) * (-900.749) (-896.638) [-901.649] (-890.590) -- 0:04:43

      Average standard deviation of split frequencies: 0.012279

      270500 -- (-913.704) (-917.700) (-899.952) [-888.522] * (-898.954) (-899.110) (-907.295) [-901.466] -- 0:04:43
      271000 -- [-897.529] (-902.608) (-901.450) (-904.720) * (-889.630) (-910.319) [-905.323] (-909.017) -- 0:04:42
      271500 -- (-908.793) [-890.397] (-911.433) (-899.166) * [-897.244] (-907.313) (-900.295) (-904.002) -- 0:04:44
      272000 -- (-900.958) (-915.133) (-919.514) [-898.235] * (-909.082) (-916.437) (-910.983) [-893.970] -- 0:04:43
      272500 -- [-902.549] (-910.669) (-916.689) (-903.808) * (-903.687) (-900.303) (-902.930) [-893.627] -- 0:04:42
      273000 -- (-903.462) (-902.598) (-906.881) [-894.680] * [-900.107] (-905.341) (-910.490) (-896.280) -- 0:04:42
      273500 -- (-892.609) (-920.806) [-896.906] (-893.315) * (-900.994) (-902.519) (-916.135) [-896.517] -- 0:04:41
      274000 -- (-901.709) (-905.097) (-898.400) [-902.310] * [-898.872] (-905.103) (-909.952) (-922.507) -- 0:04:43
      274500 -- (-910.832) [-900.552] (-914.973) (-892.848) * (-890.041) (-901.500) [-901.920] (-912.754) -- 0:04:42
      275000 -- (-914.535) (-892.863) (-902.833) [-897.718] * (-895.143) (-897.959) [-895.316] (-910.025) -- 0:04:42

      Average standard deviation of split frequencies: 0.011956

      275500 -- (-911.884) (-903.080) [-905.589] (-916.937) * [-904.729] (-892.032) (-916.976) (-920.926) -- 0:04:41
      276000 -- [-913.494] (-901.411) (-896.639) (-913.124) * (-895.994) [-902.203] (-914.025) (-902.657) -- 0:04:40
      276500 -- (-901.492) (-919.479) (-897.128) [-905.705] * (-906.059) (-921.796) (-901.931) [-912.916] -- 0:04:39
      277000 -- (-914.590) (-903.184) [-898.339] (-905.051) * [-894.937] (-904.791) (-913.344) (-901.621) -- 0:04:41
      277500 -- (-919.701) [-896.669] (-902.510) (-916.220) * (-904.736) (-900.312) (-902.225) [-900.744] -- 0:04:41
      278000 -- (-906.313) [-898.141] (-907.824) (-898.809) * [-908.102] (-916.196) (-918.443) (-916.027) -- 0:04:40
      278500 -- (-906.120) (-897.453) [-893.995] (-906.582) * (-900.600) (-901.992) [-901.550] (-908.480) -- 0:04:39
      279000 -- (-902.713) (-901.177) [-890.511] (-905.749) * (-909.629) (-895.380) [-901.508] (-896.773) -- 0:04:39
      279500 -- (-904.194) (-907.898) (-905.050) [-900.323] * (-904.298) (-923.255) (-900.846) [-899.841] -- 0:04:40
      280000 -- (-903.043) [-896.548] (-915.041) (-897.443) * (-908.126) (-916.775) (-901.469) [-901.783] -- 0:04:40

      Average standard deviation of split frequencies: 0.012933

      280500 -- [-889.646] (-902.618) (-914.369) (-905.953) * (-901.659) (-900.521) (-912.291) [-907.020] -- 0:04:39
      281000 -- [-889.583] (-907.640) (-897.556) (-912.791) * (-901.486) [-891.154] (-907.169) (-897.457) -- 0:04:38
      281500 -- (-912.693) (-917.151) (-898.382) [-899.698] * [-904.138] (-900.723) (-916.375) (-910.409) -- 0:04:38
      282000 -- (-904.802) [-911.097] (-914.129) (-903.913) * (-908.425) (-907.684) (-906.224) [-895.203] -- 0:04:40
      282500 -- [-895.118] (-900.801) (-914.735) (-898.529) * (-908.049) (-907.071) (-904.795) [-901.779] -- 0:04:39
      283000 -- (-912.051) (-902.331) [-896.093] (-893.786) * (-905.065) (-916.516) [-893.807] (-903.484) -- 0:04:38
      283500 -- (-910.639) (-912.251) [-886.878] (-903.604) * (-925.411) (-904.427) (-904.939) [-899.526] -- 0:04:38
      284000 -- [-903.175] (-895.773) (-904.959) (-908.426) * (-914.134) [-887.817] (-900.449) (-902.036) -- 0:04:37
      284500 -- (-906.092) (-905.746) [-883.870] (-909.577) * [-901.336] (-895.938) (-904.895) (-902.485) -- 0:04:39
      285000 -- (-908.753) (-914.547) [-886.015] (-903.751) * (-905.427) (-906.137) [-893.398] (-903.823) -- 0:04:38

      Average standard deviation of split frequencies: 0.013186

      285500 -- [-893.011] (-899.036) (-911.424) (-907.452) * [-898.231] (-907.795) (-902.990) (-902.892) -- 0:04:37
      286000 -- (-913.639) (-914.235) (-904.500) [-905.128] * [-894.248] (-896.182) (-912.338) (-911.466) -- 0:04:37
      286500 -- [-904.966] (-907.956) (-905.064) (-915.575) * (-899.224) (-919.630) [-904.020] (-903.086) -- 0:04:36
      287000 -- (-917.963) [-895.667] (-900.653) (-898.092) * [-890.883] (-897.262) (-907.026) (-907.240) -- 0:04:38
      287500 -- (-914.400) (-902.084) [-889.942] (-906.196) * (-902.888) (-909.728) (-915.440) [-898.025] -- 0:04:37
      288000 -- (-908.878) (-905.766) [-902.097] (-921.606) * (-905.529) [-906.398] (-911.101) (-897.140) -- 0:04:36
      288500 -- (-902.741) [-896.897] (-909.816) (-898.381) * [-899.507] (-914.071) (-913.126) (-907.029) -- 0:04:36
      289000 -- [-894.209] (-891.718) (-913.074) (-905.128) * [-899.541] (-901.248) (-908.962) (-910.257) -- 0:04:35
      289500 -- [-897.894] (-906.373) (-927.891) (-902.057) * [-893.738] (-893.821) (-922.006) (-907.716) -- 0:04:37
      290000 -- [-903.970] (-892.593) (-927.127) (-901.738) * (-906.806) [-890.241] (-908.994) (-895.031) -- 0:04:36

      Average standard deviation of split frequencies: 0.013461

      290500 -- (-897.324) [-889.669] (-905.354) (-910.531) * [-908.080] (-897.131) (-917.198) (-905.571) -- 0:04:35
      291000 -- [-906.175] (-895.344) (-909.159) (-905.017) * (-905.266) [-889.620] (-906.787) (-898.982) -- 0:04:35
      291500 -- (-911.493) (-907.636) [-906.677] (-917.064) * (-895.209) (-914.494) (-909.645) [-899.305] -- 0:04:34
      292000 -- [-898.155] (-899.473) (-904.261) (-920.051) * (-907.714) (-899.190) [-890.931] (-905.050) -- 0:04:36
      292500 -- [-895.740] (-904.366) (-903.522) (-907.599) * (-914.316) (-889.939) (-893.957) [-900.774] -- 0:04:35
      293000 -- [-905.525] (-897.014) (-910.548) (-920.295) * [-900.524] (-894.725) (-894.347) (-911.184) -- 0:04:35
      293500 -- [-897.415] (-904.052) (-906.717) (-906.089) * (-912.093) (-898.390) [-887.983] (-903.787) -- 0:04:34
      294000 -- [-897.229] (-901.242) (-925.887) (-908.546) * (-903.504) [-897.252] (-907.784) (-895.393) -- 0:04:33
      294500 -- (-901.932) [-901.940] (-903.160) (-902.552) * [-895.718] (-897.963) (-898.935) (-907.144) -- 0:04:35
      295000 -- [-891.020] (-898.029) (-920.747) (-900.156) * (-905.106) (-914.816) [-895.568] (-897.887) -- 0:04:34

      Average standard deviation of split frequencies: 0.014094

      295500 -- [-899.313] (-907.224) (-895.695) (-902.984) * [-900.182] (-928.408) (-898.652) (-912.300) -- 0:04:34
      296000 -- [-893.165] (-912.785) (-905.757) (-911.009) * (-902.700) [-900.576] (-907.590) (-903.956) -- 0:04:33
      296500 -- (-899.302) (-916.164) [-899.016] (-909.299) * (-896.712) [-891.740] (-892.338) (-910.713) -- 0:04:32
      297000 -- (-928.576) (-909.179) (-897.482) [-899.528] * (-898.014) (-915.917) (-902.766) [-898.963] -- 0:04:34
      297500 -- (-917.354) (-901.704) (-905.452) [-886.713] * (-895.674) (-909.727) [-908.257] (-903.001) -- 0:04:33
      298000 -- (-904.119) (-900.590) [-901.832] (-892.048) * (-905.707) [-890.393] (-898.722) (-913.083) -- 0:04:33
      298500 -- (-898.330) (-905.997) [-902.615] (-897.433) * (-909.649) [-889.170] (-899.376) (-908.546) -- 0:04:32
      299000 -- (-908.777) [-909.489] (-899.843) (-893.140) * [-893.983] (-915.007) (-891.769) (-911.297) -- 0:04:31
      299500 -- (-901.546) [-903.032] (-925.476) (-899.898) * (-916.770) (-886.283) [-896.536] (-917.526) -- 0:04:33
      300000 -- (-914.475) (-906.507) [-903.092] (-909.454) * (-899.545) [-910.151] (-907.148) (-911.840) -- 0:04:33

      Average standard deviation of split frequencies: 0.014973

      300500 -- (-905.194) (-906.640) [-895.579] (-896.013) * [-890.394] (-903.731) (-908.188) (-913.754) -- 0:04:32
      301000 -- (-904.345) [-906.178] (-901.483) (-904.361) * (-899.164) (-891.415) [-904.682] (-917.742) -- 0:04:31
      301500 -- [-901.207] (-922.327) (-917.980) (-896.891) * (-905.059) (-903.882) (-893.816) [-895.413] -- 0:04:31
      302000 -- [-898.147] (-905.831) (-903.562) (-891.135) * (-904.187) (-912.833) [-901.989] (-898.799) -- 0:04:32
      302500 -- [-889.271] (-898.913) (-897.828) (-913.469) * (-911.629) [-894.586] (-903.376) (-902.447) -- 0:04:32
      303000 -- (-903.723) (-901.122) [-896.388] (-917.780) * (-897.798) (-904.906) (-907.888) [-895.342] -- 0:04:31
      303500 -- (-900.070) (-915.613) [-894.193] (-913.596) * (-908.515) [-891.920] (-901.766) (-894.631) -- 0:04:30
      304000 -- [-886.242] (-906.516) (-897.216) (-913.351) * (-931.086) [-900.768] (-912.878) (-890.759) -- 0:04:30
      304500 -- [-896.374] (-925.327) (-914.050) (-904.013) * (-917.670) [-907.231] (-908.332) (-896.056) -- 0:04:31
      305000 -- (-900.525) (-915.436) (-910.917) [-899.736] * [-900.466] (-901.363) (-910.023) (-909.662) -- 0:04:31

      Average standard deviation of split frequencies: 0.014019

      305500 -- (-893.349) (-916.993) (-908.557) [-901.876] * (-919.471) (-901.451) (-921.342) [-893.231] -- 0:04:30
      306000 -- (-921.964) [-910.006] (-905.206) (-907.392) * (-901.610) (-904.108) (-907.886) [-910.128] -- 0:04:29
      306500 -- [-894.128] (-911.892) (-909.380) (-901.539) * (-925.782) (-909.556) (-909.526) [-899.528] -- 0:04:29
      307000 -- [-908.416] (-920.784) (-902.794) (-903.760) * (-906.466) (-896.101) (-908.723) [-906.209] -- 0:04:30
      307500 -- (-901.330) (-923.721) [-891.608] (-895.332) * (-912.326) (-901.619) (-912.869) [-892.842] -- 0:04:30
      308000 -- (-912.728) [-899.072] (-922.510) (-894.409) * (-897.337) (-912.419) (-915.635) [-891.048] -- 0:04:29
      308500 -- [-896.017] (-892.901) (-909.788) (-903.164) * (-897.587) [-915.598] (-905.516) (-912.210) -- 0:04:28
      309000 -- [-903.167] (-893.110) (-899.237) (-922.830) * (-914.200) (-907.224) (-902.517) [-895.130] -- 0:04:28
      309500 -- (-913.740) (-896.980) [-907.287] (-909.268) * (-906.644) [-891.131] (-914.703) (-907.807) -- 0:04:29
      310000 -- (-902.470) [-903.899] (-905.557) (-901.239) * [-893.836] (-901.114) (-900.042) (-931.438) -- 0:04:29

      Average standard deviation of split frequencies: 0.014036

      310500 -- (-904.988) (-907.133) [-898.432] (-911.949) * (-910.943) (-903.279) (-901.706) [-890.122] -- 0:04:28
      311000 -- (-911.324) (-921.096) [-905.424] (-901.241) * (-908.916) [-895.257] (-908.121) (-900.688) -- 0:04:28
      311500 -- (-918.073) (-914.656) [-898.237] (-893.875) * (-922.570) [-909.880] (-904.379) (-907.088) -- 0:04:27
      312000 -- (-906.369) (-902.074) [-890.214] (-899.116) * [-900.624] (-925.061) (-911.458) (-902.247) -- 0:04:29
      312500 -- [-894.590] (-905.727) (-915.303) (-904.194) * (-897.713) (-909.722) (-922.377) [-896.134] -- 0:04:28
      313000 -- (-904.422) (-894.920) (-903.854) [-905.462] * (-898.175) (-910.627) [-888.078] (-897.622) -- 0:04:27
      313500 -- (-911.139) [-908.357] (-903.800) (-912.583) * [-898.888] (-897.431) (-907.918) (-908.338) -- 0:04:27
      314000 -- [-890.371] (-905.592) (-914.532) (-919.265) * (-908.473) [-896.406] (-907.621) (-916.447) -- 0:04:26
      314500 -- (-909.954) (-926.762) [-908.002] (-896.749) * [-887.133] (-906.410) (-905.470) (-902.288) -- 0:04:28
      315000 -- (-916.053) [-910.170] (-900.736) (-897.733) * [-890.014] (-904.737) (-891.980) (-906.745) -- 0:04:27

      Average standard deviation of split frequencies: 0.013426

      315500 -- (-911.525) (-921.166) (-899.476) [-894.087] * (-903.405) [-899.451] (-908.488) (-900.977) -- 0:04:26
      316000 -- (-926.937) (-901.636) [-901.817] (-903.140) * (-906.750) (-906.714) [-895.809] (-912.978) -- 0:04:26
      316500 -- (-905.609) (-904.926) [-893.555] (-916.662) * (-910.827) (-914.064) [-896.794] (-903.859) -- 0:04:25
      317000 -- (-901.790) (-920.564) [-900.074] (-909.830) * (-914.000) [-896.421] (-902.331) (-910.617) -- 0:04:27
      317500 -- (-897.901) [-892.001] (-911.439) (-923.876) * (-899.332) (-897.971) [-898.042] (-903.238) -- 0:04:26
      318000 -- (-904.038) [-884.934] (-913.564) (-908.374) * [-888.262] (-906.851) (-915.246) (-905.416) -- 0:04:25
      318500 -- [-904.612] (-901.411) (-902.889) (-915.502) * [-901.528] (-923.851) (-907.940) (-908.988) -- 0:04:25
      319000 -- (-908.971) (-915.479) [-894.494] (-893.785) * [-893.986] (-912.719) (-914.443) (-896.246) -- 0:04:24
      319500 -- (-898.638) (-900.706) [-889.290] (-911.125) * [-895.502] (-908.860) (-912.539) (-901.907) -- 0:04:26
      320000 -- (-914.241) [-890.667] (-901.965) (-902.003) * (-899.919) [-899.256] (-909.312) (-919.168) -- 0:04:25

      Average standard deviation of split frequencies: 0.012496

      320500 -- (-911.501) (-912.934) (-899.547) [-907.693] * (-899.941) (-900.462) [-899.346] (-899.246) -- 0:04:25
      321000 -- (-937.173) [-901.881] (-920.713) (-915.428) * (-917.181) (-911.163) (-914.825) [-901.637] -- 0:04:24
      321500 -- (-898.962) (-905.760) [-895.989] (-907.385) * (-904.685) [-901.151] (-901.897) (-902.504) -- 0:04:23
      322000 -- (-906.425) (-905.902) [-899.201] (-905.222) * (-890.552) [-890.219] (-913.420) (-901.255) -- 0:04:25
      322500 -- (-908.051) (-910.227) [-897.958] (-916.755) * (-903.313) (-889.166) (-908.510) [-901.633] -- 0:04:24
      323000 -- (-912.436) (-898.132) [-893.191] (-917.028) * (-899.520) [-904.534] (-911.748) (-899.985) -- 0:04:24
      323500 -- (-895.761) [-908.370] (-897.302) (-905.552) * (-889.881) [-902.030] (-918.021) (-903.799) -- 0:04:23
      324000 -- (-908.821) (-904.702) (-902.622) [-904.527] * [-915.632] (-894.831) (-923.585) (-907.634) -- 0:04:22
      324500 -- (-901.526) (-907.499) [-889.051] (-894.116) * (-895.145) [-901.012] (-891.515) (-923.012) -- 0:04:24
      325000 -- (-899.028) (-903.432) (-911.087) [-900.656] * (-900.522) (-908.069) [-901.295] (-892.599) -- 0:04:23

      Average standard deviation of split frequencies: 0.011568

      325500 -- (-898.378) (-918.467) [-897.288] (-915.981) * (-904.750) (-896.876) [-888.806] (-904.023) -- 0:04:23
      326000 -- (-898.857) (-947.760) (-906.724) [-904.810] * (-910.537) (-900.612) (-907.205) [-899.059] -- 0:04:22
      326500 -- (-894.380) (-912.582) (-898.451) [-898.618] * (-897.591) (-902.748) (-905.200) [-895.262] -- 0:04:21
      327000 -- (-897.171) [-893.516] (-918.518) (-903.088) * [-889.767] (-911.437) (-899.200) (-907.528) -- 0:04:23
      327500 -- (-915.684) (-905.685) [-902.224] (-908.744) * (-900.913) (-911.024) (-923.630) [-898.516] -- 0:04:22
      328000 -- (-913.986) [-901.683] (-913.946) (-899.961) * (-896.335) (-916.977) (-923.704) [-899.691] -- 0:04:22
      328500 -- (-920.253) (-903.030) (-917.954) [-898.830] * (-893.179) (-912.173) [-898.788] (-915.194) -- 0:04:21
      329000 -- [-907.619] (-898.434) (-906.265) (-914.524) * (-898.200) [-906.662] (-904.073) (-916.931) -- 0:04:21
      329500 -- (-909.472) [-907.710] (-913.933) (-913.730) * (-910.893) (-914.169) (-906.137) [-912.606] -- 0:04:22
      330000 -- [-891.768] (-903.263) (-924.636) (-905.980) * (-902.148) (-915.456) (-907.176) [-888.782] -- 0:04:21

      Average standard deviation of split frequencies: 0.011833

      330500 -- [-898.593] (-907.474) (-922.846) (-908.017) * (-901.798) (-908.053) (-904.043) [-899.782] -- 0:04:21
      331000 -- [-895.810] (-896.310) (-929.073) (-902.838) * [-887.978] (-908.254) (-902.614) (-906.732) -- 0:04:20
      331500 -- [-899.680] (-900.484) (-913.771) (-890.350) * (-900.395) (-920.057) [-898.723] (-911.807) -- 0:04:20
      332000 -- [-902.423] (-899.018) (-908.970) (-894.996) * [-902.738] (-917.295) (-894.979) (-914.303) -- 0:04:21
      332500 -- (-898.476) (-908.124) (-903.539) [-899.933] * [-889.690] (-909.262) (-895.918) (-918.786) -- 0:04:20
      333000 -- [-888.084] (-900.857) (-913.960) (-915.050) * (-895.110) (-915.736) [-890.991] (-912.278) -- 0:04:20
      333500 -- [-888.551] (-895.570) (-912.037) (-921.492) * (-917.104) [-902.779] (-894.450) (-901.915) -- 0:04:19
      334000 -- (-896.406) [-901.827] (-909.266) (-912.650) * (-912.009) (-900.017) (-889.721) [-896.047] -- 0:04:19
      334500 -- (-910.348) [-896.622] (-920.899) (-901.702) * (-904.887) (-907.578) [-895.130] (-894.101) -- 0:04:20
      335000 -- (-900.636) (-903.380) [-897.681] (-920.482) * (-910.185) (-887.446) [-902.354] (-907.588) -- 0:04:20

      Average standard deviation of split frequencies: 0.012346

      335500 -- (-915.340) (-902.794) [-893.190] (-905.348) * (-909.613) (-895.309) [-901.575] (-903.944) -- 0:04:19
      336000 -- (-905.177) (-909.880) [-891.765] (-896.180) * (-901.040) (-896.421) [-893.477] (-898.263) -- 0:04:18
      336500 -- [-901.951] (-897.694) (-903.861) (-896.071) * (-916.064) (-898.985) (-901.477) [-900.300] -- 0:04:18
      337000 -- (-897.920) [-906.810] (-904.058) (-895.820) * (-894.635) (-894.385) [-891.263] (-905.705) -- 0:04:17
      337500 -- [-907.255] (-907.815) (-910.522) (-909.242) * (-903.392) (-908.297) (-902.484) [-895.822] -- 0:04:19
      338000 -- (-913.449) [-895.905] (-910.844) (-903.455) * (-920.069) (-905.683) (-902.708) [-895.649] -- 0:04:18
      338500 -- (-903.665) (-901.236) [-907.705] (-897.252) * [-897.744] (-901.434) (-918.217) (-897.387) -- 0:04:17
      339000 -- (-931.059) (-903.857) [-898.774] (-899.355) * [-890.774] (-912.192) (-914.935) (-895.804) -- 0:04:17
      339500 -- (-932.818) (-903.925) (-894.739) [-892.114] * (-898.492) [-905.888] (-909.362) (-902.641) -- 0:04:16
      340000 -- (-910.202) [-894.575] (-900.105) (-910.777) * (-904.505) (-905.901) (-914.332) [-889.142] -- 0:04:18

      Average standard deviation of split frequencies: 0.012108

      340500 -- (-914.750) (-901.951) (-909.382) [-894.608] * (-919.111) (-912.856) (-897.185) [-898.056] -- 0:04:17
      341000 -- (-901.300) (-914.503) (-916.553) [-894.785] * (-898.925) (-907.929) (-915.803) [-898.555] -- 0:04:17
      341500 -- [-906.508] (-910.342) (-905.499) (-900.565) * (-902.406) [-901.873] (-906.251) (-902.202) -- 0:04:16
      342000 -- [-897.324] (-925.466) (-907.495) (-890.590) * [-894.596] (-901.362) (-894.337) (-902.122) -- 0:04:15
      342500 -- (-895.055) (-903.151) (-909.532) [-899.999] * (-907.338) [-897.912] (-907.274) (-893.050) -- 0:04:17
      343000 -- [-898.057] (-903.857) (-918.971) (-893.816) * (-915.846) (-911.415) (-896.884) [-907.176] -- 0:04:16
      343500 -- (-896.788) (-897.909) (-907.866) [-898.519] * [-902.791] (-908.316) (-903.469) (-920.452) -- 0:04:16
      344000 -- [-905.244] (-901.112) (-908.855) (-908.310) * (-918.285) [-889.446] (-912.006) (-897.390) -- 0:04:15
      344500 -- (-906.054) [-903.420] (-912.587) (-910.702) * (-909.794) [-902.242] (-908.868) (-916.457) -- 0:04:14
      345000 -- [-894.410] (-907.451) (-916.929) (-916.106) * (-907.163) (-902.087) [-907.326] (-920.257) -- 0:04:16

      Average standard deviation of split frequencies: 0.011036

      345500 -- (-917.122) (-906.150) (-914.280) [-903.168] * (-908.597) (-916.721) (-914.825) [-911.637] -- 0:04:15
      346000 -- (-902.115) [-906.904] (-909.255) (-911.673) * [-901.446] (-903.472) (-917.788) (-910.573) -- 0:04:15
      346500 -- (-900.325) (-906.735) [-895.193] (-907.190) * [-889.989] (-920.727) (-905.061) (-899.254) -- 0:04:14
      347000 -- (-905.366) [-900.925] (-917.549) (-904.587) * [-892.929] (-919.704) (-915.791) (-902.382) -- 0:04:14
      347500 -- (-903.074) (-918.253) (-897.805) [-895.399] * [-893.124] (-936.287) (-894.237) (-910.572) -- 0:04:15
      348000 -- (-906.109) [-903.143] (-909.522) (-903.742) * (-895.451) [-894.633] (-897.870) (-895.996) -- 0:04:14
      348500 -- [-906.286] (-903.229) (-915.004) (-903.342) * (-899.828) (-898.585) [-906.137] (-913.360) -- 0:04:14
      349000 -- (-903.307) [-899.236] (-922.704) (-912.261) * (-894.489) (-889.474) [-903.994] (-899.531) -- 0:04:13
      349500 -- (-914.886) (-898.200) [-899.684] (-908.137) * (-903.867) (-897.853) [-887.623] (-904.325) -- 0:04:13
      350000 -- (-900.589) [-892.727] (-914.423) (-899.662) * (-894.750) (-901.544) [-897.614] (-917.078) -- 0:04:14

      Average standard deviation of split frequencies: 0.011964

      350500 -- (-909.705) (-895.679) (-908.905) [-889.377] * [-889.958] (-909.301) (-896.237) (-920.886) -- 0:04:13
      351000 -- [-897.261] (-912.798) (-910.490) (-908.026) * (-902.129) (-896.280) [-894.399] (-915.685) -- 0:04:13
      351500 -- (-896.262) (-909.935) (-912.837) [-893.587] * (-892.825) [-896.107] (-896.377) (-914.287) -- 0:04:12
      352000 -- [-891.112] (-912.294) (-910.854) (-899.453) * (-899.453) (-903.957) (-907.556) [-903.737] -- 0:04:12
      352500 -- [-901.265] (-927.660) (-905.602) (-906.966) * [-898.578] (-906.316) (-909.009) (-902.451) -- 0:04:13
      353000 -- (-908.541) (-907.844) (-901.449) [-889.544] * [-899.423] (-914.276) (-908.708) (-888.259) -- 0:04:12
      353500 -- (-901.894) (-914.947) [-902.240] (-902.447) * (-900.814) (-917.091) (-916.162) [-895.311] -- 0:04:12
      354000 -- (-914.244) (-909.806) (-897.587) [-903.897] * [-888.632] (-895.530) (-909.868) (-910.044) -- 0:04:11
      354500 -- (-898.812) [-889.973] (-902.510) (-911.885) * (-894.621) (-913.650) (-903.426) [-898.309] -- 0:04:11
      355000 -- (-907.884) [-890.535] (-902.366) (-908.272) * [-901.619] (-903.277) (-902.929) (-906.511) -- 0:04:12

      Average standard deviation of split frequencies: 0.011388

      355500 -- (-904.360) (-900.789) (-915.262) [-887.303] * (-900.594) (-904.801) [-891.620] (-913.091) -- 0:04:11
      356000 -- (-910.787) [-906.369] (-913.921) (-900.858) * (-911.867) (-913.043) (-904.580) [-894.335] -- 0:04:11
      356500 -- (-916.464) (-897.237) (-897.176) [-892.412] * (-916.183) [-914.017] (-908.599) (-900.463) -- 0:04:10
      357000 -- (-923.369) [-894.494] (-904.888) (-892.997) * (-897.997) (-902.730) (-912.784) [-900.005] -- 0:04:10
      357500 -- (-905.944) [-901.575] (-904.141) (-913.383) * (-904.048) (-913.520) (-900.262) [-889.829] -- 0:04:11
      358000 -- [-906.832] (-900.366) (-902.692) (-924.845) * (-911.247) (-914.335) (-925.648) [-900.163] -- 0:04:11
      358500 -- (-901.490) [-896.778] (-921.086) (-902.844) * [-895.460] (-895.036) (-907.233) (-923.904) -- 0:04:10
      359000 -- (-911.588) (-903.358) (-906.629) [-898.417] * (-896.141) (-924.649) [-896.222] (-904.718) -- 0:04:09
      359500 -- (-913.676) (-906.836) [-888.434] (-901.200) * (-898.373) [-892.397] (-921.571) (-904.640) -- 0:04:11
      360000 -- (-913.939) (-903.835) [-898.698] (-914.496) * (-894.462) (-911.971) (-915.569) [-888.464] -- 0:04:10

      Average standard deviation of split frequencies: 0.012351

      360500 -- (-912.616) [-896.254] (-904.196) (-910.143) * (-905.430) (-912.136) (-909.071) [-896.363] -- 0:04:10
      361000 -- (-912.623) [-898.115] (-891.263) (-912.823) * (-910.023) (-909.590) [-894.698] (-911.103) -- 0:04:09
      361500 -- (-904.791) (-899.611) (-900.901) [-898.741] * (-907.480) (-905.255) [-894.347] (-898.246) -- 0:04:09
      362000 -- (-909.531) (-906.162) (-903.579) [-899.600] * (-904.282) [-901.527] (-888.820) (-903.580) -- 0:04:10
      362500 -- [-895.685] (-920.604) (-897.205) (-902.609) * (-911.545) (-908.131) (-895.732) [-901.376] -- 0:04:09
      363000 -- [-907.901] (-910.208) (-900.124) (-913.344) * (-908.969) [-898.266] (-896.965) (-909.146) -- 0:04:09
      363500 -- (-893.091) (-900.768) [-893.930] (-902.939) * (-907.766) [-903.132] (-903.465) (-911.668) -- 0:04:08
      364000 -- (-912.813) (-915.505) (-904.198) [-897.095] * (-904.146) [-908.501] (-896.879) (-917.750) -- 0:04:08
      364500 -- (-919.588) (-914.628) (-906.029) [-894.893] * (-907.226) [-904.056] (-915.344) (-926.706) -- 0:04:07
      365000 -- (-933.775) (-917.606) [-905.806] (-896.202) * (-919.404) [-899.846] (-912.986) (-892.545) -- 0:04:08

      Average standard deviation of split frequencies: 0.012622

      365500 -- (-917.269) (-901.128) [-897.355] (-903.852) * (-901.149) [-901.345] (-923.058) (-895.144) -- 0:04:08
      366000 -- [-896.050] (-910.659) (-913.127) (-901.851) * (-913.906) [-889.971] (-902.623) (-897.660) -- 0:04:07
      366500 -- [-902.709] (-904.472) (-913.546) (-906.918) * (-916.862) (-886.939) [-895.865] (-898.598) -- 0:04:07
      367000 -- (-904.371) (-901.140) (-918.461) [-893.849] * (-915.325) [-900.718] (-909.284) (-896.658) -- 0:04:06
      367500 -- (-902.651) (-899.968) (-930.971) [-894.748] * (-907.740) (-898.386) (-899.158) [-897.111] -- 0:04:07
      368000 -- (-908.941) [-899.887] (-907.323) (-911.503) * [-897.668] (-894.179) (-910.234) (-905.911) -- 0:04:07
      368500 -- [-891.603] (-907.614) (-905.538) (-913.309) * (-903.356) [-889.715] (-910.883) (-900.673) -- 0:04:06
      369000 -- (-917.114) (-910.045) [-900.307] (-899.047) * [-898.735] (-936.191) (-921.555) (-900.734) -- 0:04:06
      369500 -- (-907.357) (-912.219) [-894.400] (-904.503) * [-897.129] (-896.007) (-908.855) (-903.138) -- 0:04:07
      370000 -- [-895.691] (-917.434) (-906.736) (-899.169) * [-893.666] (-920.772) (-917.339) (-919.724) -- 0:04:06

      Average standard deviation of split frequencies: 0.013990

      370500 -- (-917.840) [-894.466] (-907.027) (-895.302) * (-917.874) (-908.652) [-900.142] (-902.981) -- 0:04:06
      371000 -- (-915.495) (-914.349) (-899.459) [-901.456] * [-897.383] (-902.320) (-901.631) (-903.621) -- 0:04:05
      371500 -- [-900.757] (-917.553) (-909.482) (-902.237) * (-900.804) (-893.049) (-898.617) [-890.671] -- 0:04:05
      372000 -- [-899.546] (-903.035) (-914.019) (-903.621) * (-908.726) [-902.787] (-909.242) (-904.023) -- 0:04:06
      372500 -- [-885.871] (-902.995) (-904.979) (-904.623) * (-893.183) (-897.155) (-908.930) [-889.717] -- 0:04:05
      373000 -- (-911.994) (-890.449) [-917.131] (-904.276) * (-902.812) [-899.560] (-916.036) (-892.342) -- 0:04:05
      373500 -- (-928.768) (-909.253) (-912.304) [-900.789] * (-893.600) [-898.544] (-921.786) (-890.465) -- 0:04:04
      374000 -- (-920.386) (-897.711) (-913.752) [-897.638] * (-896.776) (-896.535) [-903.902] (-908.997) -- 0:04:04
      374500 -- [-916.029] (-907.945) (-922.641) (-892.112) * (-905.553) [-889.387] (-916.221) (-905.322) -- 0:04:05
      375000 -- (-901.304) (-909.048) (-902.601) [-898.950] * [-896.111] (-897.117) (-910.821) (-907.685) -- 0:04:05

      Average standard deviation of split frequencies: 0.013164

      375500 -- (-905.592) (-908.967) (-897.743) [-900.884] * [-897.467] (-911.179) (-907.884) (-922.350) -- 0:04:04
      376000 -- (-908.426) (-908.315) [-902.135] (-892.849) * [-895.028] (-902.806) (-911.771) (-908.117) -- 0:04:03
      376500 -- (-908.052) (-899.458) (-913.427) [-897.861] * (-911.975) (-893.624) (-913.804) [-891.932] -- 0:04:03
      377000 -- [-910.027] (-905.077) (-905.049) (-917.405) * (-910.464) (-893.935) (-909.801) [-890.577] -- 0:04:04
      377500 -- (-904.636) [-896.886] (-905.726) (-917.398) * (-909.594) (-912.608) (-915.335) [-897.451] -- 0:04:04
      378000 -- (-913.043) (-926.291) [-898.046] (-908.222) * [-902.020] (-899.085) (-908.086) (-908.607) -- 0:04:03
      378500 -- (-899.121) (-900.358) (-915.615) [-912.919] * (-912.267) [-898.342] (-913.475) (-923.245) -- 0:04:03
      379000 -- (-907.534) [-901.447] (-904.479) (-883.964) * (-912.824) (-889.360) (-894.552) [-905.345] -- 0:04:02
      379500 -- (-914.223) [-910.723] (-900.189) (-888.866) * (-908.873) [-899.372] (-919.867) (-896.474) -- 0:04:03
      380000 -- (-912.474) [-897.676] (-901.611) (-909.867) * (-901.653) [-897.205] (-909.362) (-906.456) -- 0:04:03

      Average standard deviation of split frequencies: 0.012755

      380500 -- (-916.502) (-910.798) [-896.067] (-895.495) * (-900.992) (-902.629) (-893.877) [-890.072] -- 0:04:02
      381000 -- (-920.247) (-901.500) (-902.151) [-900.292] * [-899.085] (-906.452) (-910.756) (-903.697) -- 0:04:02
      381500 -- (-898.260) [-900.984] (-908.578) (-899.368) * (-901.767) (-905.653) (-911.918) [-894.694] -- 0:04:01
      382000 -- (-905.921) [-896.471] (-902.731) (-901.067) * [-897.238] (-887.064) (-911.674) (-902.272) -- 0:04:02
      382500 -- [-894.875] (-900.323) (-908.056) (-906.516) * (-901.778) (-902.637) (-912.711) [-898.469] -- 0:04:02
      383000 -- [-887.300] (-916.232) (-919.144) (-890.077) * (-912.176) [-896.878] (-922.146) (-902.745) -- 0:04:01
      383500 -- [-882.320] (-896.648) (-914.406) (-901.211) * [-898.157] (-903.830) (-905.501) (-903.422) -- 0:04:01
      384000 -- (-893.873) [-894.972] (-915.667) (-900.108) * [-894.139] (-896.682) (-917.083) (-899.770) -- 0:04:00
      384500 -- [-889.667] (-906.651) (-904.241) (-905.805) * [-891.075] (-902.381) (-909.456) (-899.978) -- 0:04:01
      385000 -- (-918.477) (-906.223) (-910.196) [-903.355] * (-897.079) (-909.976) [-900.836] (-896.006) -- 0:04:01

      Average standard deviation of split frequencies: 0.013190

      385500 -- (-918.361) [-896.872] (-921.894) (-906.652) * [-894.846] (-913.485) (-901.715) (-909.144) -- 0:04:00
      386000 -- (-931.558) (-908.233) (-903.359) [-908.679] * [-905.412] (-910.962) (-902.759) (-905.893) -- 0:04:00
      386500 -- (-925.679) [-903.692] (-896.808) (-898.414) * (-907.820) (-902.191) (-898.932) [-905.821] -- 0:03:59
      387000 -- (-907.284) (-905.186) [-895.590] (-916.759) * [-904.533] (-903.344) (-899.337) (-899.591) -- 0:03:59
      387500 -- (-916.701) [-898.918] (-894.319) (-897.091) * (-907.867) [-898.422] (-905.332) (-912.023) -- 0:04:00
      388000 -- (-905.548) [-885.727] (-897.755) (-913.159) * (-897.484) [-898.804] (-908.867) (-912.355) -- 0:03:59
      388500 -- [-892.104] (-899.791) (-918.404) (-904.508) * (-893.926) (-911.883) (-903.709) [-901.759] -- 0:03:59
      389000 -- [-893.422] (-904.287) (-913.050) (-903.493) * [-889.921] (-906.427) (-901.577) (-906.795) -- 0:03:58
      389500 -- (-917.312) [-902.128] (-900.834) (-912.482) * [-896.447] (-908.087) (-907.276) (-903.464) -- 0:03:58
      390000 -- (-911.286) (-904.444) [-890.931] (-902.129) * (-905.717) (-923.471) (-909.597) [-895.557] -- 0:03:59

      Average standard deviation of split frequencies: 0.013454

      390500 -- (-910.075) (-892.275) [-901.133] (-899.058) * [-904.522] (-900.106) (-905.892) (-890.820) -- 0:03:58
      391000 -- (-916.852) (-896.815) [-902.860] (-896.539) * (-901.030) (-897.137) [-899.406] (-893.348) -- 0:03:58
      391500 -- (-906.973) (-896.924) [-901.496] (-904.040) * [-892.333] (-902.290) (-921.365) (-901.352) -- 0:03:57
      392000 -- [-897.048] (-900.253) (-908.463) (-905.989) * [-903.154] (-925.779) (-914.266) (-906.252) -- 0:03:57
      392500 -- (-901.149) (-901.992) (-915.797) [-903.674] * (-903.697) [-902.575] (-910.977) (-895.555) -- 0:03:58
      393000 -- [-885.798] (-909.159) (-916.426) (-912.878) * (-893.921) (-900.872) [-893.144] (-912.024) -- 0:03:57
      393500 -- (-888.126) (-901.536) [-894.586] (-913.610) * [-893.816] (-909.687) (-912.121) (-907.405) -- 0:03:57
      394000 -- [-896.494] (-907.029) (-896.930) (-911.283) * (-896.621) [-901.363] (-900.765) (-901.255) -- 0:03:56
      394500 -- [-889.980] (-907.698) (-901.605) (-923.590) * (-912.615) (-914.730) (-907.947) [-894.030] -- 0:03:56
      395000 -- (-916.827) [-888.162] (-902.868) (-916.925) * (-901.437) (-904.269) (-906.933) [-900.314] -- 0:03:57

      Average standard deviation of split frequencies: 0.013928

      395500 -- (-898.246) [-888.402] (-886.791) (-901.889) * (-909.965) [-900.859] (-901.441) (-897.443) -- 0:03:56
      396000 -- (-898.527) (-900.058) (-901.597) [-903.516] * (-901.973) (-908.492) [-901.789] (-898.648) -- 0:03:56
      396500 -- (-896.960) (-898.259) (-898.419) [-898.680] * [-904.035] (-916.149) (-912.249) (-898.721) -- 0:03:55
      397000 -- (-910.990) (-897.523) [-893.461] (-906.624) * (-909.813) (-926.258) (-909.308) [-892.027] -- 0:03:55
      397500 -- [-900.310] (-918.363) (-895.825) (-900.909) * (-920.572) (-902.681) (-914.032) [-900.118] -- 0:03:56
      398000 -- (-896.111) (-919.262) (-899.526) [-899.243] * (-908.810) (-912.985) (-904.758) [-900.468] -- 0:03:55
      398500 -- (-921.889) [-920.993] (-900.273) (-912.598) * [-897.573] (-916.173) (-916.958) (-908.281) -- 0:03:55
      399000 -- (-900.746) [-901.957] (-911.528) (-910.314) * [-893.895] (-912.839) (-906.294) (-913.100) -- 0:03:54
      399500 -- (-917.985) [-900.906] (-912.539) (-908.116) * [-903.816] (-909.310) (-919.067) (-899.895) -- 0:03:55
      400000 -- (-923.207) (-902.368) (-892.928) [-896.946] * (-905.535) [-904.235] (-908.978) (-909.101) -- 0:03:55

      Average standard deviation of split frequencies: 0.014413

      400500 -- (-905.964) [-901.494] (-895.407) (-899.022) * (-910.523) (-901.566) (-903.354) [-904.002] -- 0:03:55
      401000 -- (-915.897) (-902.496) (-896.413) [-894.101] * (-910.033) (-898.650) [-902.969] (-908.291) -- 0:03:54
      401500 -- (-902.431) (-922.112) (-900.933) [-891.367] * (-900.050) (-897.977) [-894.897] (-920.514) -- 0:03:54
      402000 -- (-909.837) (-908.142) (-908.976) [-903.768] * (-893.225) (-922.591) [-899.844] (-924.667) -- 0:03:55
      402500 -- (-898.532) [-890.514] (-914.669) (-915.386) * (-896.206) (-910.824) [-893.520] (-905.387) -- 0:03:54
      403000 -- (-912.692) (-905.652) (-911.683) [-896.428] * (-903.882) (-920.922) (-908.275) [-906.709] -- 0:03:54
      403500 -- (-911.718) (-898.025) (-914.757) [-894.964] * (-909.358) (-921.456) [-898.487] (-911.865) -- 0:03:53
      404000 -- (-911.972) [-893.504] (-911.318) (-897.627) * (-895.701) (-929.111) (-896.905) [-901.263] -- 0:03:53
      404500 -- (-918.548) (-895.972) (-902.116) [-901.590] * [-901.103] (-913.683) (-909.837) (-917.907) -- 0:03:54
      405000 -- [-895.465] (-894.332) (-893.729) (-894.638) * [-902.995] (-915.711) (-909.611) (-901.555) -- 0:03:53

      Average standard deviation of split frequencies: 0.013817

      405500 -- [-903.632] (-899.391) (-902.880) (-901.543) * (-906.020) (-902.883) (-911.745) [-898.177] -- 0:03:53
      406000 -- (-919.707) [-890.496] (-902.765) (-913.024) * (-906.926) (-918.189) (-908.203) [-894.289] -- 0:03:52
      406500 -- (-897.423) [-896.131] (-920.097) (-914.560) * (-900.872) [-882.773] (-909.164) (-910.252) -- 0:03:52
      407000 -- (-898.947) (-898.839) (-897.224) [-886.636] * (-920.197) (-902.386) (-931.069) [-899.971] -- 0:03:53
      407500 -- (-894.996) (-894.058) (-917.451) [-898.446] * (-899.653) [-900.409] (-913.317) (-897.983) -- 0:03:52
      408000 -- (-896.487) [-896.678] (-910.219) (-902.734) * (-911.932) [-902.809] (-906.135) (-923.258) -- 0:03:52
      408500 -- (-907.256) [-895.470] (-910.643) (-905.901) * [-908.148] (-897.593) (-900.634) (-910.462) -- 0:03:51
      409000 -- (-900.514) [-892.102] (-917.088) (-905.251) * [-912.599] (-898.517) (-902.246) (-904.996) -- 0:03:51
      409500 -- (-902.404) (-909.221) (-909.471) [-910.776] * (-898.733) (-903.151) (-915.673) [-899.826] -- 0:03:52
      410000 -- (-904.783) [-903.352] (-908.757) (-895.232) * [-903.843] (-903.656) (-908.540) (-898.389) -- 0:03:51

      Average standard deviation of split frequencies: 0.013603

      410500 -- (-913.225) [-889.441] (-890.461) (-907.245) * (-922.832) (-913.109) (-902.186) [-896.396] -- 0:03:51
      411000 -- (-909.630) [-893.704] (-900.218) (-897.498) * (-915.354) (-910.001) [-895.108] (-895.404) -- 0:03:50
      411500 -- (-898.607) (-909.454) [-896.382] (-899.766) * (-909.150) (-895.348) (-911.070) [-893.052] -- 0:03:50
      412000 -- (-911.402) (-911.987) [-891.562] (-904.508) * (-900.797) [-889.339] (-903.470) (-902.822) -- 0:03:51
      412500 -- (-908.062) (-923.712) [-904.462] (-903.835) * [-905.811] (-897.640) (-907.503) (-909.943) -- 0:03:50
      413000 -- [-888.684] (-918.355) (-900.624) (-924.557) * (-900.844) (-898.831) (-903.653) [-912.925] -- 0:03:50
      413500 -- [-902.764] (-928.322) (-896.978) (-911.888) * [-891.658] (-892.550) (-898.580) (-912.403) -- 0:03:49
      414000 -- (-907.921) (-917.189) (-903.401) [-900.545] * (-904.785) (-905.486) (-912.341) [-898.015] -- 0:03:49
      414500 -- [-905.213] (-901.336) (-908.990) (-913.030) * (-905.364) (-904.298) [-897.216] (-906.002) -- 0:03:50
      415000 -- (-908.544) (-901.942) [-898.741] (-898.511) * (-911.390) [-920.056] (-892.352) (-905.714) -- 0:03:49

      Average standard deviation of split frequencies: 0.012408

      415500 -- (-910.659) (-899.653) (-903.135) [-904.488] * (-902.176) (-917.580) [-901.903] (-901.376) -- 0:03:49
      416000 -- (-906.828) (-904.284) (-900.208) [-900.480] * (-903.024) (-910.737) [-905.246] (-901.143) -- 0:03:48
      416500 -- (-913.976) (-914.250) (-897.608) [-897.094] * [-896.288] (-911.710) (-899.274) (-905.832) -- 0:03:48
      417000 -- (-913.057) (-909.836) (-905.231) [-890.639] * (-898.471) [-900.491] (-904.650) (-907.991) -- 0:03:49
      417500 -- (-904.278) [-901.142] (-909.620) (-901.819) * (-904.535) (-896.320) (-908.514) [-895.399] -- 0:03:48
      418000 -- (-910.162) (-908.213) (-904.469) [-900.537] * (-905.955) (-920.804) [-897.733] (-899.919) -- 0:03:48
      418500 -- [-893.555] (-904.219) (-912.564) (-897.588) * (-910.160) (-905.764) [-900.827] (-916.358) -- 0:03:47
      419000 -- [-903.031] (-904.696) (-905.378) (-908.132) * (-905.922) (-916.087) [-911.788] (-906.418) -- 0:03:47
      419500 -- (-896.766) (-901.850) (-924.168) [-901.001] * (-905.057) (-926.866) (-904.145) [-891.643] -- 0:03:48
      420000 -- (-899.385) [-892.624] (-914.675) (-918.685) * [-894.176] (-912.258) (-904.893) (-888.444) -- 0:03:47

      Average standard deviation of split frequencies: 0.012103

      420500 -- (-907.442) (-909.553) (-901.100) [-892.598] * [-887.412] (-912.586) (-902.284) (-910.097) -- 0:03:47
      421000 -- (-913.132) [-894.441] (-891.261) (-895.466) * (-904.087) (-896.615) [-900.306] (-913.505) -- 0:03:46
      421500 -- (-916.370) [-897.752] (-908.646) (-893.030) * (-903.779) [-907.366] (-907.421) (-919.125) -- 0:03:46
      422000 -- (-910.507) (-912.639) (-910.963) [-892.527] * [-911.876] (-914.911) (-902.697) (-911.504) -- 0:03:47
      422500 -- (-903.404) (-906.184) (-901.202) [-895.669] * (-902.645) (-915.218) [-897.028] (-900.934) -- 0:03:46
      423000 -- (-912.361) (-910.482) (-895.906) [-897.083] * [-897.999] (-910.582) (-903.069) (-925.567) -- 0:03:46
      423500 -- (-911.777) (-910.898) (-890.653) [-900.193] * (-912.691) (-902.543) [-890.872] (-922.530) -- 0:03:45
      424000 -- (-918.384) [-904.311] (-904.533) (-890.950) * (-916.449) (-909.859) [-890.265] (-929.838) -- 0:03:45
      424500 -- (-916.483) (-903.072) [-894.176] (-895.401) * (-915.246) (-906.013) (-906.337) [-904.205] -- 0:03:46
      425000 -- (-921.313) (-905.607) [-897.000] (-896.619) * (-906.865) [-897.863] (-900.448) (-924.751) -- 0:03:45

      Average standard deviation of split frequencies: 0.012117

      425500 -- (-904.328) (-902.133) [-897.252] (-907.936) * (-930.513) [-895.255] (-897.135) (-919.576) -- 0:03:45
      426000 -- [-891.576] (-901.734) (-913.036) (-906.152) * (-910.980) [-896.488] (-893.930) (-910.294) -- 0:03:45
      426500 -- (-907.919) (-912.815) [-901.652] (-918.272) * (-916.016) [-895.965] (-901.237) (-893.237) -- 0:03:44
      427000 -- (-905.293) (-890.764) [-891.287] (-921.933) * (-907.342) [-885.637] (-911.185) (-908.310) -- 0:03:45
      427500 -- (-908.515) (-893.098) (-909.712) [-899.355] * (-917.317) [-885.773] (-908.073) (-904.055) -- 0:03:44
      428000 -- [-901.095] (-898.868) (-910.558) (-897.434) * (-905.842) (-901.900) [-899.044] (-906.595) -- 0:03:44
      428500 -- (-903.518) (-915.106) [-890.775] (-910.643) * (-942.964) (-907.316) [-899.089] (-894.785) -- 0:03:44
      429000 -- (-912.458) (-914.100) [-891.829] (-918.186) * (-912.215) [-905.003] (-887.966) (-897.653) -- 0:03:43
      429500 -- (-901.434) (-908.418) [-888.096] (-911.477) * (-903.188) [-892.905] (-906.470) (-901.198) -- 0:03:43
      430000 -- [-905.888] (-905.143) (-891.000) (-910.422) * (-906.622) (-886.587) (-914.704) [-897.785] -- 0:03:44

      Average standard deviation of split frequencies: 0.012861

      430500 -- (-905.522) (-900.094) [-897.718] (-918.535) * [-896.264] (-904.422) (-907.736) (-911.463) -- 0:03:43
      431000 -- (-910.216) (-902.598) (-912.517) [-900.587] * (-915.305) (-900.948) [-898.585] (-894.268) -- 0:03:43
      431500 -- (-908.071) (-900.841) [-902.481] (-887.841) * (-903.813) [-906.815] (-906.614) (-893.587) -- 0:03:42
      432000 -- (-895.512) (-911.839) (-898.592) [-904.547] * (-910.650) (-922.221) [-899.959] (-899.078) -- 0:03:43
      432500 -- (-907.373) (-925.428) (-898.121) [-896.931] * (-911.655) (-902.002) (-896.875) [-907.191] -- 0:03:43
      433000 -- (-899.564) [-906.171] (-898.023) (-911.058) * (-909.382) [-892.606] (-902.604) (-909.665) -- 0:03:42
      433500 -- (-892.746) [-906.266] (-915.829) (-916.891) * (-908.358) (-913.985) (-911.339) [-905.833] -- 0:03:42
      434000 -- (-901.253) (-901.910) (-936.123) [-895.914] * (-908.393) [-902.397] (-904.042) (-892.139) -- 0:03:41
      434500 -- (-906.894) [-891.059] (-898.882) (-902.191) * (-906.164) (-904.383) [-894.296] (-915.682) -- 0:03:42
      435000 -- (-913.385) [-894.961] (-905.756) (-924.526) * (-911.995) (-903.999) (-911.780) [-916.081] -- 0:03:42

      Average standard deviation of split frequencies: 0.012596

      435500 -- (-910.501) [-890.669] (-898.007) (-912.442) * (-913.718) (-899.651) (-910.082) [-906.016] -- 0:03:41
      436000 -- (-919.180) (-910.663) [-888.286] (-910.601) * (-903.584) (-908.509) [-890.989] (-935.604) -- 0:03:41
      436500 -- (-901.305) (-900.204) (-906.624) [-895.916] * (-916.673) [-903.906] (-897.308) (-916.928) -- 0:03:40
      437000 -- (-908.871) [-888.565] (-895.202) (-912.497) * [-902.858] (-910.554) (-899.200) (-923.760) -- 0:03:41
      437500 -- (-899.418) (-901.075) [-908.507] (-893.940) * (-905.438) (-900.632) (-911.468) [-901.835] -- 0:03:41
      438000 -- (-916.058) (-915.982) [-900.159] (-907.786) * (-905.318) (-899.807) (-912.732) [-894.156] -- 0:03:40
      438500 -- (-901.525) (-908.191) [-902.692] (-899.726) * (-907.808) [-893.314] (-919.867) (-898.308) -- 0:03:40
      439000 -- (-904.155) (-892.262) [-892.856] (-921.480) * [-891.730] (-896.252) (-895.286) (-884.712) -- 0:03:39
      439500 -- (-910.117) (-910.383) [-890.715] (-922.545) * [-895.855] (-903.997) (-908.717) (-893.468) -- 0:03:40
      440000 -- [-892.622] (-905.197) (-902.600) (-912.617) * [-894.837] (-913.317) (-910.407) (-896.675) -- 0:03:40

      Average standard deviation of split frequencies: 0.012035

      440500 -- (-906.378) (-923.699) [-889.545] (-908.121) * [-890.608] (-896.413) (-906.037) (-900.735) -- 0:03:39
      441000 -- (-904.609) (-917.431) [-901.167] (-906.406) * (-909.245) (-892.759) [-893.178] (-911.478) -- 0:03:39
      441500 -- [-897.781] (-910.351) (-915.673) (-892.279) * [-892.654] (-901.289) (-900.374) (-913.813) -- 0:03:38
      442000 -- (-912.680) (-896.969) (-902.722) [-886.439] * [-888.986] (-891.508) (-921.996) (-914.868) -- 0:03:39
      442500 -- (-903.551) (-903.072) (-916.244) [-897.807] * (-906.281) (-911.613) [-904.890] (-926.744) -- 0:03:39
      443000 -- (-919.202) (-905.080) (-909.407) [-892.656] * (-897.348) (-911.001) (-895.876) [-895.394] -- 0:03:38
      443500 -- (-911.368) [-902.388] (-908.544) (-914.555) * (-899.013) (-915.116) (-902.317) [-902.334] -- 0:03:38
      444000 -- [-899.111] (-917.459) (-904.754) (-898.856) * (-899.194) (-915.551) (-912.231) [-899.447] -- 0:03:37
      444500 -- [-897.755] (-895.809) (-909.238) (-918.217) * [-896.095] (-924.120) (-903.287) (-915.661) -- 0:03:38
      445000 -- [-898.391] (-911.701) (-899.721) (-920.004) * [-902.805] (-915.124) (-916.992) (-907.288) -- 0:03:38

      Average standard deviation of split frequencies: 0.012261

      445500 -- (-906.066) (-895.146) [-908.293] (-919.296) * (-895.600) [-902.701] (-914.424) (-897.657) -- 0:03:37
      446000 -- [-893.212] (-893.872) (-895.979) (-920.138) * (-913.231) (-926.067) (-899.114) [-896.135] -- 0:03:37
      446500 -- (-909.498) [-894.074] (-900.647) (-908.163) * (-903.694) (-901.771) [-894.336] (-893.700) -- 0:03:36
      447000 -- (-911.107) (-912.235) [-891.156] (-898.508) * (-909.574) (-902.135) [-901.050] (-916.872) -- 0:03:36
      447500 -- (-909.073) (-922.502) [-896.769] (-906.559) * [-897.404] (-919.729) (-902.317) (-898.502) -- 0:03:37
      448000 -- (-901.498) (-914.473) [-894.527] (-904.733) * [-885.386] (-912.947) (-912.551) (-892.128) -- 0:03:36
      448500 -- (-923.551) (-904.398) [-900.270] (-918.156) * [-907.588] (-907.148) (-906.222) (-894.884) -- 0:03:36
      449000 -- [-911.111] (-901.499) (-886.477) (-920.558) * (-909.731) (-926.323) (-898.825) [-897.460] -- 0:03:35
      449500 -- [-894.858] (-901.300) (-911.091) (-911.894) * [-900.606] (-909.834) (-895.998) (-902.613) -- 0:03:35
      450000 -- (-906.306) [-895.281] (-907.876) (-902.733) * [-892.855] (-911.515) (-890.677) (-899.737) -- 0:03:36

      Average standard deviation of split frequencies: 0.012343

      450500 -- (-896.914) [-904.605] (-905.311) (-910.384) * [-906.171] (-905.803) (-909.406) (-904.954) -- 0:03:35
      451000 -- (-913.322) (-904.302) [-912.397] (-905.873) * (-929.782) [-895.878] (-897.429) (-903.703) -- 0:03:35
      451500 -- (-907.808) [-895.227] (-907.941) (-913.048) * (-907.069) (-905.624) [-899.482] (-910.190) -- 0:03:35
      452000 -- (-909.131) [-894.736] (-901.822) (-904.703) * [-897.643] (-899.210) (-910.068) (-914.779) -- 0:03:35
      452500 -- (-921.839) (-906.632) (-893.770) [-907.974] * (-904.507) (-906.711) [-903.176] (-918.603) -- 0:03:35
      453000 -- (-906.651) (-894.998) [-896.803] (-897.422) * (-903.710) [-898.923] (-899.853) (-911.384) -- 0:03:34
      453500 -- (-921.793) (-910.636) [-901.994] (-903.509) * (-901.015) (-900.301) [-902.655] (-903.968) -- 0:03:34
      454000 -- (-902.170) (-904.902) [-884.442] (-912.255) * (-919.950) (-896.918) [-910.646] (-919.389) -- 0:03:34
      454500 -- (-906.317) [-900.102] (-904.521) (-896.757) * (-898.763) (-903.562) (-904.852) [-906.409] -- 0:03:34
      455000 -- (-911.718) [-903.708] (-905.595) (-912.811) * [-897.878] (-897.711) (-893.692) (-904.742) -- 0:03:34

      Average standard deviation of split frequencies: 0.011578

      455500 -- (-905.111) (-901.770) (-896.749) [-891.157] * [-880.692] (-917.764) (-909.972) (-906.658) -- 0:03:33
      456000 -- (-903.951) (-913.619) (-902.885) [-896.037] * [-897.550] (-903.542) (-903.810) (-902.306) -- 0:03:33
      456500 -- [-903.153] (-904.087) (-914.065) (-901.315) * (-897.006) [-895.658] (-924.768) (-901.822) -- 0:03:33
      457000 -- (-905.636) (-918.830) [-905.332] (-908.367) * (-900.202) (-911.051) (-907.211) [-901.057] -- 0:03:33
      457500 -- [-898.640] (-903.603) (-911.312) (-895.129) * [-897.930] (-894.991) (-911.647) (-897.803) -- 0:03:33
      458000 -- (-915.000) [-890.938] (-903.502) (-901.909) * (-895.448) (-902.382) (-901.270) [-887.095] -- 0:03:33
      458500 -- (-900.033) (-918.070) (-911.678) [-902.362] * [-897.866] (-905.502) (-896.632) (-901.350) -- 0:03:32
      459000 -- (-894.603) (-905.900) (-914.309) [-895.546] * [-893.377] (-909.259) (-896.205) (-898.659) -- 0:03:32
      459500 -- (-892.403) (-899.685) (-905.111) [-906.163] * [-904.846] (-900.907) (-902.055) (-901.209) -- 0:03:31
      460000 -- (-912.450) (-901.822) (-895.809) [-895.298] * [-899.808] (-898.612) (-909.009) (-906.227) -- 0:03:32

      Average standard deviation of split frequencies: 0.010847

      460500 -- [-907.614] (-895.645) (-906.673) (-912.381) * [-889.707] (-901.702) (-904.433) (-908.877) -- 0:03:32
      461000 -- [-896.165] (-904.548) (-903.364) (-910.990) * (-893.918) (-902.715) (-900.539) [-899.842] -- 0:03:31
      461500 -- (-908.541) (-904.973) (-912.964) [-899.488] * (-892.450) (-929.653) [-903.278] (-911.266) -- 0:03:31
      462000 -- (-906.216) (-936.523) (-913.243) [-911.335] * (-888.888) [-896.834] (-904.343) (-898.528) -- 0:03:30
      462500 -- (-897.266) (-917.240) (-919.514) [-899.569] * (-905.355) (-904.969) [-897.305] (-909.932) -- 0:03:31
      463000 -- [-900.860] (-910.673) (-920.921) (-909.208) * [-898.209] (-914.698) (-897.182) (-913.957) -- 0:03:31
      463500 -- [-893.573] (-899.054) (-911.119) (-907.807) * (-899.362) (-904.303) [-887.715] (-920.903) -- 0:03:30
      464000 -- (-912.572) [-895.770] (-911.924) (-908.469) * [-897.786] (-904.993) (-901.614) (-902.325) -- 0:03:30
      464500 -- (-904.995) [-892.081] (-915.182) (-902.917) * (-905.372) [-902.790] (-908.548) (-896.866) -- 0:03:29
      465000 -- (-891.528) (-892.584) [-904.071] (-896.884) * (-907.956) (-910.670) (-903.847) [-893.935] -- 0:03:30

      Average standard deviation of split frequencies: 0.011229

      465500 -- [-895.276] (-912.857) (-905.388) (-907.722) * (-900.942) (-905.347) (-916.985) [-902.545] -- 0:03:30
      466000 -- (-919.351) (-894.720) (-896.902) [-909.646] * [-889.556] (-910.754) (-916.029) (-909.961) -- 0:03:29
      466500 -- (-898.293) [-897.722] (-917.553) (-904.348) * [-896.432] (-899.848) (-907.943) (-919.410) -- 0:03:29
      467000 -- (-927.986) [-893.532] (-912.674) (-899.261) * (-906.480) (-905.699) [-903.044] (-913.152) -- 0:03:28
      467500 -- (-912.514) (-911.581) [-897.409] (-903.110) * [-896.062] (-912.451) (-912.912) (-900.546) -- 0:03:29
      468000 -- (-916.560) [-906.079] (-901.625) (-885.313) * (-903.059) (-899.228) [-891.681] (-908.711) -- 0:03:29
      468500 -- [-910.972] (-911.978) (-917.371) (-895.748) * (-914.316) (-890.844) [-896.766] (-892.736) -- 0:03:28
      469000 -- (-929.635) [-903.145] (-904.160) (-888.691) * (-916.348) (-894.695) (-894.805) [-895.652] -- 0:03:28
      469500 -- (-910.432) (-913.739) [-904.704] (-906.281) * (-914.328) (-894.296) (-907.003) [-902.822] -- 0:03:27
      470000 -- (-908.468) (-899.411) [-893.422] (-904.965) * (-896.207) (-904.276) (-918.771) [-890.303] -- 0:03:28

      Average standard deviation of split frequencies: 0.010867

      470500 -- (-905.692) [-895.886] (-910.992) (-911.798) * (-901.053) (-900.330) (-917.104) [-901.608] -- 0:03:28
      471000 -- (-904.370) (-927.489) (-914.400) [-904.594] * (-902.944) (-895.468) [-897.994] (-893.702) -- 0:03:27
      471500 -- (-925.383) (-907.551) (-910.950) [-906.623] * (-904.668) [-897.108] (-924.420) (-907.778) -- 0:03:27
      472000 -- (-916.153) (-906.173) [-901.278] (-925.492) * [-893.484] (-918.936) (-917.182) (-898.433) -- 0:03:26
      472500 -- [-897.153] (-904.001) (-898.578) (-924.244) * (-899.950) [-893.828] (-908.729) (-903.264) -- 0:03:27
      473000 -- (-925.224) [-891.221] (-906.518) (-923.612) * (-910.334) (-914.840) [-900.276] (-912.313) -- 0:03:27
      473500 -- (-918.441) (-900.627) (-897.485) [-894.352] * (-900.983) (-903.883) [-902.711] (-915.504) -- 0:03:26
      474000 -- [-903.285] (-916.740) (-899.247) (-898.631) * (-919.502) (-917.037) (-894.788) [-891.629] -- 0:03:26
      474500 -- (-913.055) (-911.756) (-900.431) [-895.288] * [-893.107] (-914.659) (-907.377) (-901.157) -- 0:03:25
      475000 -- (-904.765) (-903.669) (-900.432) [-903.133] * (-906.623) (-899.694) [-911.036] (-915.288) -- 0:03:26

      Average standard deviation of split frequencies: 0.010646

      475500 -- (-910.359) (-905.056) (-901.760) [-891.343] * (-904.003) [-897.207] (-901.402) (-909.028) -- 0:03:26
      476000 -- (-899.252) (-913.085) (-896.938) [-908.211] * [-894.929] (-902.248) (-914.800) (-903.943) -- 0:03:25
      476500 -- (-898.110) (-915.522) [-907.564] (-914.649) * [-892.788] (-905.050) (-902.165) (-904.791) -- 0:03:25
      477000 -- [-897.135] (-901.481) (-899.394) (-905.858) * (-908.966) (-899.264) [-894.334] (-905.659) -- 0:03:25
      477500 -- (-911.617) [-899.679] (-901.653) (-902.058) * (-899.566) (-904.316) (-897.821) [-899.612] -- 0:03:25
      478000 -- (-921.698) (-900.795) (-904.781) [-899.759] * (-913.691) (-895.739) (-913.727) [-887.232] -- 0:03:25
      478500 -- (-919.550) [-892.669] (-910.468) (-894.661) * (-906.099) [-902.113] (-907.048) (-891.286) -- 0:03:24
      479000 -- (-897.437) (-912.030) [-886.204] (-897.639) * (-897.801) (-917.040) (-908.491) [-889.931] -- 0:03:24
      479500 -- (-889.183) (-908.705) [-895.314] (-906.301) * [-902.329] (-915.821) (-913.086) (-903.155) -- 0:03:24
      480000 -- [-907.072] (-908.295) (-917.227) (-908.037) * [-889.036] (-898.281) (-921.674) (-897.989) -- 0:03:23

      Average standard deviation of split frequencies: 0.010886

      480500 -- [-897.982] (-917.318) (-902.725) (-902.450) * (-895.440) [-892.490] (-912.426) (-901.571) -- 0:03:24
      481000 -- [-892.443] (-906.415) (-912.380) (-899.266) * (-906.115) [-887.642] (-908.616) (-908.733) -- 0:03:23
      481500 -- [-897.619] (-913.754) (-915.983) (-898.249) * (-917.399) [-908.185] (-898.211) (-906.873) -- 0:03:23
      482000 -- [-884.976] (-897.688) (-903.074) (-899.472) * [-897.351] (-900.140) (-903.298) (-915.626) -- 0:03:23
      482500 -- (-891.549) (-916.418) [-913.706] (-907.379) * (-908.930) [-903.243] (-901.046) (-913.843) -- 0:03:22
      483000 -- [-893.820] (-906.769) (-906.464) (-909.219) * (-906.517) (-915.146) (-906.033) [-897.491] -- 0:03:23
      483500 -- (-914.298) (-899.558) (-910.718) [-894.640] * (-890.017) (-917.886) (-911.960) [-888.878] -- 0:03:22
      484000 -- (-898.846) (-913.541) (-907.956) [-904.166] * (-894.858) (-916.056) [-905.945] (-913.883) -- 0:03:22
      484500 -- (-888.566) (-908.402) (-905.068) [-903.233] * (-910.751) [-904.264] (-909.049) (-910.512) -- 0:03:22
      485000 -- [-896.528] (-904.104) (-919.615) (-910.156) * (-895.713) (-913.015) (-908.319) [-899.145] -- 0:03:21

      Average standard deviation of split frequencies: 0.010621

      485500 -- (-893.623) (-904.951) [-906.733] (-904.410) * (-904.582) (-909.744) [-899.665] (-916.862) -- 0:03:22
      486000 -- (-907.411) (-900.230) (-904.753) [-898.330] * (-918.643) (-911.384) (-902.525) [-894.766] -- 0:03:22
      486500 -- (-899.063) [-903.971] (-910.082) (-910.717) * [-906.845] (-924.379) (-904.540) (-906.552) -- 0:03:21
      487000 -- (-908.661) (-899.246) [-898.220] (-901.509) * (-907.719) (-903.132) (-909.839) [-901.222] -- 0:03:21
      487500 -- (-908.094) [-886.090] (-898.752) (-904.308) * (-916.117) [-904.763] (-910.556) (-907.638) -- 0:03:21
      488000 -- (-897.445) (-906.676) (-924.242) [-888.761] * (-902.532) (-925.567) [-895.498] (-914.775) -- 0:03:21
      488500 -- (-917.180) [-905.823] (-914.034) (-903.872) * (-899.160) (-907.469) [-887.081] (-910.680) -- 0:03:21
      489000 -- (-897.239) [-894.806] (-902.378) (-904.135) * (-905.354) (-910.274) [-894.100] (-922.413) -- 0:03:20
      489500 -- [-894.842] (-909.631) (-899.853) (-901.538) * (-914.803) (-907.094) (-894.831) [-895.139] -- 0:03:20
      490000 -- (-903.930) (-912.196) [-901.497] (-905.878) * (-902.560) (-913.591) [-889.865] (-900.268) -- 0:03:20

      Average standard deviation of split frequencies: 0.010088

      490500 -- [-897.208] (-903.113) (-912.208) (-903.916) * (-906.408) (-916.213) [-893.552] (-913.851) -- 0:03:20
      491000 -- (-897.404) (-911.051) [-892.535] (-899.450) * [-898.999] (-909.641) (-893.405) (-911.151) -- 0:03:20
      491500 -- (-903.339) (-896.912) (-897.739) [-897.194] * [-905.697] (-897.239) (-896.742) (-905.985) -- 0:03:19
      492000 -- (-912.239) (-925.649) (-914.141) [-892.565] * (-917.644) (-906.614) [-895.480] (-901.372) -- 0:03:19
      492500 -- (-910.947) (-901.120) (-912.861) [-893.133] * [-890.737] (-911.057) (-891.858) (-919.878) -- 0:03:19
      493000 -- [-898.566] (-917.226) (-902.517) (-900.273) * (-902.116) (-902.538) [-900.073] (-904.998) -- 0:03:19
      493500 -- (-897.402) (-917.727) [-901.067] (-921.049) * (-909.898) [-912.165] (-915.790) (-909.940) -- 0:03:19
      494000 -- (-894.963) [-899.277] (-904.465) (-909.732) * [-901.480] (-903.718) (-890.350) (-894.948) -- 0:03:18
      494500 -- (-910.711) (-897.050) [-897.080] (-923.292) * (-902.560) [-896.400] (-898.092) (-904.333) -- 0:03:18
      495000 -- (-896.725) [-892.793] (-913.199) (-928.543) * (-910.237) (-905.055) [-895.655] (-912.091) -- 0:03:18

      Average standard deviation of split frequencies: 0.010407

      495500 -- (-903.550) [-891.024] (-900.123) (-918.059) * (-904.973) (-910.927) (-901.108) [-896.587] -- 0:03:18
      496000 -- (-907.346) [-891.617] (-913.272) (-919.661) * (-900.563) (-915.466) [-910.502] (-914.759) -- 0:03:18
      496500 -- (-915.622) (-899.296) [-904.631] (-899.784) * (-904.910) (-916.333) [-904.427] (-911.629) -- 0:03:17
      497000 -- (-905.888) (-895.023) (-893.759) [-904.436] * (-903.241) (-907.959) (-894.307) [-895.873] -- 0:03:17
      497500 -- (-910.821) (-899.602) [-891.464] (-919.558) * (-903.513) (-907.270) (-905.189) [-895.152] -- 0:03:17
      498000 -- [-898.900] (-930.647) (-899.504) (-920.777) * (-908.337) (-899.262) [-891.993] (-907.105) -- 0:03:17
      498500 -- [-902.666] (-906.309) (-911.589) (-915.883) * (-905.453) (-908.758) [-903.999] (-903.385) -- 0:03:17
      499000 -- (-901.663) (-908.632) [-896.381] (-918.236) * [-899.602] (-903.634) (-906.740) (-921.706) -- 0:03:16
      499500 -- [-900.799] (-899.877) (-910.548) (-903.822) * (-893.107) (-896.112) [-896.723] (-909.474) -- 0:03:16
      500000 -- (-910.016) [-901.285] (-922.223) (-922.384) * (-908.304) (-907.293) [-899.687] (-900.307) -- 0:03:17

      Average standard deviation of split frequencies: 0.009745

      500500 -- [-894.123] (-895.093) (-905.261) (-915.161) * (-921.195) (-925.835) (-900.146) [-903.787] -- 0:03:16
      501000 -- (-899.984) (-908.251) (-901.725) [-899.408] * (-917.870) (-898.017) [-896.768] (-896.592) -- 0:03:16
      501500 -- (-908.928) (-917.561) (-904.959) [-903.173] * (-903.598) (-921.676) (-899.464) [-892.718] -- 0:03:15
      502000 -- [-898.667] (-917.593) (-897.894) (-910.968) * (-909.562) (-908.980) [-894.074] (-898.514) -- 0:03:15
      502500 -- (-905.938) [-909.697] (-909.339) (-914.962) * (-911.353) [-912.570] (-893.931) (-907.313) -- 0:03:16
      503000 -- [-898.341] (-902.115) (-896.075) (-898.466) * (-907.168) [-900.232] (-900.308) (-890.966) -- 0:03:15
      503500 -- (-910.123) [-898.491] (-898.822) (-905.098) * (-910.975) (-919.454) [-901.142] (-897.808) -- 0:03:15
      504000 -- (-902.495) [-893.910] (-911.776) (-905.357) * (-902.139) [-885.723] (-902.916) (-914.748) -- 0:03:14
      504500 -- (-905.662) (-902.866) [-902.302] (-907.128) * (-905.629) [-899.297] (-901.440) (-904.656) -- 0:03:14
      505000 -- (-906.587) (-901.502) [-901.502] (-903.442) * (-902.821) (-900.610) [-909.335] (-901.491) -- 0:03:14

      Average standard deviation of split frequencies: 0.009782

      505500 -- (-916.196) (-898.322) (-898.816) [-890.696] * (-891.896) (-903.220) [-905.013] (-906.948) -- 0:03:14
      506000 -- (-912.844) (-898.395) (-907.177) [-887.219] * [-884.170] (-910.274) (-901.049) (-912.356) -- 0:03:14
      506500 -- (-917.331) (-893.263) [-902.509] (-912.279) * (-908.683) [-900.158] (-915.901) (-901.327) -- 0:03:13
      507000 -- (-921.931) [-886.599] (-909.809) (-908.327) * (-913.840) [-903.686] (-914.184) (-901.765) -- 0:03:13
      507500 -- [-889.159] (-897.722) (-918.318) (-901.589) * (-919.854) [-898.145] (-896.466) (-911.059) -- 0:03:13
      508000 -- (-894.019) (-930.020) (-926.287) [-897.942] * (-914.643) [-903.818] (-891.361) (-908.146) -- 0:03:13
      508500 -- (-901.090) [-911.262] (-922.742) (-907.259) * (-920.520) (-903.161) [-891.593] (-904.981) -- 0:03:13
      509000 -- (-901.726) (-909.793) (-909.442) [-891.619] * (-895.843) [-900.154] (-919.987) (-922.633) -- 0:03:12
      509500 -- (-910.811) [-900.839] (-909.060) (-895.299) * (-899.252) (-895.989) [-894.182] (-924.781) -- 0:03:12
      510000 -- (-911.607) (-911.283) [-899.296] (-903.625) * (-902.354) (-914.846) [-893.117] (-907.630) -- 0:03:13

      Average standard deviation of split frequencies: 0.010339

      510500 -- (-905.338) (-910.381) (-897.555) [-894.079] * (-903.237) (-911.803) [-894.057] (-919.062) -- 0:03:12
      511000 -- [-894.840] (-909.677) (-905.144) (-898.374) * (-906.432) (-911.125) [-894.942] (-901.887) -- 0:03:12
      511500 -- (-902.761) (-903.314) (-913.912) [-904.940] * [-895.731] (-903.619) (-895.612) (-911.280) -- 0:03:11
      512000 -- (-905.326) [-894.046] (-909.694) (-904.439) * [-901.291] (-911.166) (-897.563) (-895.420) -- 0:03:11
      512500 -- (-916.655) [-884.152] (-907.407) (-899.174) * (-912.830) (-923.040) [-896.705] (-901.786) -- 0:03:11
      513000 -- [-912.198] (-899.023) (-898.840) (-908.809) * (-903.842) (-920.772) (-910.446) [-896.080] -- 0:03:11
      513500 -- (-895.811) [-900.503] (-909.797) (-894.127) * [-891.502] (-921.328) (-916.354) (-895.161) -- 0:03:11
      514000 -- [-896.160] (-901.789) (-908.474) (-895.754) * (-902.583) [-907.268] (-901.553) (-894.210) -- 0:03:10
      514500 -- (-909.043) [-899.195] (-912.960) (-913.420) * (-905.689) (-908.016) [-896.558] (-903.913) -- 0:03:10
      515000 -- (-904.181) (-893.834) [-894.993] (-919.104) * (-899.037) (-903.181) (-915.247) [-903.481] -- 0:03:11

      Average standard deviation of split frequencies: 0.010004

      515500 -- (-904.836) (-909.274) [-888.161] (-907.990) * (-930.382) (-903.299) (-902.441) [-896.586] -- 0:03:10
      516000 -- (-922.316) (-890.385) [-895.360] (-917.887) * [-903.294] (-908.833) (-893.216) (-909.574) -- 0:03:10
      516500 -- (-897.463) [-901.270] (-903.975) (-919.556) * (-915.196) (-901.405) [-888.809] (-901.681) -- 0:03:10
      517000 -- (-900.772) (-897.361) (-911.642) [-902.403] * [-895.540] (-901.191) (-901.554) (-903.312) -- 0:03:09
      517500 -- (-899.793) (-914.754) (-912.589) [-897.971] * (-893.712) [-907.658] (-904.974) (-898.617) -- 0:03:10
      518000 -- (-901.411) (-911.460) (-895.309) [-888.083] * (-895.315) [-892.347] (-914.447) (-906.468) -- 0:03:09
      518500 -- (-904.388) (-921.115) [-894.061] (-916.346) * [-892.026] (-900.256) (-905.249) (-898.718) -- 0:03:09
      519000 -- (-903.482) (-908.978) (-904.832) [-904.550] * [-902.343] (-909.641) (-901.567) (-902.168) -- 0:03:09
      519500 -- (-905.880) (-899.556) [-906.217] (-907.851) * [-900.796] (-908.920) (-894.835) (-914.392) -- 0:03:08
      520000 -- (-906.799) (-905.256) (-900.094) [-886.622] * [-901.447] (-893.878) (-908.194) (-898.634) -- 0:03:09

      Average standard deviation of split frequencies: 0.010502

      520500 -- (-911.449) [-904.930] (-909.662) (-915.416) * (-904.851) (-906.691) (-914.865) [-904.255] -- 0:03:08
      521000 -- (-907.059) (-919.605) [-890.280] (-903.548) * (-924.518) [-903.666] (-896.333) (-903.834) -- 0:03:08
      521500 -- (-904.757) (-910.766) [-893.758] (-907.457) * [-884.511] (-908.577) (-909.562) (-910.713) -- 0:03:08
      522000 -- [-895.330] (-916.626) (-894.579) (-899.704) * (-909.105) (-918.815) [-895.416] (-916.818) -- 0:03:07
      522500 -- [-903.997] (-922.869) (-910.775) (-910.251) * (-893.769) [-891.939] (-906.093) (-907.752) -- 0:03:08
      523000 -- (-916.020) (-914.992) [-909.133] (-921.991) * (-902.631) (-901.003) [-900.653] (-916.191) -- 0:03:07
      523500 -- (-914.039) (-908.788) [-908.224] (-904.737) * (-906.080) (-919.911) [-902.493] (-906.329) -- 0:03:07
      524000 -- (-904.541) (-897.303) [-896.069] (-903.239) * (-906.164) (-920.804) (-906.543) [-893.544] -- 0:03:07
      524500 -- (-897.271) (-904.056) [-886.072] (-909.867) * (-904.882) (-915.970) (-899.189) [-907.375] -- 0:03:07
      525000 -- (-891.736) (-925.961) (-921.143) [-904.329] * [-908.058] (-906.686) (-902.912) (-902.812) -- 0:03:07

      Average standard deviation of split frequencies: 0.009769

      525500 -- (-894.187) [-913.220] (-902.221) (-925.568) * (-920.958) [-897.370] (-908.003) (-895.873) -- 0:03:06
      526000 -- (-903.875) (-908.198) [-900.060] (-895.154) * (-920.687) (-904.777) [-899.292] (-895.203) -- 0:03:06
      526500 -- (-910.338) (-924.315) (-906.657) [-908.035] * (-931.322) [-902.225] (-894.985) (-900.208) -- 0:03:06
      527000 -- (-907.084) (-912.670) (-914.226) [-899.617] * (-912.377) [-896.975] (-903.522) (-922.664) -- 0:03:06
      527500 -- [-907.863] (-893.269) (-905.152) (-910.765) * (-922.740) (-889.569) [-892.120] (-915.781) -- 0:03:06
      528000 -- (-910.727) [-906.108] (-925.448) (-911.366) * (-912.931) [-891.182] (-904.569) (-913.932) -- 0:03:05
      528500 -- (-908.282) (-896.073) [-895.473] (-896.005) * (-905.637) (-891.917) (-917.743) [-905.746] -- 0:03:05
      529000 -- (-921.572) (-906.427) (-895.590) [-889.627] * (-906.177) (-924.112) [-905.994] (-907.372) -- 0:03:05
      529500 -- (-908.523) [-886.697] (-919.539) (-898.026) * (-897.209) (-912.762) (-908.307) [-897.780] -- 0:03:05
      530000 -- (-919.417) (-893.976) (-912.147) [-883.086] * [-898.175] (-916.644) (-897.924) (-893.615) -- 0:03:05

      Average standard deviation of split frequencies: 0.009860

      530500 -- (-915.207) (-898.076) (-909.923) [-890.413] * (-899.378) (-903.221) (-911.133) [-899.595] -- 0:03:04
      531000 -- [-899.168] (-904.976) (-906.748) (-912.265) * (-907.417) (-896.427) (-912.625) [-891.285] -- 0:03:04
      531500 -- (-906.306) (-917.773) [-899.560] (-906.722) * (-909.417) (-907.828) (-896.242) [-896.888] -- 0:03:04
      532000 -- (-919.792) [-895.767] (-919.205) (-917.415) * (-914.404) (-904.703) (-917.146) [-904.075] -- 0:03:04
      532500 -- (-895.345) (-900.498) (-917.586) [-898.289] * [-895.988] (-913.737) (-922.600) (-900.187) -- 0:03:04
      533000 -- (-902.219) (-919.862) (-907.178) [-897.491] * (-903.344) [-913.721] (-926.943) (-918.040) -- 0:03:03
      533500 -- (-913.885) (-915.953) (-899.513) [-895.675] * [-890.822] (-905.704) (-921.262) (-901.134) -- 0:03:03
      534000 -- (-921.384) (-893.937) (-890.785) [-896.403] * (-910.588) [-896.105] (-932.031) (-911.521) -- 0:03:03
      534500 -- (-905.346) (-903.493) [-895.872] (-904.923) * (-911.923) [-894.095] (-903.566) (-908.037) -- 0:03:03
      535000 -- (-899.696) (-900.645) [-890.167] (-916.847) * (-918.208) [-888.812] (-896.773) (-907.547) -- 0:03:03

      Average standard deviation of split frequencies: 0.009718

      535500 -- (-910.970) (-893.727) [-904.340] (-912.352) * (-907.881) [-898.015] (-903.910) (-917.891) -- 0:03:03
      536000 -- [-900.798] (-912.165) (-910.879) (-905.026) * (-904.618) (-907.658) (-909.392) [-895.300] -- 0:03:02
      536500 -- (-899.773) [-900.795] (-919.576) (-901.779) * (-906.711) (-919.779) (-907.745) [-885.502] -- 0:03:03
      537000 -- [-893.805] (-904.653) (-916.677) (-907.956) * (-896.088) [-893.903] (-909.419) (-907.443) -- 0:03:02
      537500 -- (-894.078) [-903.564] (-905.905) (-897.844) * [-896.644] (-904.973) (-898.839) (-904.674) -- 0:03:02
      538000 -- (-900.299) (-903.156) [-902.432] (-908.585) * [-899.484] (-907.000) (-896.351) (-913.246) -- 0:03:02
      538500 -- (-914.938) (-917.184) [-894.883] (-903.298) * (-916.698) [-900.070] (-917.543) (-915.985) -- 0:03:01
      539000 -- (-909.188) (-905.298) (-898.580) [-891.595] * (-894.612) (-900.200) (-919.701) [-902.442] -- 0:03:02
      539500 -- (-895.245) (-900.238) [-901.059] (-910.660) * (-914.438) [-894.617] (-922.839) (-899.025) -- 0:03:01
      540000 -- (-901.248) [-896.854] (-899.836) (-918.862) * (-901.754) [-894.685] (-902.000) (-903.664) -- 0:03:01

      Average standard deviation of split frequencies: 0.010506

      540500 -- (-910.396) (-906.463) [-898.799] (-920.709) * [-897.751] (-904.592) (-907.254) (-910.749) -- 0:03:01
      541000 -- [-903.370] (-907.889) (-903.584) (-908.054) * (-902.773) (-905.474) [-896.841] (-905.302) -- 0:03:00
      541500 -- (-918.446) (-908.860) (-912.578) [-901.423] * (-909.462) (-899.705) (-901.791) [-895.936] -- 0:03:01
      542000 -- (-906.430) (-905.266) (-898.415) [-910.888] * (-924.041) (-898.031) [-906.565] (-898.283) -- 0:03:00
      542500 -- (-909.826) [-913.472] (-897.072) (-902.133) * (-914.606) (-911.547) (-901.633) [-897.805] -- 0:03:00
      543000 -- [-911.753] (-916.926) (-905.295) (-910.174) * (-921.299) [-904.785] (-910.367) (-894.726) -- 0:03:00
      543500 -- (-901.585) (-909.673) [-894.863] (-896.372) * (-908.577) (-911.945) (-901.001) [-894.482] -- 0:02:59
      544000 -- (-911.392) (-914.295) (-902.731) [-902.718] * [-899.942] (-904.919) (-903.690) (-917.424) -- 0:03:00
      544500 -- (-905.520) (-908.122) [-893.689] (-905.864) * (-915.454) (-908.068) [-897.170] (-914.740) -- 0:02:59
      545000 -- (-906.391) (-903.571) (-908.642) [-897.343] * (-920.134) (-924.347) (-897.888) [-908.775] -- 0:02:59

      Average standard deviation of split frequencies: 0.010922

      545500 -- [-897.711] (-903.427) (-906.627) (-909.635) * [-902.926] (-922.428) (-891.866) (-901.547) -- 0:02:59
      546000 -- (-897.613) (-913.403) (-898.315) [-893.911] * (-898.263) (-907.213) [-894.939] (-908.688) -- 0:02:58
      546500 -- (-896.860) (-900.911) (-904.854) [-896.865] * [-911.269] (-904.382) (-915.623) (-903.395) -- 0:02:59
      547000 -- (-893.586) [-894.586] (-916.583) (-913.585) * (-914.158) (-892.727) [-901.847] (-904.037) -- 0:02:58
      547500 -- (-885.098) [-889.389] (-904.440) (-931.646) * (-917.916) [-900.573] (-908.949) (-918.628) -- 0:02:58
      548000 -- (-912.612) [-897.110] (-906.677) (-929.892) * (-932.999) (-897.157) (-908.636) [-896.572] -- 0:02:58
      548500 -- [-897.587] (-899.578) (-901.474) (-894.370) * (-921.956) [-886.428] (-918.740) (-907.285) -- 0:02:57
      549000 -- (-895.830) (-906.785) (-902.587) [-909.543] * (-909.924) [-891.409] (-918.634) (-912.853) -- 0:02:58
      549500 -- (-901.776) [-898.429] (-901.570) (-912.815) * (-918.401) (-895.228) (-898.372) [-899.507] -- 0:02:57
      550000 -- (-898.230) (-898.295) (-917.929) [-895.924] * (-909.683) (-903.149) (-919.789) [-902.795] -- 0:02:57

      Average standard deviation of split frequencies: 0.011129

      550500 -- [-902.774] (-904.853) (-895.428) (-910.903) * (-913.346) [-895.283] (-909.516) (-906.252) -- 0:02:57
      551000 -- (-914.137) (-912.039) [-900.117] (-910.633) * (-893.793) [-904.070] (-891.850) (-912.516) -- 0:02:57
      551500 -- [-897.689] (-904.723) (-905.508) (-908.711) * [-896.008] (-904.969) (-912.752) (-903.910) -- 0:02:57
      552000 -- (-890.865) [-899.624] (-902.463) (-909.581) * [-890.684] (-902.512) (-909.527) (-899.215) -- 0:02:56
      552500 -- (-903.777) (-908.908) [-896.244] (-906.135) * (-904.808) (-912.807) (-909.288) [-897.096] -- 0:02:56
      553000 -- (-909.988) (-895.157) [-902.884] (-901.393) * [-908.698] (-895.285) (-927.201) (-903.341) -- 0:02:57
      553500 -- (-885.724) (-896.736) (-914.135) [-894.164] * (-906.288) [-894.307] (-908.124) (-910.435) -- 0:02:56
      554000 -- [-898.392] (-920.720) (-900.835) (-912.548) * [-904.369] (-897.938) (-914.821) (-918.650) -- 0:02:56
      554500 -- [-892.099] (-912.545) (-904.168) (-907.904) * (-911.290) [-902.003] (-897.247) (-911.163) -- 0:02:55
      555000 -- (-891.569) [-917.592] (-906.502) (-911.812) * (-896.426) [-893.677] (-908.459) (-922.071) -- 0:02:55

      Average standard deviation of split frequencies: 0.010174

      555500 -- (-905.171) (-923.299) (-901.236) [-903.217] * (-898.975) (-897.416) [-897.587] (-921.376) -- 0:02:56
      556000 -- [-900.762] (-908.834) (-900.328) (-910.133) * (-900.258) (-912.577) [-892.602] (-902.611) -- 0:02:55
      556500 -- (-905.929) (-914.267) [-895.108] (-919.410) * (-925.497) (-889.881) [-896.062] (-910.421) -- 0:02:55
      557000 -- (-912.845) [-893.512] (-921.338) (-906.936) * [-891.207] (-903.917) (-906.451) (-903.166) -- 0:02:54
      557500 -- (-910.408) [-894.476] (-910.711) (-907.079) * [-895.292] (-934.230) (-903.469) (-905.644) -- 0:02:54
      558000 -- (-900.557) [-891.768] (-923.971) (-909.674) * (-906.137) (-917.379) [-897.336] (-909.457) -- 0:02:55
      558500 -- (-897.859) (-915.137) [-903.711] (-907.361) * (-896.473) (-920.064) (-905.929) [-906.358] -- 0:02:54
      559000 -- (-903.108) (-913.507) (-910.913) [-898.781] * (-915.330) [-903.547] (-896.021) (-901.737) -- 0:02:54
      559500 -- [-903.117] (-899.055) (-921.383) (-897.700) * (-892.156) (-905.988) (-911.025) [-901.370] -- 0:02:53
      560000 -- (-908.967) [-894.271] (-916.194) (-904.488) * (-914.983) (-901.421) (-907.631) [-888.578] -- 0:02:53

      Average standard deviation of split frequencies: 0.010888

      560500 -- (-903.393) [-904.081] (-918.664) (-896.962) * (-908.528) (-910.354) (-907.560) [-896.554] -- 0:02:54
      561000 -- (-905.061) [-901.769] (-911.187) (-899.643) * [-907.955] (-909.383) (-908.346) (-913.005) -- 0:02:53
      561500 -- (-911.587) (-903.594) [-895.174] (-908.781) * (-900.654) [-906.500] (-907.528) (-915.029) -- 0:02:53
      562000 -- (-898.269) [-893.987] (-897.471) (-912.260) * (-893.962) [-886.747] (-907.291) (-897.118) -- 0:02:53
      562500 -- (-902.757) (-896.382) [-896.936] (-920.304) * (-894.048) (-906.558) (-909.843) [-890.203] -- 0:02:52
      563000 -- (-911.194) (-897.762) [-889.063] (-914.040) * [-897.542] (-919.822) (-892.704) (-906.059) -- 0:02:53
      563500 -- (-900.964) (-899.659) [-903.894] (-903.689) * (-907.181) (-908.573) (-891.360) [-893.954] -- 0:02:52
      564000 -- (-910.543) (-893.121) (-908.772) [-895.167] * (-899.683) (-900.485) [-896.163] (-908.276) -- 0:02:52
      564500 -- (-916.076) (-901.003) [-898.044] (-894.762) * (-916.540) [-905.112] (-901.421) (-894.459) -- 0:02:52
      565000 -- (-911.767) (-897.449) [-902.694] (-907.033) * (-899.885) (-907.986) [-898.179] (-902.751) -- 0:02:51

      Average standard deviation of split frequencies: 0.010827

      565500 -- [-900.985] (-908.715) (-926.597) (-914.253) * (-916.807) [-903.893] (-901.261) (-897.036) -- 0:02:52
      566000 -- (-890.692) (-905.801) [-903.301] (-911.586) * (-900.306) (-914.664) (-901.720) [-896.788] -- 0:02:51
      566500 -- [-902.926] (-898.874) (-911.756) (-913.839) * (-905.284) (-904.887) [-899.465] (-889.144) -- 0:02:51
      567000 -- (-894.955) (-910.188) [-897.495] (-901.216) * (-902.784) (-917.905) (-902.614) [-891.771] -- 0:02:51
      567500 -- [-900.607] (-910.890) (-913.307) (-922.538) * (-897.788) (-911.546) (-902.135) [-897.838] -- 0:02:50
      568000 -- (-910.624) (-913.261) [-905.045] (-904.826) * (-920.379) (-891.437) [-898.971] (-912.518) -- 0:02:51
      568500 -- [-896.212] (-912.494) (-900.144) (-891.604) * (-906.487) (-894.559) [-896.203] (-913.943) -- 0:02:50
      569000 -- (-913.848) (-897.460) (-905.252) [-897.355] * (-921.782) (-894.794) [-901.439] (-912.893) -- 0:02:50
      569500 -- [-906.808] (-896.918) (-914.300) (-892.411) * (-901.277) [-907.005] (-897.563) (-908.791) -- 0:02:50
      570000 -- (-913.787) [-894.230] (-905.856) (-903.707) * (-909.285) (-907.771) (-904.768) [-900.375] -- 0:02:50

      Average standard deviation of split frequencies: 0.011854

      570500 -- (-906.678) [-904.386] (-904.600) (-898.322) * (-906.945) (-904.473) (-922.832) [-892.251] -- 0:02:50
      571000 -- (-902.325) [-892.809] (-902.227) (-899.807) * (-896.208) (-891.956) (-917.765) [-894.701] -- 0:02:49
      571500 -- (-916.333) (-899.002) (-916.222) [-918.736] * [-892.920] (-913.754) (-893.754) (-890.486) -- 0:02:49
      572000 -- [-889.504] (-904.106) (-911.204) (-896.115) * (-912.729) (-908.180) [-900.279] (-900.340) -- 0:02:49
      572500 -- (-935.064) [-902.696] (-905.546) (-896.821) * (-912.474) [-913.882] (-896.007) (-921.846) -- 0:02:49
      573000 -- (-905.336) [-896.160] (-905.481) (-899.190) * (-903.022) (-905.749) [-909.488] (-896.491) -- 0:02:49
      573500 -- (-907.923) [-894.834] (-909.160) (-900.330) * (-903.223) [-899.524] (-909.179) (-901.385) -- 0:02:48
      574000 -- (-898.177) [-901.155] (-913.896) (-904.216) * [-894.975] (-909.136) (-901.879) (-900.153) -- 0:02:48
      574500 -- (-906.285) [-904.318] (-913.131) (-897.478) * (-901.464) [-895.912] (-905.580) (-904.527) -- 0:02:48
      575000 -- (-909.918) (-908.287) (-914.336) [-898.989] * [-885.475] (-903.016) (-894.417) (-900.096) -- 0:02:48

      Average standard deviation of split frequencies: 0.012317

      575500 -- (-921.672) (-887.545) (-913.568) [-901.260] * (-885.059) (-900.592) (-929.853) [-900.849] -- 0:02:48
      576000 -- (-923.420) (-900.119) (-909.268) [-904.779] * (-901.336) [-907.291] (-920.683) (-906.762) -- 0:02:47
      576500 -- [-905.128] (-910.973) (-901.804) (-899.999) * (-906.153) [-900.298] (-916.948) (-910.719) -- 0:02:47
      577000 -- (-909.070) (-906.325) (-908.982) [-887.609] * (-912.887) [-891.227] (-894.153) (-917.553) -- 0:02:47
      577500 -- (-897.235) (-894.807) (-903.451) [-899.450] * (-911.701) (-900.681) [-888.441] (-932.100) -- 0:02:47
      578000 -- [-912.094] (-911.179) (-911.362) (-898.506) * [-894.828] (-901.215) (-913.005) (-908.245) -- 0:02:47
      578500 -- [-897.964] (-887.496) (-906.098) (-915.561) * (-899.132) [-902.718] (-891.527) (-905.205) -- 0:02:46
      579000 -- [-887.128] (-906.671) (-897.955) (-921.243) * (-908.805) (-910.557) (-905.347) [-903.369] -- 0:02:46
      579500 -- (-889.696) (-906.418) (-898.358) [-915.507] * (-901.480) (-901.209) [-897.532] (-895.668) -- 0:02:46
      580000 -- [-899.586] (-906.257) (-917.644) (-913.780) * (-905.301) (-900.913) [-893.245] (-907.832) -- 0:02:46

      Average standard deviation of split frequencies: 0.012137

      580500 -- (-888.520) [-893.884] (-915.484) (-939.673) * (-894.949) (-911.905) [-893.177] (-889.520) -- 0:02:46
      581000 -- [-887.427] (-891.303) (-918.965) (-904.456) * (-905.182) (-902.913) (-901.912) [-894.193] -- 0:02:45
      581500 -- (-893.338) (-904.122) [-904.502] (-912.260) * [-903.350] (-918.917) (-897.268) (-909.042) -- 0:02:45
      582000 -- [-888.657] (-897.725) (-904.402) (-910.238) * (-900.435) (-900.525) [-895.470] (-908.226) -- 0:02:45
      582500 -- (-902.200) [-898.423] (-907.298) (-916.549) * (-923.045) (-902.672) (-920.422) [-895.759] -- 0:02:45
      583000 -- (-914.764) (-897.082) (-916.524) [-895.926] * [-905.309] (-910.158) (-905.261) (-904.126) -- 0:02:45
      583500 -- (-900.241) (-910.351) (-901.753) [-894.549] * (-909.568) [-889.813] (-895.026) (-905.065) -- 0:02:44
      584000 -- [-896.386] (-906.083) (-898.401) (-908.855) * (-894.995) (-909.770) [-899.579] (-901.143) -- 0:02:44
      584500 -- (-904.913) [-898.705] (-905.552) (-910.410) * (-893.911) [-899.220] (-923.883) (-908.963) -- 0:02:44
      585000 -- (-894.794) [-898.626] (-898.360) (-924.923) * [-892.174] (-895.655) (-915.012) (-903.614) -- 0:02:44

      Average standard deviation of split frequencies: 0.012670

      585500 -- (-899.592) [-907.083] (-904.199) (-915.724) * [-896.917] (-901.812) (-931.390) (-896.899) -- 0:02:44
      586000 -- (-916.810) (-908.282) [-904.713] (-920.960) * (-902.231) [-897.035] (-918.325) (-901.906) -- 0:02:43
      586500 -- [-904.986] (-903.826) (-906.204) (-900.950) * (-910.013) [-897.540] (-914.459) (-903.588) -- 0:02:43
      587000 -- (-926.011) [-907.278] (-901.102) (-903.665) * (-907.436) [-908.348] (-923.585) (-906.025) -- 0:02:43
      587500 -- (-920.718) (-901.789) [-890.875] (-907.976) * (-914.462) [-901.166] (-896.200) (-905.540) -- 0:02:43
      588000 -- (-900.965) (-912.620) [-888.912] (-909.753) * (-909.656) (-903.900) [-899.144] (-919.295) -- 0:02:43
      588500 -- (-903.474) [-907.222] (-900.751) (-902.749) * (-896.205) (-908.751) [-900.428] (-904.069) -- 0:02:42
      589000 -- (-923.882) (-898.093) (-896.656) [-904.078] * (-900.560) (-896.360) (-905.455) [-910.395] -- 0:02:42
      589500 -- (-922.315) [-897.206] (-893.681) (-899.705) * [-896.332] (-906.491) (-901.356) (-901.287) -- 0:02:42
      590000 -- (-917.558) (-903.760) (-904.674) [-900.849] * (-929.094) (-903.405) [-899.533] (-902.717) -- 0:02:42

      Average standard deviation of split frequencies: 0.012929

      590500 -- (-916.327) [-899.281] (-913.692) (-896.114) * (-918.186) (-891.955) (-906.985) [-891.092] -- 0:02:42
      591000 -- (-913.757) [-900.016] (-919.043) (-901.199) * (-901.442) (-915.026) (-911.354) [-892.240] -- 0:02:41
      591500 -- (-928.500) (-894.284) [-906.854] (-894.083) * (-904.957) (-908.981) (-896.190) [-890.515] -- 0:02:41
      592000 -- (-898.739) (-899.103) [-898.755] (-900.385) * (-907.096) (-903.786) (-915.104) [-895.182] -- 0:02:41
      592500 -- [-889.510] (-907.266) (-915.629) (-911.431) * [-907.176] (-913.166) (-901.666) (-917.003) -- 0:02:41
      593000 -- [-900.630] (-901.577) (-917.142) (-906.420) * (-901.777) [-900.082] (-894.135) (-916.132) -- 0:02:41
      593500 -- [-894.451] (-907.195) (-912.227) (-895.322) * (-909.991) [-900.768] (-902.158) (-907.059) -- 0:02:40
      594000 -- [-901.822] (-909.684) (-893.355) (-897.719) * (-905.194) [-892.083] (-884.972) (-907.429) -- 0:02:40
      594500 -- (-898.679) (-901.075) [-901.656] (-915.857) * (-899.509) (-909.742) [-894.794] (-899.155) -- 0:02:40
      595000 -- (-906.815) (-900.275) [-889.763] (-917.012) * [-892.963] (-915.425) (-910.064) (-894.434) -- 0:02:40

      Average standard deviation of split frequencies: 0.012892

      595500 -- (-911.425) (-893.435) [-898.047] (-917.313) * (-895.962) [-908.447] (-912.066) (-903.707) -- 0:02:40
      596000 -- (-907.700) [-888.601] (-897.743) (-904.320) * [-905.501] (-904.020) (-896.765) (-907.266) -- 0:02:39
      596500 -- [-897.483] (-890.409) (-900.655) (-912.401) * (-887.043) (-897.572) [-906.559] (-906.514) -- 0:02:39
      597000 -- (-898.234) [-896.771] (-907.297) (-913.385) * [-904.126] (-927.747) (-905.249) (-904.421) -- 0:02:39
      597500 -- (-893.305) [-909.142] (-909.662) (-900.121) * (-909.213) (-898.723) [-896.909] (-901.268) -- 0:02:39
      598000 -- (-886.795) (-908.964) [-896.636] (-922.179) * [-901.099] (-923.840) (-907.575) (-898.693) -- 0:02:39
      598500 -- (-899.986) [-897.179] (-912.206) (-912.083) * [-906.268] (-916.546) (-906.401) (-903.040) -- 0:02:38
      599000 -- [-901.702] (-899.472) (-908.438) (-906.390) * (-906.557) (-924.965) [-888.648] (-905.594) -- 0:02:38
      599500 -- [-895.845] (-904.236) (-904.654) (-897.249) * (-902.430) (-916.961) [-898.134] (-900.433) -- 0:02:38
      600000 -- (-916.963) (-889.868) (-909.766) [-896.014] * (-880.578) (-915.951) (-918.942) [-897.826] -- 0:02:38

      Average standard deviation of split frequencies: 0.012635

      600500 -- (-913.650) (-895.756) (-913.175) [-900.048] * (-894.041) [-899.405] (-912.799) (-907.242) -- 0:02:38
      601000 -- (-913.225) [-889.439] (-913.598) (-904.541) * [-903.894] (-900.373) (-894.058) (-896.545) -- 0:02:38
      601500 -- (-896.510) [-912.527] (-895.697) (-916.790) * (-918.255) (-892.798) (-906.172) [-885.142] -- 0:02:37
      602000 -- (-911.719) (-900.692) (-910.883) [-895.717] * (-914.227) (-903.829) [-905.006] (-910.752) -- 0:02:38
      602500 -- [-898.841] (-908.132) (-915.917) (-903.413) * [-917.499] (-896.700) (-911.486) (-905.810) -- 0:02:37
      603000 -- (-902.715) (-899.769) [-905.364] (-906.766) * (-916.536) (-902.063) (-905.249) [-897.965] -- 0:02:37
      603500 -- (-905.615) (-898.863) [-895.628] (-897.904) * (-914.155) (-903.007) (-907.706) [-909.268] -- 0:02:37
      604000 -- (-913.543) (-899.682) [-900.901] (-903.831) * (-913.571) (-905.039) [-892.625] (-902.924) -- 0:02:36
      604500 -- (-914.645) (-905.846) (-908.882) [-898.170] * [-890.134] (-915.120) (-902.524) (-897.447) -- 0:02:37
      605000 -- (-901.918) (-906.347) (-898.640) [-900.909] * (-907.674) [-903.185] (-914.144) (-911.993) -- 0:02:36

      Average standard deviation of split frequencies: 0.012991

      605500 -- [-906.705] (-905.124) (-913.019) (-893.219) * [-898.656] (-912.183) (-903.548) (-926.029) -- 0:02:36
      606000 -- (-903.538) (-897.591) [-897.089] (-896.724) * [-888.979] (-912.868) (-910.209) (-907.821) -- 0:02:36
      606500 -- (-921.341) [-900.663] (-905.514) (-903.079) * [-889.403] (-914.999) (-900.046) (-908.383) -- 0:02:35
      607000 -- (-917.717) (-915.166) (-895.991) [-900.758] * (-903.725) (-927.514) [-894.644] (-904.406) -- 0:02:36
      607500 -- (-904.846) (-904.823) [-901.420] (-905.836) * [-896.925] (-902.527) (-902.149) (-906.986) -- 0:02:35
      608000 -- (-900.140) (-919.991) [-897.272] (-910.017) * (-895.834) (-912.016) [-909.301] (-905.815) -- 0:02:35
      608500 -- (-907.809) [-894.239] (-908.560) (-903.737) * [-891.523] (-900.932) (-901.905) (-914.097) -- 0:02:35
      609000 -- (-916.376) (-895.801) (-911.690) [-891.737] * [-903.714] (-911.918) (-898.202) (-915.674) -- 0:02:35
      609500 -- (-891.801) (-902.925) [-900.936] (-916.404) * [-903.421] (-910.912) (-898.378) (-903.992) -- 0:02:35
      610000 -- (-909.241) (-908.904) (-904.172) [-914.013] * (-915.759) (-912.128) (-906.576) [-901.772] -- 0:02:34

      Average standard deviation of split frequencies: 0.013007

      610500 -- (-901.856) (-910.223) (-893.224) [-903.621] * (-897.112) (-898.848) [-905.982] (-897.630) -- 0:02:34
      611000 -- [-889.725] (-901.074) (-906.051) (-911.850) * [-896.954] (-932.885) (-898.312) (-902.022) -- 0:02:34
      611500 -- [-892.865] (-912.133) (-899.762) (-907.492) * (-901.097) (-923.544) (-909.116) [-903.875] -- 0:02:34
      612000 -- [-904.475] (-901.448) (-893.504) (-900.671) * [-897.806] (-912.118) (-903.372) (-894.785) -- 0:02:34
      612500 -- (-914.517) (-903.193) (-896.154) [-897.904] * [-894.388] (-919.326) (-904.946) (-906.790) -- 0:02:33
      613000 -- (-914.246) [-892.765] (-907.268) (-896.971) * (-905.986) [-909.339] (-900.538) (-913.350) -- 0:02:33
      613500 -- [-907.073] (-905.560) (-902.981) (-910.545) * [-898.642] (-909.166) (-901.320) (-926.330) -- 0:02:33
      614000 -- (-912.361) [-905.649] (-903.642) (-901.343) * (-911.812) (-899.503) [-898.054] (-912.064) -- 0:02:33
      614500 -- [-891.936] (-893.975) (-912.903) (-896.380) * (-908.077) [-896.365] (-901.190) (-911.389) -- 0:02:33
      615000 -- (-905.886) [-906.121] (-915.264) (-910.342) * (-894.305) (-911.183) [-902.018] (-892.316) -- 0:02:32

      Average standard deviation of split frequencies: 0.013583

      615500 -- (-907.956) [-902.618] (-911.910) (-894.733) * (-903.021) (-902.844) (-902.708) [-890.060] -- 0:02:32
      616000 -- (-908.859) (-898.657) (-921.037) [-898.516] * (-907.082) (-898.610) (-912.187) [-895.478] -- 0:02:32
      616500 -- (-918.612) (-898.664) (-901.972) [-897.590] * (-907.170) (-897.916) [-905.608] (-914.529) -- 0:02:32
      617000 -- [-904.572] (-894.441) (-915.070) (-926.565) * (-912.999) [-888.885] (-912.072) (-902.768) -- 0:02:32
      617500 -- (-924.455) (-892.553) [-904.924] (-914.008) * (-905.642) [-894.569] (-917.298) (-901.660) -- 0:02:31
      618000 -- (-923.794) (-899.249) [-900.163] (-908.285) * [-900.482] (-905.069) (-909.375) (-900.776) -- 0:02:31
      618500 -- (-908.661) (-891.719) [-901.784] (-913.011) * (-905.818) (-910.536) (-905.391) [-907.903] -- 0:02:31
      619000 -- (-905.058) (-889.254) (-906.890) [-899.860] * [-900.939] (-911.811) (-909.097) (-901.733) -- 0:02:31
      619500 -- (-903.396) (-904.362) (-917.361) [-897.355] * (-900.868) (-898.146) [-902.868] (-927.494) -- 0:02:31
      620000 -- (-898.444) (-896.993) [-894.812] (-906.094) * (-899.876) [-889.298] (-902.496) (-908.397) -- 0:02:30

      Average standard deviation of split frequencies: 0.014165

      620500 -- (-914.804) [-892.480] (-906.958) (-898.037) * [-904.717] (-911.570) (-904.285) (-922.087) -- 0:02:30
      621000 -- (-917.920) (-908.607) [-903.687] (-903.050) * (-898.023) (-906.016) [-888.133] (-906.489) -- 0:02:30
      621500 -- (-911.211) (-905.807) (-903.887) [-898.414] * (-910.188) [-901.208] (-890.722) (-889.670) -- 0:02:30
      622000 -- (-898.799) (-906.255) [-908.522] (-913.935) * [-899.668] (-901.395) (-900.912) (-904.907) -- 0:02:30
      622500 -- [-895.046] (-896.877) (-894.813) (-907.108) * [-905.635] (-910.120) (-895.208) (-903.794) -- 0:02:29
      623000 -- [-911.182] (-894.358) (-890.633) (-912.312) * (-900.320) (-908.139) [-901.048] (-907.901) -- 0:02:29
      623500 -- (-899.022) (-906.012) (-907.431) [-906.017] * (-907.316) (-929.412) [-889.566] (-912.546) -- 0:02:29
      624000 -- (-903.649) (-894.973) (-902.577) [-891.855] * [-903.809] (-908.186) (-900.742) (-907.617) -- 0:02:29
      624500 -- (-909.286) [-894.394] (-900.888) (-920.315) * [-894.563] (-904.157) (-913.310) (-908.016) -- 0:02:29
      625000 -- (-917.388) (-902.218) (-896.234) [-897.755] * (-896.613) (-902.106) [-893.966] (-911.267) -- 0:02:28

      Average standard deviation of split frequencies: 0.013969

      625500 -- (-914.196) (-899.035) [-897.540] (-905.577) * (-893.414) [-900.458] (-916.651) (-894.448) -- 0:02:28
      626000 -- (-917.272) [-896.637] (-902.222) (-903.413) * (-908.055) (-903.802) (-912.812) [-891.670] -- 0:02:28
      626500 -- (-919.344) [-897.527] (-900.641) (-908.702) * [-902.357] (-903.290) (-910.383) (-892.362) -- 0:02:28
      627000 -- (-916.197) [-907.238] (-920.964) (-911.102) * (-908.187) (-907.273) (-900.935) [-885.969] -- 0:02:28
      627500 -- (-912.006) (-900.351) [-896.119] (-905.520) * (-913.805) [-899.871] (-894.827) (-898.972) -- 0:02:27
      628000 -- [-901.478] (-916.654) (-901.057) (-902.570) * (-904.018) (-906.653) [-891.734] (-895.773) -- 0:02:27
      628500 -- (-891.071) (-901.168) [-898.543] (-902.852) * (-930.130) (-904.568) (-900.747) [-888.707] -- 0:02:27
      629000 -- (-880.379) [-900.048] (-907.798) (-908.428) * [-902.859] (-914.781) (-905.885) (-893.252) -- 0:02:27
      629500 -- [-885.576] (-905.939) (-914.769) (-911.498) * (-918.639) [-903.070] (-905.003) (-901.644) -- 0:02:27
      630000 -- (-884.065) (-921.467) [-893.895] (-909.712) * [-895.656] (-897.901) (-901.143) (-903.445) -- 0:02:26

      Average standard deviation of split frequencies: 0.013903

      630500 -- (-901.092) (-895.703) [-896.036] (-916.495) * (-894.996) (-902.632) (-895.028) [-894.830] -- 0:02:26
      631000 -- (-908.004) (-909.457) [-901.803] (-925.829) * (-900.769) (-901.403) [-901.424] (-912.274) -- 0:02:26
      631500 -- [-890.786] (-910.788) (-899.405) (-908.022) * (-916.629) [-897.546] (-911.191) (-898.983) -- 0:02:26
      632000 -- (-914.570) (-901.374) [-891.371] (-902.715) * (-912.907) [-898.962] (-904.470) (-912.556) -- 0:02:26
      632500 -- (-908.396) (-900.784) [-892.059] (-912.078) * (-922.796) [-912.570] (-919.744) (-909.190) -- 0:02:25
      633000 -- (-900.444) (-897.118) (-899.913) [-886.622] * (-902.722) [-902.999] (-902.335) (-906.472) -- 0:02:25
      633500 -- (-898.649) [-901.983] (-895.280) (-911.737) * (-908.325) (-903.562) (-903.041) [-893.776] -- 0:02:25
      634000 -- (-915.472) (-919.257) (-897.371) [-887.626] * [-900.419] (-910.889) (-905.766) (-904.373) -- 0:02:25
      634500 -- (-899.956) [-899.719] (-900.381) (-905.323) * (-914.399) [-899.957] (-897.081) (-921.468) -- 0:02:25
      635000 -- (-902.604) (-887.281) [-910.391] (-897.190) * (-902.263) [-915.774] (-899.513) (-900.178) -- 0:02:24

      Average standard deviation of split frequencies: 0.014379

      635500 -- (-902.312) (-900.064) (-924.745) [-895.221] * (-913.536) (-915.814) [-889.439] (-916.600) -- 0:02:24
      636000 -- (-901.042) (-913.249) (-915.093) [-899.346] * (-911.271) (-903.753) [-900.231] (-907.973) -- 0:02:24
      636500 -- [-892.674] (-906.598) (-905.766) (-899.253) * (-909.269) [-891.386] (-900.727) (-885.573) -- 0:02:24
      637000 -- [-890.679] (-906.849) (-901.363) (-900.211) * (-919.458) (-909.554) [-897.596] (-896.557) -- 0:02:24
      637500 -- (-898.478) (-911.284) [-896.251] (-920.999) * (-907.927) (-905.982) [-889.457] (-901.803) -- 0:02:23
      638000 -- (-899.772) (-932.705) (-900.302) [-894.681] * (-911.253) (-906.766) [-894.782] (-894.772) -- 0:02:23
      638500 -- (-905.197) (-903.370) (-918.597) [-900.504] * (-902.212) [-896.637] (-896.595) (-911.931) -- 0:02:23
      639000 -- [-902.799] (-903.486) (-904.804) (-902.613) * (-897.354) [-893.056] (-917.843) (-916.943) -- 0:02:23
      639500 -- (-906.921) (-918.136) [-894.941] (-908.283) * (-908.155) (-900.356) (-908.354) [-898.542] -- 0:02:23
      640000 -- (-919.911) (-903.053) (-900.792) [-891.929] * (-905.786) [-892.509] (-895.322) (-907.639) -- 0:02:22

      Average standard deviation of split frequencies: 0.014422

      640500 -- (-917.370) (-902.831) [-892.089] (-894.092) * (-893.975) [-890.725] (-917.335) (-913.486) -- 0:02:22
      641000 -- (-908.894) [-899.391] (-919.978) (-888.815) * (-903.477) [-894.326] (-902.725) (-918.715) -- 0:02:22
      641500 -- (-903.336) (-902.929) (-921.110) [-886.014] * (-888.037) (-913.600) [-891.960] (-918.617) -- 0:02:22
      642000 -- [-892.170] (-906.140) (-903.131) (-886.645) * [-890.749] (-906.235) (-905.217) (-910.850) -- 0:02:22
      642500 -- (-890.777) (-897.718) (-911.862) [-895.252] * (-904.210) (-884.644) (-897.829) [-896.626] -- 0:02:21
      643000 -- (-900.312) [-891.058] (-925.992) (-900.665) * (-905.065) [-885.903] (-893.806) (-897.056) -- 0:02:21
      643500 -- (-895.475) (-910.890) (-916.639) [-898.614] * (-918.342) (-912.386) [-889.416] (-903.765) -- 0:02:21
      644000 -- [-894.972] (-917.237) (-901.797) (-900.463) * (-908.939) [-910.059] (-901.759) (-909.781) -- 0:02:21
      644500 -- (-910.546) [-889.903] (-906.699) (-909.548) * (-905.684) [-904.851] (-895.856) (-901.477) -- 0:02:21
      645000 -- (-915.145) [-885.506] (-918.859) (-906.536) * (-905.457) (-911.746) (-896.738) [-899.010] -- 0:02:20

      Average standard deviation of split frequencies: 0.014412

      645500 -- [-893.687] (-887.197) (-909.357) (-922.408) * (-895.223) (-900.806) (-920.906) [-897.273] -- 0:02:20
      646000 -- [-903.304] (-891.128) (-905.578) (-917.124) * (-896.117) (-917.978) [-906.902] (-902.583) -- 0:02:20
      646500 -- (-906.570) (-904.103) [-898.296] (-921.483) * (-911.646) (-899.187) [-904.822] (-900.528) -- 0:02:20
      647000 -- [-899.561] (-893.399) (-921.007) (-910.655) * (-907.186) [-892.852] (-906.981) (-909.129) -- 0:02:20
      647500 -- [-894.955] (-895.236) (-905.970) (-899.677) * [-889.462] (-905.082) (-899.569) (-926.560) -- 0:02:19
      648000 -- (-913.444) [-886.158] (-917.047) (-896.322) * (-898.783) (-896.713) [-897.502] (-914.162) -- 0:02:19
      648500 -- [-894.582] (-895.296) (-911.789) (-914.915) * [-894.056] (-900.918) (-916.006) (-922.757) -- 0:02:19
      649000 -- [-898.058] (-897.024) (-908.040) (-904.713) * [-894.581] (-914.828) (-910.905) (-894.076) -- 0:02:19
      649500 -- (-894.591) [-896.679] (-919.579) (-908.238) * (-900.489) (-895.319) [-894.924] (-906.082) -- 0:02:19
      650000 -- (-912.528) (-911.603) (-908.252) [-901.230] * (-899.742) (-921.225) [-901.635] (-903.976) -- 0:02:18

      Average standard deviation of split frequencies: 0.014997

      650500 -- (-922.593) (-901.260) [-906.511] (-893.988) * (-917.644) (-901.700) (-915.722) [-898.921] -- 0:02:18
      651000 -- (-910.568) (-904.733) (-913.558) [-917.154] * (-894.915) [-896.168] (-898.987) (-896.465) -- 0:02:18
      651500 -- (-906.069) (-896.647) (-892.371) [-911.612] * (-919.260) [-890.989] (-905.306) (-894.492) -- 0:02:18
      652000 -- [-898.801] (-906.899) (-902.115) (-912.949) * (-913.378) (-895.089) (-898.789) [-897.657] -- 0:02:18
      652500 -- (-902.631) [-897.031] (-914.769) (-904.599) * (-911.351) (-913.322) [-892.286] (-891.756) -- 0:02:17
      653000 -- (-915.230) [-892.340] (-901.720) (-901.015) * (-899.724) (-910.147) [-897.636] (-905.459) -- 0:02:17
      653500 -- [-900.986] (-895.957) (-925.147) (-896.204) * (-897.280) (-907.232) [-900.582] (-903.597) -- 0:02:17
      654000 -- (-897.709) (-911.851) [-899.596] (-919.945) * [-900.091] (-915.349) (-900.230) (-927.797) -- 0:02:17
      654500 -- (-915.052) (-911.123) (-902.124) [-894.378] * (-902.063) (-915.047) [-903.387] (-909.736) -- 0:02:17
      655000 -- (-905.015) (-910.711) [-886.246] (-903.679) * (-914.404) (-921.614) [-894.043] (-908.317) -- 0:02:16

      Average standard deviation of split frequencies: 0.013977

      655500 -- [-903.317] (-910.082) (-901.449) (-898.105) * [-905.727] (-916.874) (-908.669) (-931.206) -- 0:02:16
      656000 -- [-902.274] (-892.234) (-917.574) (-917.687) * (-915.592) (-914.534) [-903.480] (-910.504) -- 0:02:16
      656500 -- (-907.976) [-896.474] (-910.186) (-919.600) * (-901.784) (-901.342) (-917.195) [-906.928] -- 0:02:16
      657000 -- (-917.132) (-911.260) [-888.373] (-915.316) * (-900.422) (-911.480) (-918.420) [-902.154] -- 0:02:16
      657500 -- (-920.070) (-901.672) (-894.373) [-900.737] * (-898.311) (-899.173) [-895.301] (-905.787) -- 0:02:15
      658000 -- [-894.615] (-905.323) (-906.307) (-910.032) * [-902.919] (-903.656) (-909.379) (-909.785) -- 0:02:15
      658500 -- [-903.614] (-897.113) (-918.081) (-912.575) * (-904.003) (-912.188) [-898.340] (-908.225) -- 0:02:15
      659000 -- (-901.967) (-912.623) [-898.152] (-898.785) * (-907.000) (-904.069) (-922.284) [-900.384] -- 0:02:15
      659500 -- [-884.190] (-906.625) (-895.258) (-899.056) * (-898.267) (-911.097) (-927.240) [-893.547] -- 0:02:15
      660000 -- (-912.008) (-892.449) (-906.874) [-885.242] * (-907.076) (-909.624) (-913.964) [-890.066] -- 0:02:14

      Average standard deviation of split frequencies: 0.013414

      660500 -- [-895.806] (-907.337) (-899.307) (-920.470) * [-897.709] (-911.798) (-907.972) (-890.274) -- 0:02:14
      661000 -- (-903.241) [-901.755] (-920.958) (-908.064) * (-905.355) (-910.630) [-902.359] (-899.874) -- 0:02:14
      661500 -- (-911.646) (-911.166) [-898.745] (-910.418) * (-908.183) [-893.298] (-891.916) (-894.642) -- 0:02:14
      662000 -- (-895.977) (-922.026) (-897.753) [-897.709] * [-900.650] (-916.527) (-903.921) (-907.044) -- 0:02:14
      662500 -- [-892.542] (-910.458) (-902.233) (-890.224) * (-885.364) (-913.323) (-913.194) [-898.051] -- 0:02:13
      663000 -- [-897.000] (-902.455) (-894.563) (-911.040) * [-898.886] (-916.774) (-914.455) (-897.458) -- 0:02:13
      663500 -- [-913.897] (-907.542) (-896.777) (-905.520) * (-909.382) (-913.611) [-901.200] (-894.932) -- 0:02:13
      664000 -- [-901.561] (-906.964) (-899.578) (-905.941) * (-904.291) (-892.393) (-911.698) [-890.602] -- 0:02:13
      664500 -- [-900.272] (-905.061) (-897.228) (-905.146) * [-903.536] (-897.799) (-916.335) (-896.147) -- 0:02:13
      665000 -- (-931.084) (-907.826) [-907.336] (-896.681) * (-906.188) (-907.266) (-906.894) [-899.566] -- 0:02:12

      Average standard deviation of split frequencies: 0.013590

      665500 -- (-917.245) (-896.206) [-893.508] (-907.930) * (-917.471) (-904.943) [-902.655] (-914.817) -- 0:02:12
      666000 -- (-917.271) (-904.832) (-897.180) [-908.886] * (-904.968) (-910.141) (-900.957) [-898.288] -- 0:02:12
      666500 -- (-908.203) (-900.878) [-905.465] (-913.217) * [-888.483] (-909.383) (-903.695) (-900.832) -- 0:02:12
      667000 -- (-906.192) (-908.894) [-895.401] (-907.684) * (-896.637) (-913.323) [-903.357] (-905.221) -- 0:02:12
      667500 -- (-908.640) (-908.529) (-903.818) [-897.735] * (-907.261) (-907.499) [-889.005] (-895.046) -- 0:02:12
      668000 -- (-911.437) [-898.584] (-904.863) (-905.080) * (-926.048) (-908.285) [-899.237] (-902.967) -- 0:02:11
      668500 -- (-908.784) [-894.914] (-917.402) (-901.235) * (-905.489) (-914.664) [-898.426] (-893.819) -- 0:02:11
      669000 -- (-918.753) [-894.970] (-923.267) (-903.409) * (-905.948) (-898.913) [-897.951] (-908.223) -- 0:02:11
      669500 -- (-911.799) (-926.831) [-908.136] (-903.246) * (-906.380) (-899.479) (-901.096) [-910.291] -- 0:02:11
      670000 -- (-903.846) (-915.249) [-895.896] (-898.530) * (-902.580) (-903.383) [-905.201] (-898.196) -- 0:02:11

      Average standard deviation of split frequencies: 0.013144

      670500 -- [-906.386] (-903.130) (-902.463) (-920.719) * (-908.150) [-893.563] (-918.787) (-910.910) -- 0:02:10
      671000 -- [-899.806] (-907.706) (-903.656) (-903.431) * (-908.829) [-890.225] (-899.283) (-907.466) -- 0:02:10
      671500 -- [-904.380] (-921.983) (-906.258) (-902.277) * (-919.647) (-893.979) [-891.464] (-909.385) -- 0:02:10
      672000 -- (-927.069) [-903.384] (-912.725) (-913.491) * [-894.389] (-909.583) (-897.014) (-906.827) -- 0:02:10
      672500 -- (-904.410) [-895.743] (-905.617) (-906.164) * (-897.435) (-918.935) (-907.554) [-898.180] -- 0:02:10
      673000 -- (-905.776) [-884.428] (-912.455) (-909.086) * (-906.901) (-914.364) [-902.508] (-906.322) -- 0:02:09
      673500 -- (-901.045) (-910.106) (-901.473) [-897.642] * (-911.993) (-907.145) (-912.667) [-894.834] -- 0:02:09
      674000 -- (-901.124) (-904.248) (-913.684) [-892.875] * (-916.165) [-897.217] (-905.466) (-894.682) -- 0:02:09
      674500 -- (-900.958) (-906.260) [-901.608] (-905.511) * (-903.066) (-906.249) [-902.872] (-897.574) -- 0:02:09
      675000 -- [-904.304] (-906.380) (-921.946) (-897.050) * (-905.396) [-902.202] (-907.622) (-893.581) -- 0:02:09

      Average standard deviation of split frequencies: 0.013284

      675500 -- (-916.467) [-901.155] (-922.068) (-886.962) * (-894.526) (-914.576) (-915.491) [-899.906] -- 0:02:08
      676000 -- [-897.512] (-911.526) (-904.705) (-902.551) * (-900.705) [-904.167] (-921.667) (-895.065) -- 0:02:08
      676500 -- [-897.832] (-904.334) (-905.817) (-913.342) * (-893.599) (-905.485) (-914.595) [-888.788] -- 0:02:08
      677000 -- (-885.981) (-895.097) [-897.541] (-932.264) * (-893.440) (-910.644) (-904.932) [-895.505] -- 0:02:08
      677500 -- [-891.809] (-894.894) (-918.497) (-892.017) * (-900.903) (-908.822) [-908.126] (-906.765) -- 0:02:08
      678000 -- (-894.819) [-893.899] (-892.555) (-901.616) * (-893.245) [-900.427] (-912.337) (-903.058) -- 0:02:08
      678500 -- (-906.780) (-911.295) [-888.866] (-905.305) * [-905.871] (-898.882) (-927.827) (-911.526) -- 0:02:07
      679000 -- (-905.995) (-911.549) (-904.751) [-896.755] * (-910.471) [-898.785] (-913.459) (-906.997) -- 0:02:07
      679500 -- [-893.917] (-905.483) (-908.813) (-899.378) * (-910.117) (-904.503) (-918.308) [-905.207] -- 0:02:07
      680000 -- [-889.669] (-901.913) (-904.818) (-896.011) * (-919.045) (-899.830) (-916.935) [-891.687] -- 0:02:07

      Average standard deviation of split frequencies: 0.013193

      680500 -- (-900.750) (-918.456) (-910.737) [-901.828] * (-931.249) (-893.393) [-903.398] (-898.072) -- 0:02:07
      681000 -- (-904.215) (-915.130) [-907.446] (-915.779) * (-915.059) [-894.847] (-902.092) (-909.424) -- 0:02:06
      681500 -- (-909.888) [-901.020] (-917.605) (-919.265) * (-917.585) (-908.530) [-901.924] (-900.730) -- 0:02:06
      682000 -- (-921.443) (-900.794) (-896.935) [-909.300] * [-914.123] (-920.907) (-891.367) (-906.281) -- 0:02:06
      682500 -- (-898.600) [-898.490] (-908.197) (-900.492) * (-902.007) (-909.604) [-883.325] (-908.662) -- 0:02:06
      683000 -- [-901.944] (-912.755) (-913.151) (-896.519) * (-906.681) (-897.885) [-885.552] (-908.477) -- 0:02:06
      683500 -- (-907.493) [-904.337] (-905.016) (-889.053) * (-912.357) (-900.518) (-897.277) [-897.296] -- 0:02:05
      684000 -- (-905.993) (-899.780) (-899.982) [-894.171] * (-898.712) [-901.466] (-902.403) (-905.661) -- 0:02:05
      684500 -- (-899.034) (-902.743) (-902.775) [-900.101] * (-895.214) (-933.040) [-891.622] (-899.927) -- 0:02:05
      685000 -- (-899.077) (-899.852) (-906.958) [-887.851] * [-895.514] (-917.710) (-899.901) (-910.627) -- 0:02:05

      Average standard deviation of split frequencies: 0.013434

      685500 -- (-924.571) [-905.335] (-895.114) (-898.792) * [-894.488] (-906.665) (-903.270) (-904.229) -- 0:02:05
      686000 -- (-898.485) (-902.697) [-895.472] (-899.039) * (-893.976) (-897.523) (-912.438) [-891.651] -- 0:02:04
      686500 -- (-913.897) (-910.386) [-897.814] (-905.735) * [-895.108] (-912.250) (-908.653) (-898.984) -- 0:02:04
      687000 -- (-918.460) (-911.033) (-901.494) [-904.956] * [-902.600] (-889.745) (-904.729) (-915.279) -- 0:02:04
      687500 -- (-922.918) (-908.595) [-913.219] (-901.812) * (-898.493) [-890.410] (-900.656) (-908.113) -- 0:02:04
      688000 -- (-925.568) (-921.661) (-903.683) [-906.190] * (-899.185) (-897.652) [-895.982] (-910.156) -- 0:02:04
      688500 -- (-917.966) [-896.927] (-911.204) (-910.790) * [-896.687] (-916.040) (-908.575) (-906.023) -- 0:02:03
      689000 -- (-909.329) [-896.698] (-902.612) (-908.761) * (-906.946) (-901.465) (-918.876) [-900.383] -- 0:02:03
      689500 -- [-898.797] (-893.569) (-914.820) (-892.373) * (-902.192) (-908.760) [-898.563] (-905.758) -- 0:02:03
      690000 -- (-910.468) (-888.207) (-902.103) [-887.604] * (-899.391) (-925.775) (-896.376) [-897.067] -- 0:02:03

      Average standard deviation of split frequencies: 0.013617

      690500 -- (-905.513) (-906.809) (-922.926) [-898.643] * (-892.005) (-922.438) [-903.134] (-891.720) -- 0:02:03
      691000 -- (-915.992) [-901.930] (-901.827) (-904.142) * (-909.205) (-911.441) [-899.220] (-909.557) -- 0:02:02
      691500 -- (-901.033) (-913.368) (-921.693) [-894.718] * (-899.028) (-911.669) (-925.862) [-897.850] -- 0:02:02
      692000 -- (-902.389) [-896.081] (-919.905) (-909.696) * [-897.166] (-903.715) (-910.510) (-895.781) -- 0:02:02
      692500 -- (-901.589) (-906.341) (-907.542) [-899.674] * [-894.843] (-892.199) (-921.600) (-916.511) -- 0:02:02
      693000 -- (-906.413) (-915.715) (-919.702) [-902.905] * [-900.611] (-909.168) (-918.187) (-909.864) -- 0:02:02
      693500 -- (-911.159) [-894.581] (-903.182) (-909.564) * (-899.215) (-895.341) (-899.623) [-889.732] -- 0:02:01
      694000 -- (-913.967) (-894.674) [-883.126] (-902.870) * (-909.526) (-900.805) [-890.217] (-904.484) -- 0:02:01
      694500 -- [-903.604] (-913.355) (-900.148) (-905.687) * (-913.593) (-902.270) (-899.959) [-891.186] -- 0:02:01
      695000 -- (-913.731) (-900.170) (-905.375) [-895.773] * (-911.478) [-893.275] (-910.535) (-899.035) -- 0:02:01

      Average standard deviation of split frequencies: 0.013580

      695500 -- (-900.623) [-897.900] (-906.454) (-915.229) * [-899.210] (-893.822) (-898.860) (-901.343) -- 0:02:01
      696000 -- (-906.755) (-899.023) [-896.945] (-906.083) * [-907.571] (-904.313) (-910.617) (-905.785) -- 0:02:00
      696500 -- (-903.575) [-887.955] (-907.466) (-900.090) * [-893.343] (-903.466) (-927.694) (-902.154) -- 0:02:00
      697000 -- (-913.257) (-897.296) (-894.263) [-894.022] * (-911.491) (-909.934) (-908.640) [-899.142] -- 0:02:00
      697500 -- (-900.309) [-895.865] (-900.296) (-911.406) * (-899.913) [-902.596] (-906.718) (-903.145) -- 0:02:00
      698000 -- (-912.463) (-896.669) [-907.305] (-912.024) * (-892.875) (-907.343) [-897.238] (-906.037) -- 0:02:00
      698500 -- (-913.643) (-915.438) [-899.437] (-904.670) * [-900.384] (-919.390) (-892.496) (-901.602) -- 0:01:59
      699000 -- [-900.123] (-911.146) (-904.781) (-898.409) * (-901.387) [-897.778] (-896.817) (-905.294) -- 0:01:59
      699500 -- [-894.482] (-917.747) (-901.292) (-916.753) * (-896.477) (-903.442) [-905.385] (-915.637) -- 0:01:59
      700000 -- [-895.370] (-912.376) (-894.703) (-911.586) * [-899.455] (-910.406) (-908.328) (-896.742) -- 0:01:59

      Average standard deviation of split frequencies: 0.013658

      700500 -- (-901.460) (-899.747) [-894.420] (-927.477) * (-899.565) [-891.255] (-898.117) (-909.452) -- 0:01:59
      701000 -- (-906.261) (-900.089) [-899.977] (-899.349) * (-903.486) (-899.195) [-901.406] (-907.349) -- 0:01:59
      701500 -- [-883.238] (-903.307) (-903.769) (-901.487) * (-915.073) [-903.671] (-899.623) (-911.645) -- 0:01:58
      702000 -- (-897.967) (-911.389) [-903.473] (-918.000) * (-904.722) (-919.227) (-894.680) [-907.938] -- 0:01:58
      702500 -- (-909.371) (-898.383) [-902.336] (-914.579) * (-900.861) (-931.887) (-895.923) [-909.615] -- 0:01:58
      703000 -- (-907.208) (-897.874) [-904.034] (-915.129) * (-908.572) (-916.187) [-901.493] (-906.680) -- 0:01:58
      703500 -- (-909.875) (-899.809) (-909.419) [-894.141] * (-902.508) (-903.885) (-895.514) [-899.806] -- 0:01:58
      704000 -- (-905.249) (-903.218) (-913.122) [-894.160] * (-895.693) (-911.773) (-893.241) [-894.486] -- 0:01:57
      704500 -- (-905.405) (-911.931) [-899.047] (-892.268) * (-907.793) (-904.412) [-891.792] (-903.502) -- 0:01:57
      705000 -- (-899.880) [-905.030] (-927.347) (-915.838) * (-919.262) [-897.020] (-902.234) (-913.554) -- 0:01:57

      Average standard deviation of split frequencies: 0.013822

      705500 -- [-896.933] (-917.096) (-914.813) (-902.442) * [-905.151] (-899.301) (-913.110) (-909.613) -- 0:01:57
      706000 -- (-908.515) [-900.866] (-921.606) (-894.262) * (-903.519) (-912.034) [-902.733] (-905.526) -- 0:01:57
      706500 -- (-901.714) (-905.080) [-901.564] (-901.397) * (-902.328) (-920.316) (-904.309) [-897.598] -- 0:01:56
      707000 -- (-907.108) (-909.370) (-902.904) [-900.308] * (-895.557) (-907.585) (-911.494) [-902.470] -- 0:01:56
      707500 -- (-913.305) (-898.235) [-900.259] (-897.088) * (-907.332) (-902.908) (-908.421) [-909.274] -- 0:01:56
      708000 -- (-903.324) (-919.921) [-893.499] (-897.707) * (-903.266) (-909.502) (-896.928) [-904.762] -- 0:01:56
      708500 -- (-904.693) (-914.842) [-887.582] (-897.319) * (-913.161) (-901.509) (-902.004) [-905.115] -- 0:01:56
      709000 -- (-910.731) [-894.798] (-892.654) (-900.864) * (-923.039) (-901.279) (-909.678) [-895.408] -- 0:01:55
      709500 -- (-912.747) [-897.112] (-922.739) (-921.159) * (-915.600) (-912.536) (-895.878) [-915.719] -- 0:01:55
      710000 -- (-912.489) [-902.408] (-917.246) (-911.310) * (-918.143) (-905.856) (-901.414) [-898.038] -- 0:01:55

      Average standard deviation of split frequencies: 0.013499

      710500 -- (-930.742) [-894.985] (-911.079) (-907.848) * (-908.147) (-917.067) [-904.020] (-903.451) -- 0:01:55
      711000 -- [-895.857] (-919.738) (-924.530) (-900.111) * [-901.425] (-900.846) (-905.820) (-906.604) -- 0:01:55
      711500 -- [-897.425] (-897.846) (-906.540) (-917.214) * [-903.355] (-894.475) (-908.565) (-897.857) -- 0:01:54
      712000 -- (-914.332) (-903.516) [-892.117] (-910.904) * (-909.800) (-896.738) (-912.015) [-890.216] -- 0:01:54
      712500 -- (-916.614) [-906.184] (-910.908) (-908.690) * (-911.771) (-892.715) (-901.074) [-892.213] -- 0:01:54
      713000 -- (-913.582) [-890.175] (-909.300) (-896.212) * (-918.591) [-897.837] (-910.756) (-907.936) -- 0:01:54
      713500 -- [-901.268] (-928.990) (-930.341) (-907.538) * [-900.628] (-903.974) (-901.085) (-918.663) -- 0:01:54
      714000 -- (-901.326) (-909.663) (-913.755) [-909.356] * (-908.657) (-903.780) (-903.987) [-895.630] -- 0:01:53
      714500 -- [-898.592] (-912.568) (-911.877) (-898.317) * (-897.192) [-895.904] (-910.006) (-902.726) -- 0:01:53
      715000 -- (-912.175) (-915.974) (-906.600) [-900.591] * [-900.959] (-897.139) (-891.460) (-909.266) -- 0:01:53

      Average standard deviation of split frequencies: 0.012773

      715500 -- (-899.108) (-903.511) (-901.593) [-896.756] * (-911.222) (-907.944) [-908.256] (-912.619) -- 0:01:53
      716000 -- (-893.864) (-903.660) [-902.759] (-919.373) * (-940.144) [-893.193] (-895.671) (-893.713) -- 0:01:53
      716500 -- (-910.124) (-899.001) [-892.773] (-904.535) * (-923.054) (-908.339) (-899.941) [-891.740] -- 0:01:52
      717000 -- (-900.916) (-906.692) [-889.398] (-914.726) * (-915.393) (-931.462) (-895.958) [-897.227] -- 0:01:52
      717500 -- (-905.407) (-905.862) (-890.285) [-903.615] * (-903.752) (-907.660) (-897.377) [-904.101] -- 0:01:52
      718000 -- (-936.577) (-911.661) (-886.047) [-883.808] * (-897.076) (-907.616) (-903.959) [-893.344] -- 0:01:52
      718500 -- (-929.013) (-911.266) (-891.286) [-896.651] * (-924.905) (-898.891) (-907.987) [-898.170] -- 0:01:52
      719000 -- [-904.820] (-915.724) (-904.580) (-922.325) * (-911.240) (-917.413) [-898.859] (-913.359) -- 0:01:51
      719500 -- (-910.287) [-901.179] (-916.707) (-900.786) * (-920.693) (-915.485) (-930.158) [-905.456] -- 0:01:51
      720000 -- (-901.559) [-888.222] (-922.468) (-902.103) * (-909.259) [-904.453] (-917.806) (-930.206) -- 0:01:51

      Average standard deviation of split frequencies: 0.012298

      720500 -- (-906.267) (-900.240) (-909.278) [-900.861] * (-917.141) [-889.527] (-898.422) (-913.073) -- 0:01:51
      721000 -- (-905.574) (-903.486) (-913.098) [-896.311] * (-902.283) (-899.105) [-889.558] (-897.411) -- 0:01:51
      721500 -- (-904.467) [-896.149] (-906.723) (-895.736) * [-900.176] (-909.930) (-907.531) (-897.909) -- 0:01:50
      722000 -- (-906.715) (-924.443) (-912.068) [-890.169] * (-903.146) (-887.948) [-905.160] (-915.606) -- 0:01:50
      722500 -- (-917.052) (-915.913) (-896.683) [-906.259] * [-897.018] (-898.496) (-904.229) (-908.788) -- 0:01:50
      723000 -- (-908.247) (-918.944) [-906.955] (-914.822) * [-901.551] (-899.965) (-908.508) (-918.138) -- 0:01:50
      723500 -- [-889.914] (-909.073) (-893.505) (-916.851) * (-908.999) (-915.987) (-908.212) [-889.242] -- 0:01:50
      724000 -- [-900.785] (-901.990) (-907.659) (-908.085) * (-899.196) (-922.995) (-909.143) [-904.508] -- 0:01:49
      724500 -- (-904.598) (-906.217) (-897.673) [-893.604] * (-902.548) (-933.005) (-907.674) [-893.936] -- 0:01:49
      725000 -- (-900.709) [-896.846] (-904.034) (-913.053) * [-897.762] (-911.119) (-907.082) (-905.799) -- 0:01:49

      Average standard deviation of split frequencies: 0.012175

      725500 -- [-903.719] (-904.368) (-901.515) (-914.274) * [-894.264] (-902.826) (-924.438) (-894.382) -- 0:01:49
      726000 -- [-897.193] (-903.046) (-905.624) (-889.945) * (-898.921) [-899.711] (-910.000) (-897.172) -- 0:01:49
      726500 -- (-897.040) [-900.346] (-903.256) (-889.909) * (-907.325) (-900.187) (-913.797) [-893.858] -- 0:01:48
      727000 -- (-907.518) (-911.789) (-903.351) [-892.818] * (-901.194) [-899.720] (-904.061) (-916.419) -- 0:01:48
      727500 -- (-897.241) (-903.385) (-927.026) [-894.539] * [-896.492] (-898.909) (-903.798) (-913.029) -- 0:01:48
      728000 -- (-907.906) (-899.827) (-910.089) [-895.137] * (-908.095) (-909.039) [-907.268] (-904.094) -- 0:01:48
      728500 -- (-905.193) (-909.900) [-896.638] (-904.826) * [-894.104] (-919.047) (-910.278) (-905.061) -- 0:01:48
      729000 -- (-907.709) (-908.767) [-898.257] (-923.627) * (-896.806) (-905.098) [-892.230] (-902.009) -- 0:01:47
      729500 -- (-905.112) [-902.538] (-912.105) (-914.588) * (-890.055) (-907.572) [-896.596] (-897.175) -- 0:01:47
      730000 -- (-917.674) [-907.162] (-905.533) (-916.092) * (-901.245) (-921.152) [-898.530] (-912.227) -- 0:01:47

      Average standard deviation of split frequencies: 0.011774

      730500 -- (-896.705) (-900.890) [-897.901] (-906.659) * (-895.382) (-926.008) (-906.387) [-886.696] -- 0:01:47
      731000 -- (-905.776) [-892.481] (-893.562) (-897.507) * (-891.754) (-922.964) [-907.908] (-902.534) -- 0:01:47
      731500 -- (-905.935) [-904.686] (-899.842) (-916.236) * (-909.505) (-903.936) [-899.980] (-905.780) -- 0:01:46
      732000 -- (-905.282) (-899.812) (-900.274) [-890.284] * (-902.936) [-903.052] (-896.185) (-913.803) -- 0:01:46
      732500 -- (-896.728) (-919.265) [-900.066] (-905.408) * [-904.306] (-903.134) (-897.796) (-905.125) -- 0:01:46
      733000 -- (-901.015) [-903.479] (-898.877) (-906.150) * [-899.530] (-899.815) (-902.780) (-908.164) -- 0:01:46
      733500 -- [-894.113] (-907.789) (-906.786) (-903.187) * (-898.287) (-899.338) (-893.309) [-898.240] -- 0:01:46
      734000 -- (-906.807) (-900.369) (-916.357) [-899.221] * (-903.333) (-913.004) (-907.819) [-897.663] -- 0:01:45
      734500 -- (-911.117) [-909.765] (-907.715) (-897.515) * (-898.028) (-913.417) [-899.447] (-891.565) -- 0:01:45
      735000 -- (-901.217) (-904.565) (-905.325) [-891.362] * (-893.724) [-890.943] (-907.017) (-913.286) -- 0:01:45

      Average standard deviation of split frequencies: 0.011913

      735500 -- (-920.075) (-919.564) (-891.803) [-883.744] * (-907.644) [-898.335] (-900.422) (-904.873) -- 0:01:45
      736000 -- (-905.601) (-909.188) [-891.560] (-910.491) * (-910.450) (-898.879) (-898.145) [-906.192] -- 0:01:45
      736500 -- [-908.906] (-914.277) (-898.348) (-897.092) * (-913.436) (-894.262) [-902.689] (-908.249) -- 0:01:44
      737000 -- [-909.388] (-899.363) (-909.392) (-902.142) * [-894.231] (-900.237) (-908.534) (-911.241) -- 0:01:44
      737500 -- (-910.095) (-904.321) (-905.041) [-896.650] * (-909.520) (-892.533) [-906.322] (-916.731) -- 0:01:44
      738000 -- (-902.937) (-907.138) [-898.077] (-913.263) * (-907.848) (-895.397) (-897.684) [-896.667] -- 0:01:44
      738500 -- (-906.350) [-894.303] (-892.906) (-909.142) * (-911.532) (-890.259) [-907.916] (-897.834) -- 0:01:44
      739000 -- (-913.459) [-901.645] (-898.858) (-903.740) * (-898.555) [-894.684] (-908.200) (-926.021) -- 0:01:43
      739500 -- (-903.243) (-905.707) (-915.605) [-897.530] * (-896.648) (-911.886) (-896.613) [-905.996] -- 0:01:43
      740000 -- [-899.066] (-908.642) (-913.583) (-902.733) * [-898.868] (-925.129) (-898.773) (-900.111) -- 0:01:43

      Average standard deviation of split frequencies: 0.011711

      740500 -- [-891.668] (-907.120) (-903.836) (-914.667) * (-905.781) (-906.909) [-901.435] (-898.065) -- 0:01:43
      741000 -- (-907.166) (-909.789) [-903.233] (-921.296) * [-897.617] (-913.323) (-911.228) (-908.496) -- 0:01:43
      741500 -- (-915.090) (-909.431) [-910.830] (-890.150) * (-903.440) (-905.639) (-903.284) [-899.645] -- 0:01:42
      742000 -- (-908.729) (-888.850) (-913.199) [-898.042] * (-896.504) (-897.900) [-897.978] (-907.933) -- 0:01:42
      742500 -- (-919.968) [-904.644] (-908.990) (-895.505) * [-898.331] (-890.522) (-907.013) (-902.686) -- 0:01:42
      743000 -- (-911.157) (-898.898) (-921.632) [-905.860] * (-916.341) [-902.444] (-906.782) (-907.253) -- 0:01:42
      743500 -- (-902.573) [-905.224] (-898.553) (-897.244) * (-910.670) (-899.674) [-896.626] (-911.728) -- 0:01:42
      744000 -- (-919.342) (-914.786) (-900.366) [-900.060] * (-917.785) (-902.107) [-910.154] (-914.132) -- 0:01:42
      744500 -- (-905.178) (-898.660) (-899.718) [-898.057] * [-898.484] (-924.378) (-904.858) (-906.305) -- 0:01:41
      745000 -- (-902.921) [-906.395] (-909.632) (-907.395) * (-905.185) [-910.213] (-912.868) (-909.688) -- 0:01:41

      Average standard deviation of split frequencies: 0.011722

      745500 -- (-912.285) [-897.663] (-914.761) (-900.512) * [-894.641] (-899.801) (-917.580) (-899.977) -- 0:01:41
      746000 -- (-906.830) (-894.397) (-896.601) [-890.151] * [-904.007] (-899.398) (-917.044) (-905.370) -- 0:01:41
      746500 -- (-911.624) (-890.175) [-904.284] (-922.783) * [-897.396] (-910.306) (-908.635) (-900.792) -- 0:01:41
      747000 -- (-903.592) (-901.504) [-897.036] (-925.893) * [-903.735] (-915.315) (-916.459) (-899.396) -- 0:01:40
      747500 -- (-892.338) (-905.272) (-916.416) [-908.732] * [-891.979] (-909.679) (-915.058) (-903.170) -- 0:01:40
      748000 -- [-897.395] (-926.006) (-897.475) (-915.674) * (-896.669) (-896.824) [-890.663] (-912.258) -- 0:01:40
      748500 -- (-894.517) (-904.435) (-915.634) [-898.312] * (-904.890) (-900.557) [-899.956] (-913.038) -- 0:01:40
      749000 -- (-900.422) (-898.577) [-900.465] (-904.008) * (-913.710) (-891.446) [-902.433] (-912.212) -- 0:01:40
      749500 -- (-901.756) (-918.501) (-925.903) [-893.700] * (-902.706) (-893.744) [-904.292] (-902.420) -- 0:01:39
      750000 -- (-905.172) (-905.429) (-918.777) [-909.900] * (-902.011) (-909.398) (-908.868) [-900.949] -- 0:01:39

      Average standard deviation of split frequencies: 0.011366

      750500 -- (-902.193) (-891.723) (-926.424) [-891.352] * (-908.467) (-905.073) (-907.902) [-898.323] -- 0:01:39
      751000 -- [-903.401] (-898.338) (-916.850) (-908.675) * (-911.369) (-896.236) (-902.244) [-905.604] -- 0:01:39
      751500 -- (-904.878) [-894.337] (-924.861) (-906.641) * (-899.281) (-906.456) [-893.840] (-917.079) -- 0:01:39
      752000 -- (-914.062) (-907.418) (-922.025) [-900.749] * (-891.554) (-916.655) [-891.035] (-922.038) -- 0:01:38
      752500 -- (-916.471) (-910.179) (-908.262) [-894.482] * (-906.620) (-897.207) [-894.911] (-911.535) -- 0:01:38
      753000 -- [-899.585] (-899.577) (-920.055) (-898.803) * (-904.680) (-906.396) [-893.900] (-923.575) -- 0:01:38
      753500 -- (-915.156) (-925.497) (-904.013) [-904.623] * (-901.965) (-906.390) [-889.800] (-902.499) -- 0:01:38
      754000 -- (-903.032) (-926.541) [-903.143] (-904.544) * [-898.435] (-915.303) (-909.288) (-903.321) -- 0:01:38
      754500 -- (-911.155) (-903.974) (-900.388) [-894.924] * (-905.170) (-906.086) (-908.692) [-904.739] -- 0:01:37
      755000 -- (-913.102) (-897.313) (-905.311) [-891.548] * [-897.016] (-907.867) (-899.786) (-909.623) -- 0:01:37

      Average standard deviation of split frequencies: 0.011224

      755500 -- (-905.817) (-899.461) (-909.582) [-895.978] * (-915.400) (-907.480) [-899.088] (-919.012) -- 0:01:37
      756000 -- (-902.372) (-901.766) (-907.871) [-894.438] * [-904.476] (-896.400) (-901.326) (-906.472) -- 0:01:37
      756500 -- (-915.143) [-898.192] (-906.313) (-898.026) * [-895.548] (-896.246) (-914.661) (-914.281) -- 0:01:37
      757000 -- (-911.921) [-900.701] (-899.707) (-916.397) * (-916.459) (-902.130) (-915.614) [-902.798] -- 0:01:36
      757500 -- [-893.566] (-904.337) (-904.518) (-913.825) * [-904.882] (-901.503) (-899.367) (-898.849) -- 0:01:36
      758000 -- (-922.869) (-928.479) (-902.523) [-895.652] * (-897.423) (-906.370) [-888.520] (-900.818) -- 0:01:36
      758500 -- (-913.506) [-894.780] (-914.149) (-906.941) * (-902.237) (-905.398) (-902.604) [-894.754] -- 0:01:36
      759000 -- (-910.005) (-900.095) [-900.847] (-908.570) * (-899.835) [-889.482] (-909.797) (-906.039) -- 0:01:36
      759500 -- [-902.277] (-913.063) (-919.145) (-897.761) * (-906.860) (-895.607) (-914.756) [-893.087] -- 0:01:35
      760000 -- (-909.547) (-901.028) [-906.213] (-910.337) * (-914.859) (-905.114) [-895.752] (-914.897) -- 0:01:35

      Average standard deviation of split frequencies: 0.010814

      760500 -- (-909.085) (-899.598) [-914.081] (-906.346) * (-910.134) (-914.696) [-900.436] (-908.371) -- 0:01:35
      761000 -- (-903.890) (-903.608) [-903.509] (-916.177) * (-908.066) (-909.946) [-895.672] (-897.473) -- 0:01:35
      761500 -- (-904.733) (-901.517) [-897.106] (-901.105) * (-913.967) (-919.365) [-899.281] (-915.907) -- 0:01:35
      762000 -- (-906.411) (-907.012) [-889.237] (-914.036) * [-900.050] (-925.343) (-911.778) (-903.333) -- 0:01:34
      762500 -- (-907.666) (-907.001) [-895.770] (-933.027) * (-907.061) [-893.962] (-896.748) (-905.724) -- 0:01:34
      763000 -- (-907.655) (-912.253) [-891.121] (-902.480) * (-891.971) (-905.742) [-902.164] (-911.232) -- 0:01:34
      763500 -- (-918.753) [-902.787] (-910.602) (-907.026) * [-895.289] (-901.055) (-900.440) (-897.605) -- 0:01:34
      764000 -- (-920.227) [-901.170] (-889.127) (-916.684) * (-925.687) (-905.159) [-896.211] (-895.487) -- 0:01:34
      764500 -- (-932.196) (-910.894) [-894.725] (-901.148) * (-912.883) (-912.681) (-902.390) [-902.073] -- 0:01:33
      765000 -- (-895.482) [-891.086] (-907.359) (-907.901) * (-910.892) (-910.530) (-903.640) [-893.213] -- 0:01:33

      Average standard deviation of split frequencies: 0.011200

      765500 -- [-895.173] (-893.977) (-907.808) (-902.384) * [-892.490] (-899.079) (-908.189) (-899.870) -- 0:01:33
      766000 -- (-917.612) (-894.209) (-908.354) [-897.697] * [-899.758] (-895.676) (-909.690) (-904.340) -- 0:01:33
      766500 -- (-904.414) (-909.965) (-908.441) [-887.934] * [-894.417] (-891.402) (-929.200) (-915.225) -- 0:01:33
      767000 -- [-898.527] (-921.916) (-905.676) (-894.189) * (-899.956) (-898.127) (-912.633) [-901.341] -- 0:01:32
      767500 -- (-912.471) [-897.142] (-905.786) (-899.266) * (-900.826) (-902.490) (-905.196) [-900.177] -- 0:01:32
      768000 -- (-902.581) [-899.584] (-896.485) (-904.497) * (-904.398) (-909.507) [-898.616] (-917.919) -- 0:01:32
      768500 -- [-902.326] (-921.819) (-908.547) (-900.108) * (-901.847) [-895.225] (-903.744) (-911.981) -- 0:01:32
      769000 -- [-903.774] (-918.070) (-906.323) (-903.559) * [-896.685] (-895.648) (-903.275) (-901.771) -- 0:01:32
      769500 -- (-915.714) [-907.303] (-918.880) (-914.845) * (-904.785) [-891.138] (-903.862) (-901.599) -- 0:01:31
      770000 -- (-894.801) (-907.048) (-921.539) [-903.282] * [-897.664] (-895.968) (-923.768) (-925.541) -- 0:01:31

      Average standard deviation of split frequencies: 0.011469

      770500 -- (-911.897) (-910.599) (-905.889) [-884.362] * (-893.998) [-897.572] (-929.577) (-910.873) -- 0:01:31
      771000 -- (-902.511) [-903.013] (-909.117) (-899.726) * [-899.396] (-896.865) (-912.801) (-899.209) -- 0:01:31
      771500 -- (-904.590) (-908.957) (-912.856) [-906.966] * (-902.574) [-892.619] (-898.165) (-911.849) -- 0:01:31
      772000 -- (-906.392) (-895.541) [-896.290] (-892.779) * (-897.769) [-898.735] (-903.763) (-911.019) -- 0:01:30
      772500 -- (-908.443) (-910.017) (-903.813) [-893.401] * (-909.339) [-902.440] (-898.682) (-901.286) -- 0:01:30
      773000 -- [-899.497] (-892.843) (-902.005) (-906.395) * (-915.710) (-896.889) (-903.192) [-904.363] -- 0:01:30
      773500 -- (-898.654) [-896.511] (-905.846) (-887.314) * (-909.155) [-905.243] (-903.582) (-906.410) -- 0:01:30
      774000 -- (-917.743) (-905.059) [-898.311] (-892.801) * (-920.244) (-900.455) (-892.424) [-886.763] -- 0:01:30
      774500 -- (-901.107) (-912.885) [-894.983] (-910.738) * (-916.836) (-922.275) (-907.131) [-889.817] -- 0:01:29
      775000 -- (-897.503) (-913.158) [-908.652] (-903.863) * (-907.347) (-896.621) (-899.569) [-895.555] -- 0:01:29

      Average standard deviation of split frequencies: 0.010874

      775500 -- [-899.932] (-930.630) (-896.759) (-900.362) * (-902.133) [-900.031] (-909.725) (-901.173) -- 0:01:29
      776000 -- (-921.022) (-901.044) [-895.780] (-900.621) * (-913.453) [-899.419] (-912.621) (-921.206) -- 0:01:29
      776500 -- (-903.787) (-907.940) [-891.555] (-894.211) * (-903.449) [-886.585] (-904.572) (-918.395) -- 0:01:29
      777000 -- [-899.316] (-911.279) (-927.481) (-900.075) * [-905.383] (-903.652) (-918.176) (-901.611) -- 0:01:28
      777500 -- [-897.982] (-911.215) (-906.955) (-898.372) * (-906.620) (-906.664) (-920.130) [-887.751] -- 0:01:28
      778000 -- (-894.702) [-903.589] (-894.546) (-910.591) * (-912.495) [-894.611] (-905.800) (-896.448) -- 0:01:28
      778500 -- [-887.889] (-890.965) (-921.520) (-911.957) * (-917.537) [-901.040] (-903.662) (-893.823) -- 0:01:28
      779000 -- (-905.474) (-897.074) (-920.494) [-898.660] * (-907.690) [-891.268] (-898.505) (-895.911) -- 0:01:28
      779500 -- (-899.351) [-901.323] (-898.675) (-916.803) * (-906.124) (-910.143) (-914.000) [-888.594] -- 0:01:27
      780000 -- (-907.463) [-906.549] (-910.756) (-891.742) * [-896.183] (-901.878) (-916.022) (-899.500) -- 0:01:27

      Average standard deviation of split frequencies: 0.010779

      780500 -- (-918.327) (-897.705) (-899.548) [-899.958] * (-908.606) [-895.333] (-911.091) (-913.629) -- 0:01:27
      781000 -- (-902.184) (-930.830) [-891.476] (-907.761) * (-908.848) [-896.846] (-912.388) (-904.352) -- 0:01:27
      781500 -- (-897.452) (-911.593) [-891.067] (-913.882) * (-890.772) [-903.953] (-924.264) (-917.429) -- 0:01:27
      782000 -- (-914.887) (-913.641) (-915.091) [-889.531] * [-897.212] (-904.285) (-908.922) (-910.162) -- 0:01:26
      782500 -- [-897.513] (-919.292) (-895.267) (-906.610) * (-898.678) (-898.263) (-896.754) [-894.671] -- 0:01:26
      783000 -- [-904.797] (-905.987) (-896.860) (-912.660) * (-906.701) (-902.422) (-913.258) [-894.823] -- 0:01:26
      783500 -- [-899.967] (-897.380) (-901.297) (-899.886) * (-888.679) (-911.165) (-916.011) [-893.790] -- 0:01:26
      784000 -- (-904.218) (-906.599) [-901.057] (-905.062) * (-906.109) (-904.685) (-915.149) [-885.113] -- 0:01:26
      784500 -- (-907.792) (-908.801) [-889.765] (-913.328) * [-899.811] (-905.568) (-914.127) (-898.258) -- 0:01:25
      785000 -- [-902.325] (-912.425) (-891.837) (-918.270) * (-915.835) (-909.560) (-899.937) [-896.433] -- 0:01:25

      Average standard deviation of split frequencies: 0.010646

      785500 -- (-916.819) (-910.117) (-903.821) [-902.400] * (-905.306) (-912.275) [-892.699] (-906.032) -- 0:01:25
      786000 -- (-912.948) (-897.516) (-902.649) [-902.933] * [-892.412] (-907.238) (-894.410) (-932.179) -- 0:01:25
      786500 -- (-903.219) [-910.466] (-905.256) (-911.344) * (-895.499) (-909.353) [-888.344] (-909.951) -- 0:01:25
      787000 -- (-899.971) (-905.845) [-900.594] (-906.329) * (-912.359) [-910.501] (-891.005) (-918.565) -- 0:01:24
      787500 -- [-893.834] (-898.676) (-893.663) (-904.656) * (-905.486) (-896.870) [-898.896] (-896.782) -- 0:01:24
      788000 -- [-897.884] (-900.888) (-902.372) (-904.314) * (-907.319) (-908.440) [-900.672] (-903.322) -- 0:01:24
      788500 -- (-901.914) (-921.726) (-913.823) [-888.076] * (-909.327) (-919.192) [-898.832] (-897.464) -- 0:01:24
      789000 -- (-918.232) (-893.786) [-900.330] (-896.891) * (-904.455) [-894.843] (-894.393) (-916.442) -- 0:01:24
      789500 -- [-905.044] (-895.034) (-903.775) (-908.055) * (-910.965) [-900.554] (-908.560) (-905.705) -- 0:01:23
      790000 -- (-894.909) [-887.844] (-906.823) (-915.703) * (-902.592) (-906.270) (-902.240) [-904.083] -- 0:01:23

      Average standard deviation of split frequencies: 0.010285

      790500 -- (-898.230) (-903.881) (-909.394) [-898.611] * (-894.845) [-903.529] (-933.931) (-912.810) -- 0:01:23
      791000 -- (-908.143) (-904.798) [-891.080] (-895.666) * (-907.253) (-901.206) (-912.439) [-886.718] -- 0:01:23
      791500 -- (-906.380) (-901.923) (-910.292) [-891.428] * [-900.411] (-916.198) (-902.962) (-902.730) -- 0:01:23
      792000 -- (-888.352) [-904.480] (-904.984) (-893.362) * (-904.094) (-911.419) [-905.254] (-907.903) -- 0:01:22
      792500 -- (-924.209) (-905.436) [-892.173] (-905.186) * (-905.553) (-898.331) [-904.376] (-907.919) -- 0:01:23
      793000 -- [-896.981] (-928.698) (-908.256) (-896.564) * (-909.018) [-909.618] (-903.360) (-895.073) -- 0:01:22
      793500 -- [-903.865] (-916.748) (-895.795) (-896.095) * [-911.082] (-920.349) (-900.586) (-907.430) -- 0:01:22
      794000 -- (-899.591) (-925.134) (-908.299) [-904.515] * (-894.852) (-900.828) (-899.574) [-895.825] -- 0:01:22
      794500 -- (-909.090) (-919.171) (-901.905) [-896.887] * (-908.878) [-890.622] (-902.439) (-907.579) -- 0:01:21
      795000 -- (-915.443) (-907.432) (-917.479) [-892.300] * [-899.523] (-895.184) (-912.734) (-903.656) -- 0:01:22

      Average standard deviation of split frequencies: 0.010423

      795500 -- (-911.546) [-895.470] (-912.121) (-898.699) * (-902.654) [-890.157] (-913.191) (-899.471) -- 0:01:21
      796000 -- (-910.854) (-922.927) [-893.141] (-898.032) * (-916.126) (-894.751) (-896.436) [-893.737] -- 0:01:21
      796500 -- (-910.806) (-906.369) (-899.165) [-907.106] * [-896.107] (-889.948) (-904.234) (-900.170) -- 0:01:21
      797000 -- (-926.142) (-902.113) [-904.432] (-904.568) * (-899.831) [-897.808] (-912.301) (-909.060) -- 0:01:20
      797500 -- (-903.384) (-910.239) (-897.208) [-897.628] * (-909.166) (-921.110) [-904.876] (-898.483) -- 0:01:21
      798000 -- [-903.144] (-904.537) (-907.266) (-891.451) * (-904.664) (-911.390) [-901.246] (-911.297) -- 0:01:20
      798500 -- (-899.138) [-896.291] (-896.551) (-902.400) * (-898.735) (-908.012) [-903.819] (-894.697) -- 0:01:20
      799000 -- [-903.606] (-895.333) (-916.182) (-905.980) * (-896.770) (-923.691) (-917.683) [-893.286] -- 0:01:20
      799500 -- (-903.001) (-911.130) [-903.755] (-919.267) * (-907.621) (-910.377) [-888.491] (-894.224) -- 0:01:19
      800000 -- (-907.756) (-900.421) (-900.898) [-897.417] * (-889.795) [-911.155] (-903.671) (-913.919) -- 0:01:20

      Average standard deviation of split frequencies: 0.010951

      800500 -- (-902.006) (-896.729) [-886.326] (-903.539) * [-894.484] (-902.289) (-908.211) (-911.194) -- 0:01:19
      801000 -- (-905.168) [-897.381] (-900.630) (-902.512) * [-888.130] (-915.693) (-905.873) (-917.170) -- 0:01:19
      801500 -- (-903.100) [-894.344] (-913.715) (-900.703) * [-889.363] (-911.574) (-911.163) (-904.236) -- 0:01:19
      802000 -- (-911.343) (-896.334) [-894.065] (-900.011) * (-900.765) (-905.809) [-889.394] (-902.487) -- 0:01:19
      802500 -- (-889.132) [-894.143] (-902.902) (-908.712) * (-888.449) (-911.749) [-901.123] (-898.523) -- 0:01:19
      803000 -- [-891.302] (-913.025) (-915.151) (-901.154) * (-901.112) (-920.042) (-905.548) [-893.264] -- 0:01:18
      803500 -- (-904.943) [-904.810] (-902.558) (-899.765) * (-908.467) (-909.587) [-894.569] (-899.746) -- 0:01:18
      804000 -- (-908.731) (-918.469) [-897.686] (-890.568) * (-905.681) (-901.897) (-907.922) [-886.006] -- 0:01:18
      804500 -- (-911.406) (-910.132) (-902.927) [-894.171] * (-910.706) (-908.875) [-907.444] (-893.274) -- 0:01:18
      805000 -- (-903.312) (-917.098) [-898.666] (-910.929) * (-905.886) (-908.847) [-892.608] (-900.775) -- 0:01:18

      Average standard deviation of split frequencies: 0.010528

      805500 -- [-898.686] (-909.557) (-920.206) (-902.124) * (-911.828) [-901.736] (-900.456) (-908.359) -- 0:01:17
      806000 -- (-902.580) (-923.488) [-900.584] (-898.513) * (-899.529) [-894.052] (-906.251) (-897.523) -- 0:01:17
      806500 -- (-889.706) (-895.725) [-888.607] (-909.374) * (-927.854) (-890.864) (-904.117) [-898.635] -- 0:01:17
      807000 -- (-927.999) (-910.498) [-893.648] (-901.487) * (-914.560) [-897.290] (-902.915) (-905.475) -- 0:01:17
      807500 -- (-912.516) [-895.037] (-915.536) (-904.259) * [-907.948] (-914.565) (-896.220) (-901.076) -- 0:01:17
      808000 -- [-898.868] (-904.857) (-921.183) (-894.525) * (-905.516) (-896.230) [-909.811] (-900.819) -- 0:01:16
      808500 -- [-896.671] (-903.589) (-905.886) (-902.967) * (-916.720) (-902.855) (-909.539) [-892.059] -- 0:01:16
      809000 -- (-901.567) (-899.257) [-898.277] (-915.778) * [-901.454] (-928.633) (-905.593) (-916.075) -- 0:01:16
      809500 -- (-905.832) (-904.832) [-902.126] (-905.820) * [-903.483] (-902.977) (-897.615) (-911.041) -- 0:01:16
      810000 -- (-920.173) [-896.348] (-896.527) (-919.770) * (-904.422) (-913.917) [-891.157] (-907.861) -- 0:01:16

      Average standard deviation of split frequencies: 0.010990

      810500 -- (-898.274) (-911.206) (-912.458) [-904.102] * [-890.544] (-894.180) (-900.541) (-900.245) -- 0:01:15
      811000 -- (-906.115) (-899.144) [-898.197] (-914.008) * (-891.243) (-908.886) (-907.133) [-899.887] -- 0:01:15
      811500 -- (-902.629) [-891.161] (-898.579) (-916.881) * [-893.556] (-931.697) (-911.354) (-891.210) -- 0:01:15
      812000 -- (-910.323) [-893.617] (-895.360) (-918.017) * (-902.815) (-914.266) (-903.738) [-890.047] -- 0:01:15
      812500 -- (-921.993) [-900.136] (-900.231) (-917.002) * (-895.006) (-908.863) (-908.013) [-892.322] -- 0:01:15
      813000 -- (-899.432) (-892.060) [-888.626] (-909.356) * [-902.556] (-902.780) (-907.027) (-902.033) -- 0:01:14
      813500 -- (-895.672) [-891.927] (-898.624) (-905.411) * [-902.455] (-896.583) (-900.791) (-907.659) -- 0:01:14
      814000 -- (-896.922) (-908.364) (-917.203) [-904.548] * [-901.005] (-912.889) (-909.186) (-895.518) -- 0:01:14
      814500 -- (-910.375) (-908.477) (-908.639) [-899.413] * [-886.876] (-913.897) (-895.864) (-897.946) -- 0:01:14
      815000 -- (-905.046) [-902.679] (-910.967) (-910.328) * [-899.291] (-908.182) (-910.174) (-900.785) -- 0:01:14

      Average standard deviation of split frequencies: 0.011005

      815500 -- [-894.935] (-913.799) (-915.702) (-929.604) * [-892.185] (-910.495) (-926.146) (-896.652) -- 0:01:13
      816000 -- (-903.589) [-896.048] (-920.689) (-923.549) * (-894.629) (-908.515) (-924.615) [-892.995] -- 0:01:13
      816500 -- (-904.623) (-901.425) [-908.382] (-907.915) * [-902.693] (-900.358) (-895.011) (-915.977) -- 0:01:13
      817000 -- (-908.668) (-913.921) [-905.042] (-898.020) * [-910.171] (-893.602) (-905.353) (-897.945) -- 0:01:13
      817500 -- (-896.711) (-902.814) [-894.454] (-903.627) * (-908.979) [-899.376] (-900.012) (-892.436) -- 0:01:13
      818000 -- (-912.958) [-910.186] (-906.675) (-911.183) * (-920.421) (-889.786) [-898.326] (-915.898) -- 0:01:12
      818500 -- (-910.700) (-905.506) [-898.510] (-905.924) * (-911.352) (-901.911) [-894.536] (-898.109) -- 0:01:12
      819000 -- (-897.587) (-905.527) [-896.579] (-916.290) * (-921.594) (-907.711) (-899.061) [-911.215] -- 0:01:12
      819500 -- (-904.180) [-895.880] (-904.600) (-907.221) * [-901.768] (-902.134) (-884.741) (-917.966) -- 0:01:12
      820000 -- (-906.677) (-894.395) [-893.609] (-900.601) * (-900.896) (-900.258) (-902.777) [-895.452] -- 0:01:12

      Average standard deviation of split frequencies: 0.011460

      820500 -- (-915.873) (-909.750) [-897.352] (-901.518) * (-899.383) (-903.223) (-913.678) [-895.475] -- 0:01:11
      821000 -- (-919.198) [-891.572] (-931.727) (-909.316) * (-894.787) (-913.105) [-893.516] (-898.780) -- 0:01:11
      821500 -- (-899.913) [-891.081] (-903.319) (-899.031) * (-906.178) (-904.753) (-910.981) [-888.043] -- 0:01:11
      822000 -- [-894.682] (-893.116) (-916.517) (-907.469) * (-914.327) [-900.672] (-907.505) (-910.101) -- 0:01:11
      822500 -- (-899.896) [-894.057] (-897.973) (-905.215) * [-895.962] (-900.378) (-903.925) (-899.425) -- 0:01:11
      823000 -- (-910.337) [-895.744] (-905.248) (-919.646) * [-905.918] (-904.466) (-906.963) (-895.344) -- 0:01:10
      823500 -- (-897.134) (-906.279) (-913.731) [-906.706] * (-904.394) (-913.331) (-896.206) [-891.954] -- 0:01:10
      824000 -- (-894.672) [-905.895] (-913.524) (-900.016) * (-902.710) [-902.366] (-900.957) (-901.561) -- 0:01:10
      824500 -- (-911.292) (-906.033) (-918.869) [-904.685] * (-900.068) [-889.277] (-901.459) (-899.424) -- 0:01:10
      825000 -- [-903.488] (-931.378) (-900.733) (-899.332) * (-907.064) [-883.992] (-920.889) (-901.659) -- 0:01:10

      Average standard deviation of split frequencies: 0.011243

      825500 -- (-918.503) (-922.896) [-899.214] (-912.256) * (-902.571) [-898.764] (-906.661) (-915.996) -- 0:01:09
      826000 -- [-897.690] (-910.303) (-909.533) (-917.680) * (-905.189) [-892.471] (-903.660) (-904.257) -- 0:01:09
      826500 -- (-913.938) (-905.290) [-903.470] (-908.393) * (-914.511) (-902.352) [-896.763] (-907.015) -- 0:01:09
      827000 -- (-909.441) [-894.043] (-902.985) (-917.614) * [-901.496] (-906.022) (-908.140) (-906.655) -- 0:01:09
      827500 -- (-894.879) [-893.988] (-901.778) (-911.234) * (-910.469) (-916.812) [-892.906] (-896.986) -- 0:01:09
      828000 -- (-905.469) (-905.984) [-892.432] (-908.728) * [-909.167] (-908.933) (-910.708) (-918.782) -- 0:01:08
      828500 -- (-901.567) (-902.894) [-898.576] (-899.070) * [-901.646] (-918.028) (-924.897) (-913.487) -- 0:01:08
      829000 -- (-903.095) (-896.637) (-905.177) [-895.946] * (-903.897) (-912.012) (-909.393) [-896.896] -- 0:01:08
      829500 -- (-928.963) (-904.591) (-888.027) [-892.214] * (-912.305) (-902.025) [-890.748] (-901.765) -- 0:01:08
      830000 -- [-897.293] (-912.688) (-904.576) (-904.946) * (-918.163) (-905.399) (-907.366) [-908.076] -- 0:01:08

      Average standard deviation of split frequencies: 0.011208

      830500 -- (-895.241) (-905.325) [-891.916] (-920.342) * [-898.105] (-900.151) (-915.414) (-919.571) -- 0:01:07
      831000 -- (-903.228) (-902.101) (-902.089) [-903.256] * (-909.059) (-896.812) [-897.671] (-897.817) -- 0:01:07
      831500 -- [-903.614] (-909.844) (-909.280) (-911.970) * [-898.506] (-906.210) (-906.170) (-913.632) -- 0:01:07
      832000 -- (-913.213) (-924.426) (-893.631) [-893.107] * (-896.401) (-903.660) (-897.306) [-892.272] -- 0:01:07
      832500 -- (-903.908) (-906.856) [-893.366] (-910.000) * (-896.212) (-898.876) [-894.209] (-899.297) -- 0:01:07
      833000 -- (-888.946) (-899.181) [-897.083] (-908.179) * (-909.327) (-908.314) [-902.102] (-917.087) -- 0:01:06
      833500 -- (-908.295) (-910.466) [-897.347] (-900.591) * (-894.931) (-900.456) (-912.179) [-912.076] -- 0:01:06
      834000 -- (-904.044) (-900.962) (-909.952) [-898.480] * [-891.963] (-894.130) (-909.633) (-905.082) -- 0:01:06
      834500 -- (-898.843) (-917.349) (-921.463) [-907.817] * (-900.088) [-904.852] (-905.211) (-912.386) -- 0:01:06
      835000 -- [-894.463] (-901.227) (-911.007) (-899.032) * (-902.332) [-898.492] (-897.053) (-908.420) -- 0:01:06

      Average standard deviation of split frequencies: 0.011137

      835500 -- (-899.398) [-885.503] (-906.356) (-898.278) * (-891.273) (-910.029) [-897.107] (-909.026) -- 0:01:05
      836000 -- (-902.014) (-890.059) (-923.406) [-900.607] * (-897.338) (-900.125) (-935.043) [-895.926] -- 0:01:05
      836500 -- (-900.538) (-901.914) (-911.268) [-904.904] * (-917.735) (-894.083) (-910.141) [-891.540] -- 0:01:05
      837000 -- (-900.407) [-886.856] (-913.361) (-903.075) * (-926.073) [-891.034] (-901.759) (-895.091) -- 0:01:05
      837500 -- (-901.440) (-903.775) (-921.854) [-901.969] * (-914.150) (-890.382) [-898.828] (-908.572) -- 0:01:05
      838000 -- [-900.960] (-911.225) (-911.911) (-903.083) * (-903.963) [-889.060] (-911.258) (-907.420) -- 0:01:04
      838500 -- [-895.951] (-896.567) (-895.848) (-929.501) * [-902.390] (-908.109) (-907.816) (-920.756) -- 0:01:04
      839000 -- (-917.789) [-892.100] (-901.922) (-913.749) * (-913.591) (-898.304) (-908.859) [-901.489] -- 0:01:04
      839500 -- (-909.986) [-898.033] (-897.140) (-913.210) * [-896.229] (-901.981) (-908.945) (-902.061) -- 0:01:04
      840000 -- (-910.858) [-893.737] (-895.547) (-907.477) * [-891.614] (-910.321) (-907.264) (-917.357) -- 0:01:04

      Average standard deviation of split frequencies: 0.011131

      840500 -- (-904.880) (-896.940) [-891.269] (-892.271) * (-915.572) (-903.107) [-903.150] (-909.183) -- 0:01:03
      841000 -- (-894.808) (-910.472) [-897.195] (-905.321) * (-901.455) (-903.708) (-925.868) [-904.329] -- 0:01:03
      841500 -- [-899.098] (-894.158) (-910.104) (-918.204) * [-901.689] (-894.255) (-912.158) (-888.856) -- 0:01:03
      842000 -- [-881.463] (-906.825) (-897.987) (-916.165) * [-894.338] (-905.077) (-912.300) (-897.508) -- 0:01:03
      842500 -- (-897.342) [-897.753] (-900.548) (-906.087) * [-898.478] (-894.997) (-910.645) (-901.898) -- 0:01:03
      843000 -- [-899.504] (-895.072) (-923.566) (-913.128) * (-909.111) (-931.574) (-907.067) [-911.981] -- 0:01:02
      843500 -- (-893.346) [-891.314] (-904.969) (-914.094) * (-903.782) (-917.984) [-897.340] (-916.990) -- 0:01:02
      844000 -- [-897.086] (-906.018) (-911.031) (-902.269) * [-896.430] (-902.191) (-901.103) (-907.914) -- 0:01:02
      844500 -- (-914.110) (-899.733) [-901.039] (-919.016) * (-888.525) (-914.189) (-908.807) [-896.247] -- 0:01:02
      845000 -- (-890.456) (-917.687) [-904.810] (-914.717) * (-910.791) (-921.956) (-912.850) [-900.490] -- 0:01:02

      Average standard deviation of split frequencies: 0.011116

      845500 -- (-904.445) (-904.187) [-913.475] (-902.415) * [-892.744] (-906.662) (-900.230) (-916.052) -- 0:01:01
      846000 -- (-917.190) (-907.909) (-926.498) [-905.485] * (-894.869) (-900.115) (-905.320) [-898.634] -- 0:01:01
      846500 -- (-909.950) [-899.638] (-913.471) (-904.194) * (-910.260) (-891.302) [-900.530] (-910.249) -- 0:01:01
      847000 -- [-894.850] (-898.821) (-904.805) (-901.210) * (-897.389) (-897.689) (-913.701) [-892.571] -- 0:01:01
      847500 -- (-910.631) [-898.765] (-913.843) (-913.355) * (-899.758) (-896.338) (-909.982) [-896.908] -- 0:01:01
      848000 -- [-898.923] (-900.905) (-908.733) (-920.683) * (-902.987) [-890.633] (-913.165) (-902.021) -- 0:01:00
      848500 -- (-898.971) [-892.392] (-912.095) (-905.913) * (-903.362) (-910.785) (-910.878) [-901.229] -- 0:01:00
      849000 -- (-896.129) [-891.917] (-925.051) (-900.445) * [-902.716] (-905.347) (-915.841) (-894.255) -- 0:01:00
      849500 -- (-906.097) [-895.098] (-908.880) (-904.806) * (-895.084) [-892.427] (-915.185) (-901.729) -- 0:01:00
      850000 -- (-895.194) (-902.046) [-895.449] (-909.345) * (-893.467) [-891.447] (-920.357) (-909.353) -- 0:01:00

      Average standard deviation of split frequencies: 0.011055

      850500 -- (-908.984) (-903.819) (-901.415) [-898.994] * (-907.760) [-897.208] (-906.833) (-900.770) -- 0:00:59
      851000 -- (-897.516) (-903.033) [-895.001] (-899.473) * (-908.966) [-896.875] (-898.548) (-893.925) -- 0:00:59
      851500 -- (-902.009) (-897.529) [-893.821] (-911.617) * (-900.848) (-918.864) [-903.713] (-899.345) -- 0:00:59
      852000 -- (-901.791) [-892.876] (-908.010) (-910.986) * (-922.523) (-899.730) [-895.009] (-901.804) -- 0:00:59
      852500 -- (-926.028) [-897.793] (-904.500) (-922.927) * [-900.393] (-915.586) (-917.477) (-930.458) -- 0:00:59
      853000 -- (-913.155) (-918.095) [-902.734] (-927.793) * (-926.280) (-916.666) [-915.063] (-932.209) -- 0:00:58
      853500 -- [-905.247] (-913.500) (-890.475) (-916.149) * (-902.688) [-898.625] (-908.090) (-934.962) -- 0:00:58
      854000 -- (-910.205) (-922.546) [-898.559] (-908.330) * (-898.590) (-895.057) [-901.024] (-914.169) -- 0:00:58
      854500 -- (-901.008) (-927.582) [-899.154] (-898.330) * (-901.710) [-894.194] (-912.971) (-908.301) -- 0:00:58
      855000 -- (-906.563) (-906.087) (-890.606) [-894.235] * (-900.048) [-898.334] (-912.493) (-916.027) -- 0:00:58

      Average standard deviation of split frequencies: 0.011097

      855500 -- (-897.031) (-917.126) (-897.310) [-889.512] * [-892.741] (-910.961) (-918.927) (-906.460) -- 0:00:57
      856000 -- (-906.270) (-919.919) [-889.550] (-899.327) * [-889.427] (-912.640) (-888.671) (-907.484) -- 0:00:57
      856500 -- (-909.316) [-889.221] (-896.141) (-905.889) * (-901.460) (-907.732) [-889.631] (-929.153) -- 0:00:57
      857000 -- [-903.711] (-912.235) (-890.363) (-912.409) * (-896.425) (-912.647) (-896.699) [-900.709] -- 0:00:57
      857500 -- (-900.657) (-905.831) [-889.322] (-900.373) * (-899.848) [-901.826] (-914.435) (-904.858) -- 0:00:57
      858000 -- (-912.408) [-897.979] (-905.468) (-906.436) * (-919.902) (-894.556) (-907.492) [-895.690] -- 0:00:56
      858500 -- (-914.073) (-911.064) [-893.355] (-904.552) * (-906.794) [-893.023] (-906.167) (-913.970) -- 0:00:56
      859000 -- (-899.700) (-902.610) (-904.213) [-893.538] * (-912.611) [-901.278] (-900.424) (-908.992) -- 0:00:56
      859500 -- [-894.521] (-899.792) (-912.539) (-907.488) * [-909.297] (-908.978) (-908.665) (-926.797) -- 0:00:56
      860000 -- (-905.957) (-900.290) [-899.319] (-909.332) * [-895.584] (-896.204) (-913.114) (-906.878) -- 0:00:56

      Average standard deviation of split frequencies: 0.010982

      860500 -- [-897.774] (-905.622) (-903.913) (-900.831) * [-896.497] (-899.391) (-912.063) (-911.889) -- 0:00:55
      861000 -- [-895.541] (-906.204) (-896.030) (-896.794) * (-897.811) (-901.872) (-904.614) [-894.714] -- 0:00:55
      861500 -- (-895.680) (-914.659) [-898.072] (-902.201) * (-895.324) [-889.044] (-905.312) (-898.819) -- 0:00:55
      862000 -- (-899.940) (-901.722) (-919.342) [-896.813] * [-900.241] (-891.660) (-914.880) (-912.470) -- 0:00:55
      862500 -- (-907.114) (-908.501) (-919.242) [-894.848] * (-898.064) (-888.347) [-905.957] (-897.249) -- 0:00:55
      863000 -- [-902.468] (-908.699) (-896.803) (-891.749) * (-893.676) (-893.030) (-918.522) [-894.762] -- 0:00:54
      863500 -- (-900.751) [-901.086] (-910.120) (-910.146) * [-896.728] (-907.190) (-900.528) (-907.577) -- 0:00:54
      864000 -- [-897.861] (-904.634) (-903.336) (-930.461) * (-900.147) (-909.515) [-893.524] (-907.389) -- 0:00:54
      864500 -- (-900.984) (-919.327) [-897.684] (-906.870) * (-924.778) (-897.654) [-890.508] (-892.067) -- 0:00:54
      865000 -- (-912.213) (-918.440) [-900.982] (-910.754) * (-913.872) [-901.481] (-915.646) (-885.787) -- 0:00:54

      Average standard deviation of split frequencies: 0.010914

      865500 -- (-906.635) (-908.513) [-901.367] (-909.585) * (-917.749) (-907.354) [-905.648] (-909.071) -- 0:00:53
      866000 -- (-931.006) (-903.895) (-913.244) [-903.373] * (-907.155) (-902.200) (-909.012) [-896.067] -- 0:00:53
      866500 -- [-892.924] (-902.839) (-911.941) (-906.467) * (-912.663) (-915.893) (-909.601) [-895.828] -- 0:00:53
      867000 -- (-906.796) (-901.738) [-903.358] (-911.650) * (-913.245) (-918.036) [-905.800] (-907.322) -- 0:00:53
      867500 -- [-895.550] (-902.965) (-908.831) (-913.547) * (-907.959) (-893.428) (-914.813) [-914.097] -- 0:00:53
      868000 -- (-893.909) (-900.733) [-896.760] (-916.113) * (-908.020) (-916.403) (-894.683) [-904.099] -- 0:00:52
      868500 -- (-909.550) (-902.302) (-897.488) [-889.524] * (-895.883) (-927.742) (-905.397) [-894.079] -- 0:00:52
      869000 -- (-910.662) [-892.088] (-905.833) (-910.619) * (-899.765) (-914.476) [-884.839] (-914.745) -- 0:00:52
      869500 -- (-908.852) [-899.955] (-896.196) (-926.261) * [-900.203] (-918.635) (-897.257) (-919.976) -- 0:00:52
      870000 -- [-898.750] (-896.144) (-906.266) (-910.399) * [-909.024] (-914.260) (-897.777) (-908.873) -- 0:00:52

      Average standard deviation of split frequencies: 0.010639

      870500 -- (-899.946) [-893.920] (-914.500) (-894.548) * (-912.869) (-902.368) (-902.760) [-898.283] -- 0:00:51
      871000 -- (-899.749) (-893.136) (-903.997) [-889.627] * (-907.654) (-897.673) (-914.169) [-893.231] -- 0:00:51
      871500 -- (-899.815) (-900.866) (-920.890) [-899.915] * (-908.735) (-908.686) (-898.684) [-899.793] -- 0:00:51
      872000 -- (-898.149) (-929.564) (-904.040) [-883.216] * (-927.020) (-905.075) [-903.417] (-896.190) -- 0:00:51
      872500 -- (-916.301) (-908.365) (-920.270) [-904.141] * (-919.704) (-908.629) [-911.086] (-913.808) -- 0:00:51
      873000 -- (-904.949) [-902.049] (-896.329) (-895.312) * [-900.620] (-900.207) (-899.750) (-909.056) -- 0:00:50
      873500 -- (-898.527) (-893.001) (-906.111) [-901.508] * (-906.931) [-900.498] (-897.399) (-913.527) -- 0:00:50
      874000 -- (-914.850) (-903.835) (-907.488) [-891.593] * (-910.046) [-889.222] (-897.501) (-901.397) -- 0:00:50
      874500 -- (-910.868) (-902.699) (-910.365) [-902.808] * (-897.526) [-897.952] (-906.865) (-911.486) -- 0:00:50
      875000 -- (-909.828) (-901.467) (-905.431) [-900.004] * [-903.311] (-897.894) (-899.683) (-915.119) -- 0:00:50

      Average standard deviation of split frequencies: 0.010198

      875500 -- (-902.556) (-903.808) [-895.806] (-915.935) * (-900.961) (-903.229) [-888.244] (-905.180) -- 0:00:49
      876000 -- (-906.980) [-894.412] (-891.953) (-900.895) * (-899.156) [-900.158] (-907.202) (-905.666) -- 0:00:49
      876500 -- [-893.937] (-908.776) (-912.375) (-920.852) * [-901.024] (-898.742) (-926.607) (-907.324) -- 0:00:49
      877000 -- (-922.057) [-894.281] (-897.239) (-914.103) * (-905.645) (-916.948) [-894.681] (-899.725) -- 0:00:49
      877500 -- (-903.619) (-911.249) (-899.435) [-882.678] * (-922.412) (-900.571) (-907.792) [-885.706] -- 0:00:49
      878000 -- [-897.638] (-909.183) (-903.225) (-890.559) * (-911.307) (-915.442) (-905.483) [-900.491] -- 0:00:48
      878500 -- (-910.125) (-912.384) (-911.795) [-896.647] * (-903.281) (-906.481) (-914.176) [-886.748] -- 0:00:48
      879000 -- (-920.418) [-894.962] (-913.775) (-889.720) * (-888.807) [-904.840] (-914.847) (-902.367) -- 0:00:48
      879500 -- (-897.612) (-894.951) [-890.955] (-906.425) * [-899.693] (-902.200) (-914.451) (-899.126) -- 0:00:48
      880000 -- [-901.181] (-908.743) (-900.604) (-917.864) * [-906.903] (-906.161) (-905.828) (-925.572) -- 0:00:48

      Average standard deviation of split frequencies: 0.010304

      880500 -- (-903.953) [-916.009] (-905.240) (-903.496) * (-902.339) (-894.071) (-912.323) [-899.654] -- 0:00:47
      881000 -- (-909.902) (-904.164) (-899.888) [-897.325] * [-889.653] (-914.744) (-901.563) (-928.269) -- 0:00:47
      881500 -- (-899.254) (-899.828) [-892.460] (-910.336) * [-893.583] (-904.681) (-905.295) (-907.011) -- 0:00:47
      882000 -- [-891.172] (-911.532) (-892.246) (-908.379) * (-900.434) [-889.400] (-907.904) (-901.124) -- 0:00:47
      882500 -- [-895.316] (-902.387) (-905.898) (-913.670) * [-899.583] (-905.946) (-912.324) (-905.613) -- 0:00:47
      883000 -- (-910.613) (-895.982) (-904.572) [-902.867] * (-901.050) (-899.944) [-902.612] (-894.432) -- 0:00:46
      883500 -- (-898.503) (-908.632) (-902.235) [-893.606] * (-908.281) [-885.669] (-906.048) (-901.406) -- 0:00:46
      884000 -- (-908.198) (-908.213) [-894.705] (-895.363) * (-900.241) (-899.302) [-905.804] (-901.025) -- 0:00:46
      884500 -- (-896.433) (-905.456) (-918.376) [-895.106] * [-894.137] (-909.363) (-917.089) (-906.688) -- 0:00:46
      885000 -- (-916.367) [-902.800] (-913.911) (-903.710) * (-900.580) (-902.642) (-903.252) [-893.105] -- 0:00:46

      Average standard deviation of split frequencies: 0.010349

      885500 -- (-903.324) (-909.795) [-902.467] (-904.056) * (-904.480) (-911.457) (-911.311) [-903.467] -- 0:00:45
      886000 -- (-910.184) (-915.299) (-887.946) [-912.789] * (-909.286) (-918.591) [-893.561] (-929.016) -- 0:00:45
      886500 -- [-898.023] (-924.505) (-904.856) (-923.280) * [-883.552] (-917.099) (-904.160) (-954.339) -- 0:00:45
      887000 -- (-898.862) (-917.897) [-907.981] (-931.467) * (-902.191) (-921.586) [-897.279] (-916.503) -- 0:00:45
      887500 -- (-898.705) (-916.319) [-905.145] (-906.446) * (-909.190) (-918.848) [-904.339] (-917.742) -- 0:00:45
      888000 -- (-903.578) (-908.264) (-906.798) [-901.578] * (-919.098) (-913.370) (-917.115) [-898.814] -- 0:00:44
      888500 -- [-888.588] (-902.878) (-912.181) (-907.238) * (-904.740) (-903.346) (-907.025) [-895.029] -- 0:00:44
      889000 -- (-905.379) (-914.061) [-908.065] (-903.774) * (-906.772) (-908.372) [-886.538] (-909.018) -- 0:00:44
      889500 -- (-903.232) (-904.686) [-900.851] (-913.152) * (-908.165) (-908.367) [-898.800] (-902.558) -- 0:00:44
      890000 -- (-905.355) (-905.327) [-899.318] (-918.614) * [-895.607] (-901.604) (-898.903) (-907.710) -- 0:00:44

      Average standard deviation of split frequencies: 0.010030

      890500 -- (-901.261) [-898.902] (-908.929) (-925.061) * (-902.676) (-907.952) [-894.776] (-907.468) -- 0:00:43
      891000 -- (-893.304) [-901.046] (-906.088) (-901.942) * [-901.470] (-893.713) (-898.972) (-925.538) -- 0:00:43
      891500 -- (-905.693) (-898.355) [-906.768] (-916.794) * (-901.132) (-904.294) [-892.690] (-902.768) -- 0:00:43
      892000 -- [-894.040] (-888.243) (-899.833) (-897.457) * (-892.648) (-917.681) [-899.626] (-904.003) -- 0:00:43
      892500 -- (-914.215) [-898.825] (-889.624) (-917.521) * (-896.514) [-905.668] (-914.807) (-907.195) -- 0:00:43
      893000 -- (-899.971) (-902.628) [-906.099] (-933.274) * (-903.248) (-900.344) (-920.889) [-894.538] -- 0:00:42
      893500 -- (-913.016) [-896.777] (-904.952) (-916.891) * (-911.265) (-905.778) [-897.496] (-906.689) -- 0:00:42
      894000 -- (-916.086) [-893.073] (-914.271) (-914.934) * (-905.733) (-913.803) [-905.721] (-914.567) -- 0:00:42
      894500 -- (-891.341) [-900.447] (-916.828) (-899.484) * [-900.831] (-899.399) (-907.435) (-906.672) -- 0:00:42
      895000 -- [-893.911] (-912.617) (-910.824) (-909.748) * (-900.903) [-887.914] (-893.937) (-906.315) -- 0:00:42

      Average standard deviation of split frequencies: 0.010259

      895500 -- (-891.662) [-902.760] (-899.506) (-894.828) * (-909.472) (-885.143) [-902.297] (-905.164) -- 0:00:41
      896000 -- (-910.186) (-917.952) (-912.024) [-892.449] * (-902.518) [-894.732] (-907.312) (-911.227) -- 0:00:41
      896500 -- [-897.431] (-907.863) (-905.859) (-895.358) * [-888.514] (-895.527) (-909.173) (-903.009) -- 0:00:41
      897000 -- [-894.721] (-917.372) (-909.255) (-910.103) * (-888.502) (-908.645) (-907.107) [-894.786] -- 0:00:41
      897500 -- (-899.825) [-894.640] (-913.436) (-910.169) * [-891.701] (-901.311) (-921.150) (-914.538) -- 0:00:41
      898000 -- [-896.606] (-904.020) (-921.419) (-907.815) * (-894.679) (-912.556) [-899.421] (-904.341) -- 0:00:40
      898500 -- (-911.755) [-892.480] (-911.015) (-920.821) * (-902.277) [-897.745] (-918.370) (-913.563) -- 0:00:40
      899000 -- (-895.245) (-897.792) (-944.729) [-907.017] * [-892.006] (-903.041) (-910.153) (-910.437) -- 0:00:40
      899500 -- [-899.508] (-903.859) (-895.817) (-907.063) * (-899.002) [-892.416] (-913.062) (-911.963) -- 0:00:40
      900000 -- (-901.612) (-906.006) (-895.287) [-900.045] * (-901.116) [-901.119] (-921.118) (-898.294) -- 0:00:40

      Average standard deviation of split frequencies: 0.010494

      900500 -- [-901.359] (-893.384) (-914.534) (-900.590) * (-897.079) (-892.529) [-895.510] (-909.508) -- 0:00:39
      901000 -- [-892.380] (-906.674) (-915.181) (-892.162) * (-905.911) (-900.676) (-926.474) [-897.270] -- 0:00:39
      901500 -- [-904.488] (-911.085) (-898.477) (-896.377) * (-903.381) (-895.298) [-896.951] (-906.542) -- 0:00:39
      902000 -- (-904.581) (-913.564) [-895.381] (-906.544) * (-905.434) (-901.687) [-889.102] (-908.792) -- 0:00:39
      902500 -- (-918.440) (-906.665) (-901.166) [-895.170] * [-900.592] (-905.862) (-912.036) (-911.551) -- 0:00:39
      903000 -- (-916.556) (-895.859) (-897.876) [-896.138] * [-896.741] (-909.646) (-920.587) (-900.680) -- 0:00:38
      903500 -- (-921.516) (-905.091) [-897.886] (-909.637) * (-900.828) (-904.283) [-906.561] (-917.602) -- 0:00:38
      904000 -- (-917.541) (-919.818) [-896.571] (-905.852) * (-890.622) (-905.129) [-898.968] (-916.033) -- 0:00:38
      904500 -- (-914.363) (-913.554) [-905.138] (-914.460) * (-915.486) (-902.516) [-902.441] (-919.374) -- 0:00:38
      905000 -- [-896.680] (-917.534) (-924.664) (-913.286) * [-905.863] (-907.772) (-913.988) (-917.635) -- 0:00:38

      Average standard deviation of split frequencies: 0.010224

      905500 -- (-913.906) (-904.999) [-897.949] (-908.254) * (-929.303) (-896.438) (-920.398) [-897.059] -- 0:00:37
      906000 -- (-894.766) [-886.804] (-900.882) (-927.761) * (-918.461) (-900.171) (-905.959) [-887.590] -- 0:00:37
      906500 -- (-918.372) [-899.340] (-896.011) (-911.986) * (-907.690) [-890.181] (-911.188) (-890.565) -- 0:00:37
      907000 -- (-898.147) (-911.551) [-906.141] (-907.929) * (-914.047) (-900.534) (-909.190) [-889.470] -- 0:00:37
      907500 -- (-899.787) (-903.936) (-909.969) [-903.285] * [-911.177] (-908.165) (-900.169) (-897.474) -- 0:00:37
      908000 -- [-897.825] (-905.893) (-902.903) (-897.646) * (-908.034) [-893.582] (-920.220) (-908.856) -- 0:00:36
      908500 -- (-911.545) (-905.426) [-900.085] (-898.916) * (-903.050) (-900.974) (-912.982) [-904.785] -- 0:00:36
      909000 -- (-917.132) [-909.785] (-912.699) (-889.540) * (-900.527) (-903.745) (-899.728) [-900.537] -- 0:00:36
      909500 -- (-924.309) [-907.246] (-905.780) (-901.629) * (-912.231) [-895.023] (-901.734) (-903.690) -- 0:00:36
      910000 -- (-910.472) [-895.898] (-902.353) (-906.985) * (-915.572) (-911.864) (-890.642) [-899.664] -- 0:00:36

      Average standard deviation of split frequencies: 0.010224

      910500 -- (-900.903) (-907.926) [-904.650] (-914.678) * (-902.991) [-897.953] (-906.020) (-903.742) -- 0:00:35
      911000 -- (-899.002) (-921.680) [-899.844] (-904.923) * (-909.941) (-913.306) (-908.134) [-895.884] -- 0:00:35
      911500 -- (-933.837) (-914.941) [-898.262] (-912.468) * (-908.961) [-908.441] (-908.728) (-894.368) -- 0:00:35
      912000 -- [-902.493] (-899.176) (-900.088) (-900.491) * (-910.655) (-932.731) [-911.119] (-907.290) -- 0:00:35
      912500 -- (-911.216) (-903.139) [-895.379] (-903.097) * (-910.497) [-902.620] (-914.614) (-901.709) -- 0:00:35
      913000 -- (-920.462) (-920.071) (-905.461) [-888.641] * (-908.288) (-904.180) [-895.775] (-905.795) -- 0:00:34
      913500 -- (-903.660) (-917.630) (-895.059) [-908.052] * (-903.210) [-891.557] (-891.326) (-893.196) -- 0:00:34
      914000 -- (-910.358) (-903.973) [-892.616] (-911.159) * (-897.763) (-917.520) (-902.786) [-894.502] -- 0:00:34
      914500 -- (-929.317) (-913.712) [-899.293] (-917.694) * [-890.314] (-906.590) (-892.092) (-905.899) -- 0:00:34
      915000 -- (-915.844) [-891.575] (-903.576) (-900.610) * (-902.857) (-913.081) (-894.661) [-903.233] -- 0:00:34

      Average standard deviation of split frequencies: 0.009830

      915500 -- (-909.301) [-900.340] (-901.902) (-902.996) * (-909.851) [-901.516] (-908.240) (-920.522) -- 0:00:33
      916000 -- (-922.012) [-902.542] (-908.155) (-904.642) * [-911.584] (-902.560) (-904.108) (-909.318) -- 0:00:33
      916500 -- (-914.564) [-885.547] (-909.534) (-913.703) * [-894.463] (-913.944) (-908.866) (-902.857) -- 0:00:33
      917000 -- (-907.372) [-893.000] (-913.094) (-908.698) * (-906.465) (-909.610) (-915.985) [-903.524] -- 0:00:33
      917500 -- [-899.399] (-894.737) (-910.891) (-901.595) * (-908.887) [-892.139] (-915.434) (-915.074) -- 0:00:33
      918000 -- [-890.235] (-906.190) (-900.891) (-908.130) * (-903.426) (-902.454) [-908.641] (-901.331) -- 0:00:32
      918500 -- (-887.414) (-909.020) [-902.576] (-906.913) * (-908.202) (-901.624) (-914.387) [-896.550] -- 0:00:32
      919000 -- (-902.540) [-910.827] (-896.466) (-900.432) * (-916.709) [-899.286] (-908.281) (-908.003) -- 0:00:32
      919500 -- (-906.072) (-904.235) [-888.175] (-919.306) * (-909.128) [-903.533] (-899.090) (-921.650) -- 0:00:32
      920000 -- (-918.136) (-907.246) [-898.164] (-902.166) * [-890.143] (-904.916) (-902.751) (-897.418) -- 0:00:32

      Average standard deviation of split frequencies: 0.009754

      920500 -- (-927.162) (-900.076) [-893.354] (-913.360) * (-886.235) (-902.831) (-919.059) [-892.756] -- 0:00:31
      921000 -- (-929.756) (-894.884) (-890.573) [-896.799] * (-905.733) (-905.371) (-903.083) [-888.229] -- 0:00:31
      921500 -- (-908.785) (-908.606) (-891.487) [-918.432] * (-910.821) (-920.126) (-928.035) [-900.852] -- 0:00:31
      922000 -- (-906.666) (-899.434) (-926.035) [-893.736] * [-900.270] (-917.455) (-909.359) (-902.783) -- 0:00:31
      922500 -- (-909.944) (-902.375) (-916.793) [-893.379] * (-909.872) (-914.678) (-934.620) [-898.176] -- 0:00:31
      923000 -- [-896.983] (-910.444) (-909.424) (-899.355) * [-898.547] (-896.168) (-920.102) (-903.593) -- 0:00:30
      923500 -- (-912.420) (-907.819) (-918.960) [-904.093] * [-893.209] (-912.015) (-924.932) (-902.769) -- 0:00:30
      924000 -- (-892.419) (-908.627) [-899.941] (-911.381) * (-900.520) (-900.503) (-908.095) [-900.279] -- 0:00:30
      924500 -- [-892.948] (-902.505) (-897.912) (-901.596) * (-904.577) (-901.921) (-895.361) [-902.495] -- 0:00:30
      925000 -- (-908.608) (-904.068) (-907.731) [-896.620] * [-898.019] (-911.706) (-898.450) (-903.718) -- 0:00:30

      Average standard deviation of split frequencies: 0.010258

      925500 -- (-917.355) [-888.988] (-903.746) (-894.950) * [-903.584] (-904.458) (-901.925) (-913.855) -- 0:00:29
      926000 -- (-917.555) (-901.080) (-894.132) [-889.482] * (-910.792) [-900.824] (-891.811) (-909.869) -- 0:00:29
      926500 -- (-927.978) (-894.539) (-898.741) [-894.433] * (-897.936) [-898.098] (-900.213) (-913.689) -- 0:00:29
      927000 -- (-907.486) [-901.988] (-905.021) (-919.618) * [-900.753] (-912.259) (-900.123) (-921.797) -- 0:00:29
      927500 -- (-905.804) (-908.480) [-903.064] (-894.116) * (-908.063) (-898.759) [-905.108] (-904.790) -- 0:00:29
      928000 -- (-911.875) (-948.365) [-897.442] (-918.308) * [-893.424] (-907.616) (-898.800) (-913.638) -- 0:00:28
      928500 -- (-915.920) (-913.668) [-896.244] (-898.136) * (-897.221) (-899.143) (-905.312) [-893.279] -- 0:00:28
      929000 -- (-892.117) [-901.559] (-910.588) (-899.912) * [-910.439] (-917.651) (-900.804) (-901.355) -- 0:00:28
      929500 -- [-893.119] (-908.980) (-904.473) (-906.824) * (-913.046) (-896.771) (-910.180) [-899.837] -- 0:00:28
      930000 -- (-896.469) (-922.327) [-899.901] (-918.178) * [-896.082] (-911.518) (-902.322) (-918.147) -- 0:00:28

      Average standard deviation of split frequencies: 0.010054

      930500 -- [-900.354] (-910.729) (-908.530) (-900.350) * (-906.048) (-893.792) [-906.421] (-906.305) -- 0:00:27
      931000 -- [-891.899] (-902.732) (-909.845) (-893.071) * [-898.184] (-888.381) (-912.937) (-906.765) -- 0:00:27
      931500 -- (-910.225) (-916.501) [-899.501] (-904.529) * (-891.401) [-901.344] (-899.002) (-912.425) -- 0:00:27
      932000 -- [-895.830] (-899.457) (-907.675) (-896.921) * (-902.997) (-917.948) [-908.967] (-904.647) -- 0:00:27
      932500 -- (-892.315) (-915.201) (-901.936) [-897.714] * (-922.179) (-920.094) [-897.718] (-894.775) -- 0:00:27
      933000 -- (-890.644) [-897.749] (-911.804) (-908.217) * (-900.672) (-901.673) (-911.363) [-897.651] -- 0:00:26
      933500 -- (-915.754) [-898.528] (-905.668) (-893.170) * (-902.900) (-901.257) (-915.134) [-900.663] -- 0:00:26
      934000 -- (-905.272) (-903.246) (-901.529) [-893.777] * (-909.124) (-897.098) (-905.066) [-900.755] -- 0:00:26
      934500 -- (-899.012) (-914.691) [-894.767] (-900.029) * (-915.520) [-898.980] (-918.833) (-900.031) -- 0:00:26
      935000 -- (-903.446) (-888.882) (-903.583) [-895.471] * (-898.358) (-909.490) (-911.970) [-908.243] -- 0:00:26

      Average standard deviation of split frequencies: 0.010249

      935500 -- (-901.771) (-912.170) [-914.142] (-898.572) * [-892.519] (-910.481) (-900.688) (-903.299) -- 0:00:25
      936000 -- (-905.302) (-905.476) (-889.293) [-902.469] * (-896.128) (-901.236) (-931.041) [-903.358] -- 0:00:25
      936500 -- (-899.077) (-906.309) [-892.267] (-897.749) * [-893.407] (-898.781) (-936.276) (-910.351) -- 0:00:25
      937000 -- [-885.698] (-912.529) (-901.313) (-898.032) * (-915.713) [-886.310] (-930.664) (-915.248) -- 0:00:25
      937500 -- (-893.508) [-896.158] (-899.853) (-901.425) * (-914.362) [-889.365] (-913.763) (-904.268) -- 0:00:25
      938000 -- (-889.349) (-910.544) (-901.277) [-895.461] * (-907.384) [-899.788] (-911.160) (-898.824) -- 0:00:24
      938500 -- (-926.453) (-903.675) [-905.048] (-896.321) * (-905.783) (-906.345) (-896.910) [-901.878] -- 0:00:24
      939000 -- (-903.149) [-897.723] (-905.788) (-906.302) * (-904.498) (-915.270) (-900.670) [-900.625] -- 0:00:24
      939500 -- [-894.845] (-904.592) (-902.517) (-902.919) * (-897.846) (-923.433) (-910.163) [-899.975] -- 0:00:24
      940000 -- [-888.171] (-901.627) (-918.979) (-897.365) * [-889.191] (-897.192) (-904.055) (-893.328) -- 0:00:24

      Average standard deviation of split frequencies: 0.010449

      940500 -- (-908.021) (-897.659) (-932.633) [-896.895] * (-900.232) (-901.473) [-896.408] (-903.372) -- 0:00:23
      941000 -- (-899.495) [-911.014] (-907.660) (-902.740) * (-923.394) [-911.951] (-906.307) (-903.083) -- 0:00:23
      941500 -- (-917.784) (-899.581) [-898.577] (-893.911) * (-910.922) (-923.785) [-888.133] (-897.319) -- 0:00:23
      942000 -- (-912.276) (-900.405) (-903.648) [-895.351] * (-918.977) (-916.269) (-898.172) [-893.287] -- 0:00:23
      942500 -- (-907.836) (-891.071) (-907.033) [-899.943] * [-899.603] (-915.376) (-896.750) (-911.288) -- 0:00:23
      943000 -- (-910.307) [-895.669] (-911.528) (-906.023) * (-894.900) [-903.275] (-893.204) (-917.172) -- 0:00:22
      943500 -- (-898.824) (-911.056) [-903.257] (-910.868) * (-914.068) (-906.841) [-890.152] (-907.464) -- 0:00:22
      944000 -- (-897.329) (-907.755) (-910.721) [-892.643] * [-906.264] (-909.122) (-908.748) (-914.763) -- 0:00:22
      944500 -- (-905.349) [-905.991] (-929.931) (-914.137) * (-907.910) [-902.122] (-896.519) (-900.527) -- 0:00:22
      945000 -- (-902.788) [-902.315] (-909.519) (-909.653) * (-900.984) (-901.319) [-896.176] (-907.706) -- 0:00:22

      Average standard deviation of split frequencies: 0.010988

      945500 -- (-906.165) (-896.297) [-902.511] (-912.944) * (-901.646) (-904.208) (-911.838) [-905.081] -- 0:00:21
      946000 -- (-915.703) [-905.566] (-890.279) (-909.133) * (-909.346) [-897.206] (-896.909) (-892.990) -- 0:00:21
      946500 -- [-891.780] (-912.017) (-901.863) (-899.433) * (-895.278) (-907.423) [-895.187] (-900.823) -- 0:00:21
      947000 -- (-905.934) (-906.022) (-899.240) [-897.329] * (-903.824) (-915.278) [-891.487] (-898.826) -- 0:00:21
      947500 -- (-903.293) [-893.313] (-909.254) (-908.766) * (-900.727) (-899.297) [-895.427] (-904.286) -- 0:00:21
      948000 -- [-897.434] (-900.351) (-908.219) (-897.722) * (-903.656) (-901.492) (-893.750) [-894.923] -- 0:00:20
      948500 -- [-903.634] (-900.978) (-899.757) (-900.522) * (-911.226) (-897.588) (-902.438) [-895.737] -- 0:00:20
      949000 -- [-890.231] (-903.867) (-908.830) (-911.505) * (-909.148) (-913.883) (-903.835) [-885.884] -- 0:00:20
      949500 -- [-896.052] (-897.334) (-910.361) (-915.871) * [-912.499] (-904.357) (-910.508) (-901.187) -- 0:00:20
      950000 -- (-895.327) [-898.865] (-910.497) (-905.141) * [-898.981] (-910.076) (-895.632) (-905.325) -- 0:00:20

      Average standard deviation of split frequencies: 0.010884

      950500 -- [-902.374] (-904.892) (-914.737) (-922.580) * (-896.978) (-920.994) [-889.483] (-910.378) -- 0:00:19
      951000 -- (-914.802) (-904.092) [-897.101] (-923.977) * (-894.827) (-906.709) [-893.390] (-913.802) -- 0:00:19
      951500 -- (-913.816) [-892.078] (-900.640) (-915.742) * [-891.308] (-911.475) (-903.061) (-907.973) -- 0:00:19
      952000 -- (-902.938) (-897.832) (-888.796) [-897.766] * (-902.759) (-892.202) [-905.973] (-920.283) -- 0:00:19
      952500 -- (-911.855) (-899.970) (-903.869) [-902.035] * (-927.102) [-905.434] (-896.219) (-913.761) -- 0:00:19
      953000 -- [-910.959] (-923.023) (-902.442) (-913.821) * (-910.523) [-903.214] (-896.986) (-916.626) -- 0:00:18
      953500 -- (-901.595) [-904.374] (-901.288) (-916.730) * (-905.822) [-902.621] (-901.344) (-908.846) -- 0:00:18
      954000 -- (-919.520) [-894.243] (-909.979) (-899.836) * (-901.205) (-905.470) [-900.574] (-904.370) -- 0:00:18
      954500 -- (-911.372) (-898.331) [-898.735] (-903.652) * (-919.962) (-909.111) (-913.780) [-908.368] -- 0:00:18
      955000 -- (-913.212) [-895.506] (-903.668) (-906.346) * (-928.162) (-908.745) [-901.239] (-906.403) -- 0:00:18

      Average standard deviation of split frequencies: 0.010232

      955500 -- [-907.298] (-904.334) (-911.883) (-907.829) * (-920.313) [-895.669] (-905.449) (-915.785) -- 0:00:17
      956000 -- (-909.548) [-896.697] (-911.784) (-900.555) * (-918.896) [-894.226] (-896.780) (-910.376) -- 0:00:17
      956500 -- (-911.434) (-891.899) [-907.106] (-923.773) * (-908.137) (-897.410) [-890.627] (-906.041) -- 0:00:17
      957000 -- (-910.831) (-896.033) [-912.780] (-901.806) * (-915.266) (-908.136) [-889.543] (-905.208) -- 0:00:17
      957500 -- [-897.605] (-907.148) (-917.675) (-905.764) * (-894.035) (-912.799) [-905.731] (-901.750) -- 0:00:17
      958000 -- (-907.233) [-899.948] (-906.411) (-899.731) * (-914.896) (-901.267) (-914.708) [-898.661] -- 0:00:16
      958500 -- (-920.045) [-893.335] (-914.360) (-891.868) * (-910.198) (-900.822) [-900.655] (-903.390) -- 0:00:16
      959000 -- (-913.821) (-911.628) [-900.373] (-906.308) * [-898.095] (-895.521) (-903.939) (-906.359) -- 0:00:16
      959500 -- (-910.324) [-906.967] (-900.030) (-904.872) * (-884.460) (-901.916) [-911.775] (-919.149) -- 0:00:16
      960000 -- (-908.986) [-897.993] (-902.517) (-909.258) * [-888.593] (-895.816) (-911.049) (-906.614) -- 0:00:16

      Average standard deviation of split frequencies: 0.009961

      960500 -- (-917.500) (-916.381) [-891.784] (-905.393) * [-888.959] (-915.881) (-908.823) (-908.103) -- 0:00:15
      961000 -- [-898.605] (-901.229) (-905.006) (-905.445) * (-911.403) (-905.531) [-890.202] (-902.569) -- 0:00:15
      961500 -- (-905.453) (-905.631) (-915.307) [-898.178] * (-905.125) [-901.066] (-894.542) (-910.786) -- 0:00:15
      962000 -- (-893.856) [-891.127] (-906.067) (-909.155) * [-897.061] (-911.418) (-900.773) (-899.834) -- 0:00:15
      962500 -- [-907.548] (-900.246) (-899.647) (-910.794) * (-898.276) [-897.970] (-892.014) (-918.509) -- 0:00:15
      963000 -- (-922.023) (-899.932) (-903.092) [-899.000] * [-895.594] (-901.960) (-900.757) (-899.238) -- 0:00:14
      963500 -- (-908.296) (-909.769) [-906.727] (-897.133) * [-891.625] (-910.833) (-887.995) (-901.095) -- 0:00:14
      964000 -- (-909.349) (-899.730) (-900.379) [-892.676] * (-894.575) (-908.762) (-897.630) [-898.165] -- 0:00:14
      964500 -- (-913.423) (-900.129) (-902.184) [-885.257] * (-905.143) (-919.304) [-896.390] (-895.176) -- 0:00:14
      965000 -- (-901.446) [-900.669] (-902.403) (-896.163) * (-899.219) (-918.925) [-900.562] (-915.069) -- 0:00:14

      Average standard deviation of split frequencies: 0.010419

      965500 -- (-915.598) [-895.965] (-905.728) (-907.781) * [-891.199] (-909.038) (-897.342) (-900.742) -- 0:00:13
      966000 -- [-896.398] (-908.083) (-910.232) (-897.911) * (-889.074) (-914.600) [-893.796] (-892.526) -- 0:00:13
      966500 -- (-921.076) [-896.382] (-924.125) (-908.688) * (-895.347) (-896.377) [-886.183] (-918.187) -- 0:00:13
      967000 -- (-898.962) (-909.565) (-926.332) [-896.643] * (-912.734) (-898.704) [-888.066] (-908.643) -- 0:00:13
      967500 -- (-911.301) [-899.523] (-924.235) (-897.720) * [-900.081] (-900.647) (-905.324) (-907.683) -- 0:00:13
      968000 -- (-896.735) [-910.032] (-912.332) (-904.208) * (-910.242) [-902.914] (-911.554) (-902.191) -- 0:00:12
      968500 -- (-910.496) [-894.609] (-919.318) (-907.861) * (-901.700) [-902.452] (-910.942) (-910.634) -- 0:00:12
      969000 -- (-917.297) (-906.969) (-910.770) [-901.514] * (-912.899) (-899.097) (-920.397) [-909.028] -- 0:00:12
      969500 -- (-907.521) (-894.041) [-899.394] (-907.020) * (-911.671) (-920.921) [-918.643] (-900.459) -- 0:00:12
      970000 -- (-915.470) (-905.453) [-901.118] (-914.514) * [-894.056] (-908.082) (-906.034) (-907.023) -- 0:00:12

      Average standard deviation of split frequencies: 0.010004

      970500 -- [-896.307] (-901.646) (-919.314) (-900.056) * (-900.804) (-912.646) (-910.503) [-888.934] -- 0:00:11
      971000 -- (-897.352) (-901.638) [-898.205] (-922.257) * [-896.410] (-902.603) (-919.074) (-905.786) -- 0:00:11
      971500 -- (-927.601) (-896.219) (-906.239) [-908.551] * [-897.595] (-917.802) (-901.383) (-898.637) -- 0:00:11
      972000 -- (-908.855) (-898.528) [-893.413] (-900.705) * (-897.753) [-904.646] (-892.217) (-908.346) -- 0:00:11
      972500 -- [-895.651] (-897.760) (-903.202) (-897.276) * [-897.845] (-909.002) (-898.452) (-901.552) -- 0:00:11
      973000 -- (-910.515) (-898.185) [-892.983] (-902.539) * [-897.714] (-901.533) (-920.773) (-910.130) -- 0:00:10
      973500 -- [-890.859] (-906.113) (-919.211) (-897.812) * (-904.363) (-903.815) (-912.747) [-902.131] -- 0:00:10
      974000 -- (-903.648) (-900.498) (-908.698) [-900.351] * (-913.427) (-894.996) [-900.803] (-905.122) -- 0:00:10
      974500 -- [-909.426] (-897.704) (-887.888) (-915.659) * [-912.883] (-901.912) (-897.695) (-909.695) -- 0:00:10
      975000 -- (-911.692) (-891.634) (-906.695) [-893.167] * (-913.891) (-917.320) (-901.583) [-897.213] -- 0:00:10

      Average standard deviation of split frequencies: 0.009829

      975500 -- (-907.195) [-904.805] (-911.765) (-892.789) * (-911.711) [-901.226] (-911.333) (-899.372) -- 0:00:09
      976000 -- (-920.433) (-906.549) [-903.321] (-902.039) * [-905.777] (-908.265) (-905.638) (-906.825) -- 0:00:09
      976500 -- (-919.663) (-904.505) [-909.153] (-898.194) * (-919.721) (-901.803) [-912.971] (-910.240) -- 0:00:09
      977000 -- (-904.166) [-894.269] (-906.400) (-917.556) * (-903.370) [-891.963] (-908.667) (-905.859) -- 0:00:09
      977500 -- (-895.375) (-901.452) [-906.184] (-912.978) * (-903.787) (-891.399) (-918.916) [-888.060] -- 0:00:09
      978000 -- (-894.744) (-891.377) (-902.112) [-910.073] * (-926.856) [-901.946] (-914.719) (-903.528) -- 0:00:08
      978500 -- (-895.942) (-916.998) [-890.829] (-914.528) * [-890.214] (-903.876) (-908.302) (-910.695) -- 0:00:08
      979000 -- (-900.480) [-896.283] (-905.576) (-910.364) * (-902.816) [-898.331] (-908.675) (-900.968) -- 0:00:08
      979500 -- (-898.846) [-895.150] (-897.346) (-931.825) * (-890.528) (-891.090) (-907.736) [-895.818] -- 0:00:08
      980000 -- (-906.021) (-921.783) [-896.546] (-905.990) * (-902.214) [-901.134] (-903.634) (-900.437) -- 0:00:08

      Average standard deviation of split frequencies: 0.009782

      980500 -- (-912.494) (-910.296) [-895.974] (-902.283) * (-914.708) (-908.341) [-894.190] (-914.010) -- 0:00:07
      981000 -- (-910.374) (-892.312) [-895.720] (-899.181) * [-893.230] (-902.642) (-896.797) (-910.255) -- 0:00:07
      981500 -- [-904.677] (-906.437) (-906.129) (-900.801) * (-894.592) (-925.815) [-890.345] (-909.790) -- 0:00:07
      982000 -- [-910.499] (-901.053) (-897.422) (-916.989) * (-916.764) (-900.292) [-888.885] (-897.999) -- 0:00:07
      982500 -- (-930.717) (-905.660) [-898.646] (-899.260) * (-899.802) [-896.561] (-908.050) (-905.485) -- 0:00:07
      983000 -- (-911.439) [-899.081] (-905.673) (-901.708) * (-900.025) [-892.240] (-894.695) (-903.571) -- 0:00:06
      983500 -- (-893.845) [-908.240] (-913.876) (-907.412) * [-900.049] (-913.664) (-920.555) (-913.633) -- 0:00:06
      984000 -- (-897.550) (-918.713) (-910.143) [-896.425] * (-903.730) (-910.747) (-903.383) [-906.347] -- 0:00:06
      984500 -- (-899.652) (-909.338) (-899.725) [-901.225] * [-906.142] (-903.613) (-907.026) (-903.443) -- 0:00:06
      985000 -- [-901.936] (-902.387) (-902.263) (-922.019) * (-904.054) (-903.007) (-908.744) [-896.065] -- 0:00:06

      Average standard deviation of split frequencies: 0.009849

      985500 -- (-902.609) (-906.708) [-902.352] (-916.848) * (-926.500) (-899.390) (-900.872) [-901.712] -- 0:00:05
      986000 -- (-901.462) [-900.158] (-917.755) (-890.973) * (-915.373) [-891.104] (-900.909) (-907.642) -- 0:00:05
      986500 -- (-912.254) (-904.934) (-901.783) [-907.945] * (-898.404) (-907.985) (-900.293) [-897.446] -- 0:00:05
      987000 -- [-900.808] (-902.641) (-910.435) (-932.398) * [-896.231] (-918.619) (-923.608) (-898.892) -- 0:00:05
      987500 -- [-896.927] (-900.472) (-898.136) (-909.601) * (-895.730) (-923.879) [-914.531] (-895.020) -- 0:00:05
      988000 -- (-912.711) [-903.949] (-896.295) (-915.122) * [-891.378] (-912.377) (-903.140) (-898.806) -- 0:00:04
      988500 -- (-897.464) (-909.300) [-894.874] (-902.844) * [-902.404] (-916.705) (-903.059) (-891.167) -- 0:00:04
      989000 -- (-900.777) [-890.731] (-902.571) (-902.436) * (-905.732) (-908.836) [-907.934] (-901.952) -- 0:00:04
      989500 -- (-910.164) [-895.899] (-905.501) (-895.474) * (-914.422) (-903.951) [-893.696] (-896.816) -- 0:00:04
      990000 -- (-915.807) [-897.879] (-900.570) (-911.133) * (-918.246) (-906.027) [-904.164] (-900.919) -- 0:00:04

      Average standard deviation of split frequencies: 0.009921

      990500 -- (-890.304) (-923.176) [-898.840] (-914.547) * (-910.086) (-907.992) (-897.275) [-898.358] -- 0:00:03
      991000 -- (-912.898) [-894.345] (-898.808) (-902.048) * (-900.597) (-903.065) (-901.920) [-896.680] -- 0:00:03
      991500 -- (-910.255) (-908.503) [-904.451] (-899.285) * (-897.000) [-896.682] (-909.655) (-907.402) -- 0:00:03
      992000 -- (-910.676) (-904.399) [-891.971] (-901.214) * (-904.134) (-892.070) (-916.708) [-900.120] -- 0:00:03
      992500 -- [-896.212] (-911.191) (-912.504) (-896.548) * (-914.193) [-899.344] (-902.104) (-911.424) -- 0:00:03
      993000 -- [-897.306] (-903.765) (-904.766) (-914.906) * (-897.980) (-893.205) [-898.515] (-909.787) -- 0:00:02
      993500 -- (-924.696) [-897.122] (-918.460) (-917.348) * (-905.024) (-921.404) [-908.377] (-918.804) -- 0:00:02
      994000 -- (-900.808) [-898.714] (-905.523) (-911.448) * [-903.734] (-909.904) (-896.981) (-921.722) -- 0:00:02
      994500 -- (-905.089) [-895.512] (-910.411) (-914.537) * (-915.993) (-907.209) [-895.725] (-914.732) -- 0:00:02
      995000 -- [-899.231] (-924.178) (-903.734) (-910.468) * (-907.685) (-906.038) (-903.638) [-890.561] -- 0:00:02

      Average standard deviation of split frequencies: 0.009845

      995500 -- [-895.528] (-922.657) (-910.433) (-902.129) * (-914.302) (-898.621) [-893.301] (-895.648) -- 0:00:01
      996000 -- (-912.564) [-902.911] (-916.345) (-901.690) * (-904.999) (-905.653) [-893.834] (-902.290) -- 0:00:01
      996500 -- (-923.419) [-899.341] (-918.935) (-898.964) * (-914.547) [-901.187] (-901.266) (-902.341) -- 0:00:01
      997000 -- (-914.569) (-900.855) [-895.916] (-900.572) * (-916.956) (-900.618) (-900.797) [-907.170] -- 0:00:01
      997500 -- (-910.606) (-917.143) (-907.604) [-892.940] * (-906.372) (-907.138) (-910.647) [-889.576] -- 0:00:01
      998000 -- (-896.215) [-906.814] (-914.600) (-888.009) * (-902.750) (-903.947) (-897.451) [-897.077] -- 0:00:00
      998500 -- [-910.268] (-919.350) (-889.725) (-906.140) * (-925.083) (-897.861) [-901.871] (-915.458) -- 0:00:00
      999000 -- (-897.761) (-929.824) [-888.679] (-901.928) * [-906.347] (-903.695) (-907.483) (-902.868) -- 0:00:00
      999500 -- (-909.971) (-902.971) [-904.855] (-904.820) * (-908.951) [-914.234] (-907.883) (-910.863) -- 0:00:00
      1000000 -- [-894.705] (-917.479) (-918.765) (-897.057) * [-893.819] (-898.024) (-915.822) (-904.241) -- 0:00:00

      Average standard deviation of split frequencies: 0.009799
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -894.705036 -- 29.201790
         Chain 1 -- -894.705046 -- 29.201790
         Chain 2 -- -917.479358 -- 24.824189
         Chain 2 -- -917.479358 -- 24.824189
         Chain 3 -- -918.764817 -- 27.397777
         Chain 3 -- -918.764794 -- 27.397777
         Chain 4 -- -897.056924 -- 28.326873
         Chain 4 -- -897.056924 -- 28.326873
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -893.818746 -- 29.859277
         Chain 1 -- -893.818746 -- 29.859277
         Chain 2 -- -898.023902 -- 26.978784
         Chain 2 -- -898.023906 -- 26.978784
         Chain 3 -- -915.821512 -- 21.861639
         Chain 3 -- -915.821503 -- 21.861639
         Chain 4 -- -904.241063 -- 27.569769
         Chain 4 -- -904.241069 -- 27.569769

      Analysis completed in 6 mins 41 seconds
      Analysis used 401.81 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -877.53
      Likelihood of best state for "cold" chain of run 2 was -879.06

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            51.6 %     ( 45 %)     Dirichlet(Revmat{all})
            68.6 %     ( 57 %)     Slider(Revmat{all})
            36.4 %     ( 25 %)     Dirichlet(Pi{all})
            37.6 %     ( 20 %)     Slider(Pi{all})
            37.7 %     ( 26 %)     Multiplier(Alpha{1,2})
            47.3 %     ( 34 %)     Multiplier(Alpha{3})
            65.3 %     ( 25 %)     Slider(Pinvar{all})
            57.5 %     ( 66 %)     ExtSPR(Tau{all},V{all})
            21.4 %     ( 25 %)     ExtTBR(Tau{all},V{all})
            66.0 %     ( 67 %)     NNI(Tau{all},V{all})
            53.8 %     ( 64 %)     ParsSPR(Tau{all},V{all})
            27.2 %     ( 29 %)     Multiplier(V{all})
            58.0 %     ( 60 %)     Nodeslider(V{all})
            26.0 %     ( 21 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            52.5 %     ( 42 %)     Dirichlet(Revmat{all})
            68.8 %     ( 55 %)     Slider(Revmat{all})
            37.5 %     ( 33 %)     Dirichlet(Pi{all})
            37.8 %     ( 21 %)     Slider(Pi{all})
            37.6 %     ( 26 %)     Multiplier(Alpha{1,2})
            47.6 %     ( 28 %)     Multiplier(Alpha{3})
            64.3 %     ( 37 %)     Slider(Pinvar{all})
            57.7 %     ( 61 %)     ExtSPR(Tau{all},V{all})
            21.6 %     ( 26 %)     ExtTBR(Tau{all},V{all})
            66.3 %     ( 66 %)     NNI(Tau{all},V{all})
            53.6 %     ( 47 %)     ParsSPR(Tau{all},V{all})
            27.3 %     ( 34 %)     Multiplier(V{all})
            58.2 %     ( 61 %)     Nodeslider(V{all})
            26.1 %     ( 23 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.62    0.35    0.17 
         2 |  166574            0.65    0.37 
         3 |  166630  166926            0.67 
         4 |  166603  166770  166497         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.62    0.34    0.17 
         2 |  166976            0.65    0.37 
         3 |  166889  166436            0.66 
         4 |  166684  166131  166884         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -894.85
      |                               1                            |
      |                               2          2                 |
      |2                                               1 2         |
      |        *   1    2            1             1      2        |
      |   2          12   1                        2         1     |
      |      2    1   1          2         1   22    11     1    2 |
      |  1  2    2         112            *     1   22 211    2    |
      |       2 2   1  2 22221 2  1  2 122  *     1   2     2 12  1|
      | 1   11    2                 2  2 1   *      1           2  |
      |   1*    11   2   1    212              1 12       12    1  |
      |1 2         2    1         2*                    2          |
      | 2     1        1      1 11      1     1            1 2 1  2|
      |             2               1                              |
      |                                       2                    |
      |                                    2                     1 |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -901.33
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -887.53          -913.93
        2       -887.57          -913.11
      --------------------------------------
      TOTAL     -887.55          -913.60
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         1.300527    0.043026    0.915982    1.704101    1.280521   1165.79   1316.67    1.000
      r(A<->C){all}   0.058255    0.000512    0.019518    0.105700    0.055677    654.21    714.43    1.000
      r(A<->G){all}   0.127391    0.001397    0.061657    0.201820    0.123346    808.09    815.21    1.000
      r(A<->T){all}   0.051789    0.000687    0.006683    0.103001    0.048009    696.51    797.61    1.000
      r(C<->G){all}   0.031111    0.000259    0.004645    0.063440    0.028918    966.08    979.90    1.000
      r(C<->T){all}   0.675380    0.003695    0.558757    0.791371    0.679130    641.62    712.42    1.000
      r(G<->T){all}   0.056074    0.000575    0.015137    0.104595    0.052951    807.70    873.45    1.000
      pi(A){all}      0.259548    0.000681    0.203418    0.306126    0.258711    801.38    872.05    1.000
      pi(C){all}      0.265909    0.000615    0.217328    0.313980    0.265031   1086.55   1130.95    1.000
      pi(G){all}      0.234106    0.000622    0.183494    0.280000    0.233549   1019.79   1159.56    1.000
      pi(T){all}      0.240437    0.000557    0.193100    0.286278    0.239537   1112.39   1132.00    1.000
      alpha{1,2}      0.270047    0.005681    0.145839    0.412255    0.256582    989.21   1119.05    1.000
      alpha{3}        2.172421    0.611152    0.921732    3.784606    2.050679   1429.54   1446.20    1.000
      pinvar{all}     0.072886    0.003304    0.000048    0.183398    0.059947   1215.79   1321.85    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8
      9 -- C9
     10 -- C10
     11 -- C11
     12 -- C12
     13 -- C13
     14 -- C14
     15 -- C15
     16 -- C16
     17 -- C17
     18 -- C18
     19 -- C19

   Key to taxon bipartitions (saved to file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   -------------------------
    1 -- .******************
    2 -- .*.................
    3 -- ..*................
    4 -- ...*...............
    5 -- ....*..............
    6 -- .....*.............
    7 -- ......*............
    8 -- .......*...........
    9 -- ........*..........
   10 -- .........*.........
   11 -- ..........*........
   12 -- ...........*.......
   13 -- ............*......
   14 -- .............*.....
   15 -- ..............*....
   16 -- ...............*...
   17 -- ................*..
   18 -- .................*.
   19 -- ..................*
   20 -- .*..*********.****.
   21 -- ..............***..
   22 -- .............*....*
   23 -- ....*.*******.****.
   24 -- ..............****.
   25 -- .************.****.
   26 -- ....*********.****.
   27 -- ..............**...
   28 -- .*..***************
   29 -- ...............**..
   30 -- ..............*.*..
   31 -- .**.*********.****.
   32 -- .*..*.*******.****.
   33 -- ..**...............
   34 -- .*.**********.****.
   35 -- .**.***************
   36 -- .*..*********.*****
   37 -- .*.****************
   38 -- .*...*.............
   39 -- .....*..*..........
   -------------------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
   20  3002    1.000000    0.000000    1.000000    1.000000    2
   21  2987    0.995003    0.002355    0.993338    0.996669    2
   22  2363    0.787142    0.008951    0.780813    0.793471    2
   23  1336    0.445037    0.017901    0.432378    0.457695    2
   24  1291    0.430047    0.008009    0.424384    0.435710    2
   25  1234    0.411059    0.013191    0.401732    0.420386    2
   26  1100    0.366422    0.027323    0.347102    0.385743    2
   27  1043    0.347435    0.016488    0.335776    0.359094    2
   28  1011    0.336775    0.003298    0.334444    0.339107    2
   29   999    0.332778    0.000471    0.332445    0.333111    2
   30   955    0.318121    0.017430    0.305796    0.330446    2
   31   878    0.292472    0.000942    0.291805    0.293138    2
   32   872    0.290473    0.020728    0.275816    0.305130    2
   33   676    0.225183    0.002827    0.223185    0.227182    2
   34   641    0.213524    0.005182    0.209860    0.217189    2
   35   527    0.175550    0.005182    0.171885    0.179214    2
   36   477    0.158894    0.000471    0.158561    0.159227    2
   37   435    0.144903    0.008951    0.138574    0.151233    2
   38   431    0.143571    0.010835    0.135909    0.151233    2
   39   330    0.109927    0.025439    0.091939    0.127915    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.256130    0.005604    0.134852    0.409408    0.245286    1.000    2
   length{all}[2]     0.036440    0.000407    0.003087    0.074858    0.033199    1.000    2
   length{all}[3]     0.048453    0.000617    0.007049    0.095604    0.044698    1.000    2
   length{all}[4]     0.035564    0.000467    0.000391    0.075757    0.031491    1.000    2
   length{all}[5]     0.020942    0.000157    0.001845    0.045212    0.018358    1.000    2
   length{all}[6]     0.049232    0.000562    0.007745    0.095544    0.046592    1.001    2
   length{all}[7]     0.020974    0.000170    0.001696    0.047281    0.018220    1.000    2
   length{all}[8]     0.014195    0.000109    0.000034    0.035506    0.011656    1.000    2
   length{all}[9]     0.020285    0.000163    0.000690    0.045241    0.017742    1.000    2
   length{all}[10]    0.021523    0.000181    0.001259    0.047733    0.018802    1.002    2
   length{all}[11]    0.028164    0.000235    0.004794    0.057947    0.025318    1.000    2
   length{all}[12]    0.022045    0.000191    0.001940    0.050617    0.019089    1.000    2
   length{all}[13]    0.021859    0.000180    0.002484    0.048457    0.019186    1.000    2
   length{all}[14]    0.089333    0.001427    0.025517    0.166667    0.083236    1.000    2
   length{all}[15]    0.013966    0.000108    0.000251    0.033616    0.011622    1.000    2
   length{all}[16]    0.014105    0.000109    0.000067    0.034409    0.011648    1.000    2
   length{all}[17]    0.021283    0.000161    0.002463    0.046276    0.019112    1.000    2
   length{all}[18]    0.018492    0.000160    0.000426    0.043291    0.015818    1.000    2
   length{all}[19]    0.090333    0.001419    0.027027    0.166983    0.084491    1.000    2
   length{all}[20]    0.225823    0.004356    0.109164    0.356243    0.218058    1.002    2
   length{all}[21]    0.025157    0.000220    0.002058    0.054415    0.022239    1.001    2
   length{all}[22]    0.058651    0.001161    0.000256    0.123212    0.053774    1.001    2
   length{all}[23]    0.016469    0.000157    0.000034    0.042058    0.013233    0.999    2
   length{all}[24]    0.013409    0.000113    0.000128    0.033548    0.010808    0.999    2
   length{all}[25]    0.036305    0.000728    0.000002    0.088137    0.031060    1.000    2
   length{all}[26]    0.020934    0.000296    0.000008    0.054502    0.017130    1.000    2
   length{all}[27]    0.006891    0.000050    0.000005    0.021628    0.004567    0.999    2
   length{all}[28]    0.039197    0.000837    0.000169    0.096626    0.032686    0.999    2
   length{all}[29]    0.007403    0.000059    0.000006    0.022879    0.005089    1.005    2
   length{all}[30]    0.007284    0.000053    0.000002    0.021391    0.004793    0.999    2
   length{all}[31]    0.025134    0.000382    0.000009    0.062765    0.020566    1.001    2
   length{all}[32]    0.022318    0.000309    0.000065    0.058800    0.018224    0.999    2
   length{all}[33]    0.020904    0.000403    0.000069    0.058160    0.015073    0.999    2
   length{all}[34]    0.024180    0.000418    0.000006    0.061416    0.018752    0.999    2
   length{all}[35]    0.016843    0.000264    0.000004    0.048733    0.011720    0.999    2
   length{all}[36]    0.041789    0.000734    0.000221    0.092973    0.037021    0.999    2
   length{all}[37]    0.015095    0.000229    0.000005    0.046782    0.010440    0.998    2
   length{all}[38]    0.013170    0.000138    0.000016    0.035475    0.009796    0.998    2
   length{all}[39]    0.014144    0.000160    0.000476    0.034495    0.011006    0.997    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.009799
       Maximum standard deviation of split frequencies = 0.027323
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.005


   Clade credibility values:

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |---------------------------------------------------------------------- C3 (3)
   |                                                                               
   |---------------------------------------------------------------------- C4 (4)
   |                                                                               
   |                      /----------------------------------------------- C2 (2)
   |                      |                                                        
   |                      |----------------------------------------------- C5 (5)
   |                      |                                                        
   |                      |----------------------------------------------- C6 (6)
   |                      |                                                        
   |                      |----------------------------------------------- C7 (7)
   |                      |                                                        
   |                      |----------------------------------------------- C8 (8)
   |                      |                                                        
   |                      |----------------------------------------------- C9 (9)
   |                      |                                                        
   +                      |----------------------------------------------- C10 (10)
   |----------100---------+                                                        
   |                      |----------------------------------------------- C11 (11)
   |                      |                                                        
   |                      |----------------------------------------------- C12 (12)
   |                      |                                                        
   |                      |----------------------------------------------- C13 (13)
   |                      |                                                        
   |                      |                       /----------------------- C15 (15)
   |                      |                       |                                
   |                      |----------100----------+----------------------- C16 (16)
   |                      |                       |                                
   |                      |                       \----------------------- C17 (17)
   |                      |                                                        
   |                      \----------------------------------------------- C18 (18)
   |                                                                               
   |                                              /----------------------- C14 (14)
   \----------------------79----------------------+                                
                                                  \----------------------- C19 (19)
                                                                                   

   Phylogram (based on average branch lengths):

   /------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------ C3 (3)
   |                                                                               
   |-------- C4 (4)
   |                                                                               
   |                                                          /--------- C2 (2)
   |                                                          |                    
   |                                                          |----- C5 (5)
   |                                                          |                    
   |                                                          |------------ C6 (6)
   |                                                          |                    
   |                                                          |----- C7 (7)
   |                                                          |                    
   |                                                          |--- C8 (8)
   |                                                          |                    
   |                                                          |----- C9 (9)
   |                                                          |                    
   +                                                          |----- C10 (10)
   |----------------------------------------------------------+                    
   |                                                          |------- C11 (11)
   |                                                          |                    
   |                                                          |----- C12 (12)
   |                                                          |                    
   |                                                          |----- C13 (13)
   |                                                          |                    
   |                                                          |     /--- C15 (15)
   |                                                          |     |              
   |                                                          |-----+--- C16 (16)
   |                                                          |     |              
   |                                                          |     \----- C17 (17)
   |                                                          |                    
   |                                                          \---- C18 (18)
   |                                                                               
   |              /---------------------- C14 (14)
   \--------------+                                                                
                  \---------------------- C19 (19)
                                                                                   
   |------------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3002 trees sampled):
      50 % credible set contains 1501 trees
      90 % credible set contains 2702 trees
      95 % credible set contains 2852 trees
      99 % credible set contains 2972 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 19  	ls = 225
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Reading seq # 9: C9     
Reading seq #10: C10     
Reading seq #11: C11     
Reading seq #12: C12     
Reading seq #13: C13     
Reading seq #14: C14     
Reading seq #15: C15     
Reading seq #16: C16     
Reading seq #17: C17     
Reading seq #18: C18     
Reading seq #19: C19     
Sequences read..
Counting site patterns..  0:00

          71 patterns at       75 /       75 sites (100.0%),  0:00
Counting codons..
NG distances for seqs.:
   1   2   3   4   5   6   7   8   9  10  11  12  13  14  15  16  17  18  19

     1368 bytes for distance
    69296 bytes for conP
     9656 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
   1    3.289796
   2    3.088726
   3    3.054951
   4    3.051603
   5    3.051008
   6    3.050948
   7    3.050934
   8    3.050933
   138592 bytes for conP, adjusted

    0.193931    0.053516    0.040854    0.300597    0.067493    0.058670    0.069542    0.040829    0.043531    0.032067    0.043443    0.052146    0.034070    0.031423    0.033366    0.040054    0.037751    0.030127    0.038386    0.117683    0.237664    0.000000    0.300000    1.300000

ntime & nrate & np:    22     2    24

Bounds (np=24):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    24
lnL0 = -1058.673010

Iterating by ming2
Initial: fx=  1058.673010
x=  0.19393  0.05352  0.04085  0.30060  0.06749  0.05867  0.06954  0.04083  0.04353  0.03207  0.04344  0.05215  0.03407  0.03142  0.03337  0.04005  0.03775  0.03013  0.03839  0.11768  0.23766  0.00000  0.30000  1.30000

  1 h-m-p  0.0000 0.0008 3916.7279 +YYYYCC  1033.035571  5 0.0000    36 | 0/24
  2 h-m-p  0.0002 0.0008 253.3538 +CYCYCCC  1000.772168  6 0.0007    74 | 0/24
  3 h-m-p  0.0001 0.0003 866.2544 +YYYYCYCCC   984.860142  8 0.0002   113 | 0/24
  4 h-m-p  0.0000 0.0002 2269.4144 +YYCCCC   970.525486  5 0.0001   149 | 0/24
  5 h-m-p  0.0001 0.0004 2742.3692 YYCCC   956.462143  4 0.0001   182 | 0/24
  6 h-m-p  0.0005 0.0025 280.3080 YYCCCC   948.172244  5 0.0008   217 | 0/24
  7 h-m-p  0.0003 0.0016 160.5467 +YYYYYCCCCC   934.686933  9 0.0013   258 | 0/24
  8 h-m-p  0.0001 0.0003 730.1317 YCYCCC   929.645316  5 0.0001   293 | 0/24
  9 h-m-p  0.0003 0.0015 176.8612 +YYCCCC   922.253457  5 0.0010   329 | 0/24
 10 h-m-p  0.0001 0.0004 643.6280 +YYCYCCC   914.761124  6 0.0003   366 | 0/24
 11 h-m-p  0.0000 0.0002 2955.3564 +YYCYCCC   896.937178  6 0.0001   403 | 0/24
 12 h-m-p  0.0015 0.0073  23.4034 YCCC    896.741767  3 0.0008   435 | 0/24
 13 h-m-p  0.0007 0.0209  26.4804 +CYC    896.229036  2 0.0024   466 | 0/24
 14 h-m-p  0.0026 0.0128   7.9451 YCC     896.151026  2 0.0016   496 | 0/24
 15 h-m-p  0.0012 0.0087  10.0192 CCC     896.043044  2 0.0015   527 | 0/24
 16 h-m-p  0.0017 0.0328   8.3574 +YC     895.614162  1 0.0046   556 | 0/24
 17 h-m-p  0.0017 0.0087  20.7337 YCCCC   894.098458  4 0.0037   590 | 0/24
 18 h-m-p  0.0019 0.0095  30.3488 +YCYCCC   888.732368  5 0.0055   626 | 0/24
 19 h-m-p  0.0008 0.0041  31.4364 CYCCC   888.086816  4 0.0013   660 | 0/24
 20 h-m-p  0.0021 0.0106  11.4636 CYCCC   887.805967  4 0.0035   694 | 0/24
 21 h-m-p  0.0061 0.0333   6.5413 YC      887.695942  1 0.0031   722 | 0/24
 22 h-m-p  0.0030 0.0670   6.6587 +YCC    887.314472  2 0.0077   753 | 0/24
 23 h-m-p  0.0023 0.0117   6.4980 CYCCC   886.876453  4 0.0044   787 | 0/24
 24 h-m-p  0.0021 0.0254  13.2642 +YCCC   884.087474  3 0.0092   820 | 0/24
 25 h-m-p  0.0009 0.0047  30.6416 YCCCC   883.277553  4 0.0018   854 | 0/24
 26 h-m-p  0.0125 0.0626   0.9974 +YYCCCC   882.541475  5 0.0393   890 | 0/24
 27 h-m-p  0.0041 0.0205   8.3679 +YYCCCC   877.458351  5 0.0135   950 | 0/24
 28 h-m-p  0.1568 0.7840   0.1839 +YCYCCC   873.754160  5 0.4708   986 | 0/24
 29 h-m-p  0.1083 0.5413   0.2239 +YYCCCC   870.753774  5 0.3467  1046 | 0/24
 30 h-m-p  0.1464 0.7321   0.2428 +YYYCCC   865.556423  5 0.5287  1105 | 0/24
 31 h-m-p  0.1403 0.7016   0.3165 +YYYYYYYCCC   858.535397  9 0.5626  1168 | 0/24
 32 h-m-p  0.0863 0.4316   0.1806 +YYCYCC   857.119931  5 0.2937  1227 | 0/24
 33 h-m-p  0.0977 0.4885   0.2763 +YYCCCC   855.633746  5 0.3114  1287 | 0/24
 34 h-m-p  0.2479 1.2393   0.2474 CC      854.611835  1 0.3959  1340 | 0/24
 35 h-m-p  0.3685 2.1990   0.2658 +YCCC   852.796285  3 1.0239  1397 | 0/24
 36 h-m-p  0.5287 2.6434   0.2836 +YYCCC   850.368729  4 1.6386  1455 | 0/24
 37 h-m-p  0.2710 1.3548   0.5207 CCCC    849.414261  3 0.4096  1512 | 0/24
 38 h-m-p  0.5359 2.6796   0.3251 YCCCC   848.154252  4 1.2058  1570 | 0/24
 39 h-m-p  1.1591 5.7953   0.2019 CCCC    847.580242  3 1.5959  1627 | 0/24
 40 h-m-p  1.6000 8.0000   0.1111 CCC     847.335220  2 1.4787  1682 | 0/24
 41 h-m-p  1.6000 8.0000   0.0994 CCC     847.046207  2 1.8305  1737 | 0/24
 42 h-m-p  1.6000 8.0000   0.0626 CCCC    846.856820  3 1.9166  1794 | 0/24
 43 h-m-p  1.6000 8.0000   0.0107 CCC     846.783165  2 2.0643  1849 | 0/24
 44 h-m-p  1.6000 8.0000   0.0031 YCC     846.731475  2 2.7265  1903 | 0/24
 45 h-m-p  0.8786 8.0000   0.0097 +CCC    846.620337  2 3.9964  1959 | 0/24
 46 h-m-p  1.6000 8.0000   0.0222 YCCC    846.405845  3 3.2582  2015 | 0/24
 47 h-m-p  1.0374 8.0000   0.0699 YC      846.227858  1 2.3028  2067 | 0/24
 48 h-m-p  1.4984 8.0000   0.1074 CCC     846.093655  2 2.0613  2122 | 0/24
 49 h-m-p  1.6000 8.0000   0.0861 CYC     846.044221  2 1.5116  2176 | 0/24
 50 h-m-p  1.6000 8.0000   0.0032 C       846.032808  0 1.6000  2227 | 0/24
 51 h-m-p  0.6013 8.0000   0.0084 YC      846.030901  1 1.1808  2279 | 0/24
 52 h-m-p  1.6000 8.0000   0.0027 YC      846.030596  1 1.2398  2331 | 0/24
 53 h-m-p  1.6000 8.0000   0.0005 C       846.030516  0 1.9528  2382 | 0/24
 54 h-m-p  1.6000 8.0000   0.0003 +YC     846.030395  1 4.9438  2435 | 0/24
 55 h-m-p  1.6000 8.0000   0.0003 +YC     846.030069  1 5.0196  2488 | 0/24
 56 h-m-p  0.8402 8.0000   0.0015 +YC     846.029866  1 2.1116  2541 | 0/24
 57 h-m-p  1.5285 8.0000   0.0021 C       846.029818  0 1.7505  2592 | 0/24
 58 h-m-p  1.6000 8.0000   0.0004 Y       846.029794  0 3.1366  2643 | 0/24
 59 h-m-p  1.6000 8.0000   0.0002 C       846.029788  0 1.7676  2694 | 0/24
 60 h-m-p  1.6000 8.0000   0.0002 C       846.029787  0 2.0019  2745 | 0/24
 61 h-m-p  1.6000 8.0000   0.0001 Y       846.029787  0 2.7943  2796 | 0/24
 62 h-m-p  1.6000 8.0000   0.0001 C       846.029786  0 1.5494  2847 | 0/24
 63 h-m-p  1.6000 8.0000   0.0000 Y       846.029786  0 1.2718  2898 | 0/24
 64 h-m-p  1.6000 8.0000   0.0000 Y       846.029786  0 1.2065  2949 | 0/24
 65 h-m-p  1.6000 8.0000   0.0000 Y       846.029786  0 0.3103  3000 | 0/24
 66 h-m-p  0.3215 8.0000   0.0000 -C      846.029786  0 0.0201  3052
Out..
lnL  =  -846.029786
3053 lfun, 3053 eigenQcodon, 67166 P(t)

Time used:  0:12


Model 1: NearlyNeutral

TREE #  1
(1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
   1    5.835775
   2    4.958630
   3    4.901184
   4    4.887692
   5    4.885895
   6    4.885575
   7    4.885551
   8    4.885546
   9    4.885544
    0.162410    0.050831    0.014924    0.282549    0.054719    0.043553    0.094635    0.026003    0.021598    0.029438    0.056632    0.039850    0.048432    0.039213    0.041892    0.050008    0.050507    0.065086    0.015465    0.089449    0.182488    0.000000    4.985594    0.703908    0.264508

ntime & nrate & np:    22     2    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 4.245627

np =    25
lnL0 =  -902.745405

Iterating by ming2
Initial: fx=   902.745405
x=  0.16241  0.05083  0.01492  0.28255  0.05472  0.04355  0.09464  0.02600  0.02160  0.02944  0.05663  0.03985  0.04843  0.03921  0.04189  0.05001  0.05051  0.06509  0.01547  0.08945  0.18249  0.00000  4.98559  0.70391  0.26451

  1 h-m-p  0.0000 0.0010 3793.7278 +YYYCCC   878.552964  5 0.0001    38 | 0/25
  2 h-m-p  0.0002 0.0011 186.0040 +YYYYCCC   866.298529  6 0.0008    75 | 0/25
  3 h-m-p  0.0003 0.0013 170.4375 YCCCC   863.095956  4 0.0007   110 | 0/25
  4 h-m-p  0.0004 0.0021 168.9165 YCCCCC   856.862850  5 0.0010   147 | 0/25
  5 h-m-p  0.0003 0.0013 117.2074 ++      851.880433  m 0.0013   175 | 1/25
  6 h-m-p  0.0001 0.0004 235.1496 YCCC    851.113722  3 0.0002   208 | 1/25
  7 h-m-p  0.0001 0.0005 234.4070 CCCC    850.357099  3 0.0002   242 | 1/25
  8 h-m-p  0.0002 0.0008 156.7328 CCCC    849.730567  3 0.0002   276 | 1/25
  9 h-m-p  0.0001 0.0006  80.1847 CYCCC   849.492486  4 0.0002   311 | 1/25
 10 h-m-p  0.0007 0.0036  16.8893 YC      849.450571  1 0.0004   340 | 1/25
 11 h-m-p  0.0004 0.0050  14.5474 CCC     849.417470  2 0.0005   372 | 1/25
 12 h-m-p  0.0005 0.0092  14.8217 YCC     849.372950  2 0.0008   403 | 1/25
 13 h-m-p  0.0022 0.0234   5.6315 YC      849.356084  1 0.0011   432 | 1/25
 14 h-m-p  0.0009 0.0296   6.8523 CC      849.330620  1 0.0014   462 | 1/25
 15 h-m-p  0.0019 0.0261   5.2581 YC      849.313423  1 0.0011   491 | 1/25
 16 h-m-p  0.0025 0.0637   2.4232 +YC     849.237156  1 0.0064   521 | 1/25
 17 h-m-p  0.0009 0.0122  16.3700 CCC     849.163900  2 0.0009   553 | 1/25
 18 h-m-p  0.0021 0.0375   7.0806 YCC     849.135245  2 0.0012   584 | 1/25
 19 h-m-p  0.0030 0.0343   2.8467 YC      849.124922  1 0.0014   613 | 1/25
 20 h-m-p  0.0016 0.0859   2.5702 YC      849.089904  1 0.0037   642 | 1/25
 21 h-m-p  0.0008 0.0195  12.1112 +YYC    848.936387  2 0.0026   673 | 1/25
 22 h-m-p  0.0015 0.0265  21.2458 +CCCC   848.144612  3 0.0067   708 | 1/25
 23 h-m-p  0.0009 0.0045  60.3640 YCCC    848.014896  3 0.0004   741 | 1/25
 24 h-m-p  0.0024 0.0473  10.6087 +YCCCC   847.433705  4 0.0098   777 | 1/25
 25 h-m-p  0.0035 0.0173  27.4218 CCCC    846.939390  3 0.0036   811 | 1/25
 26 h-m-p  0.2075 1.0376   0.0853 YCYCCC   846.687722  5 0.4453   847 | 1/25
 27 h-m-p  0.2167 6.1048   0.1752 +CCC    846.497333  2 0.9877   904 | 1/25
 28 h-m-p  1.6000 8.0000   0.0672 CCC     846.456400  2 1.3257   960 | 1/25
 29 h-m-p  1.6000 8.0000   0.0052 +YC     846.395021  1 6.8951  1014 | 1/25
 30 h-m-p  1.6000 8.0000   0.0078 YC      846.252604  1 3.7642  1067 | 1/25
 31 h-m-p  1.6000 8.0000   0.0158 CCC     846.155951  2 2.6354  1123 | 1/25
 32 h-m-p  1.6000 8.0000   0.0167 CCC     846.091553  2 2.5076  1179 | 1/25
 33 h-m-p  1.6000 8.0000   0.0095 CCC     846.041078  2 2.2807  1235 | 1/25
 34 h-m-p  1.6000 8.0000   0.0097 YC      846.032727  1 1.1512  1288 | 1/25
 35 h-m-p  1.6000 8.0000   0.0033 YC      846.030610  1 1.2006  1341 | 1/25
 36 h-m-p  1.6000 8.0000   0.0020 YC      846.030228  1 1.1636  1394 | 1/25
 37 h-m-p  1.6000 8.0000   0.0004 Y       846.030214  0 0.9485  1446 | 1/25
 38 h-m-p  1.6000 8.0000   0.0001 Y       846.030213  0 1.0512  1498 | 1/25
 39 h-m-p  1.6000 8.0000   0.0001 Y       846.030213  0 1.1430  1550 | 1/25
 40 h-m-p  1.6000 8.0000   0.0000 Y       846.030213  0 1.0747  1602 | 1/25
 41 h-m-p  1.6000 8.0000   0.0000 C       846.030213  0 1.5166  1654 | 1/25
 42 h-m-p  1.6000 8.0000   0.0000 Y       846.030213  0 0.8958  1706 | 1/25
 43 h-m-p  1.6000 8.0000   0.0000 C       846.030213  0 0.4135  1758
Out..
lnL  =  -846.030213
1759 lfun, 5277 eigenQcodon, 77396 P(t)

Time used:  0:26


Model 2: PositiveSelection

TREE #  1
(1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
   1    5.183331
   2    3.858938
   3    3.539610
   4    3.487022
   5    3.474714
   6    3.473076
   7    3.472687
   8    3.472635
   9    3.472623
  10    3.472620
initial w for M2:NSpselection reset.

    0.208829    0.064967    0.036715    0.297787    0.045587    0.065945    0.088749    0.058732    0.052141    0.038459    0.028321    0.056181    0.024728    0.027495    0.025759    0.037107    0.033458    0.053605    0.049537    0.112235    0.188333    0.000000    4.985612    1.123761    0.536599    0.476580    2.634343

ntime & nrate & np:    22     3    27

Bounds (np=27):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 2.669958

np =    27
lnL0 =  -924.587381

Iterating by ming2
Initial: fx=   924.587381
x=  0.20883  0.06497  0.03671  0.29779  0.04559  0.06594  0.08875  0.05873  0.05214  0.03846  0.02832  0.05618  0.02473  0.02749  0.02576  0.03711  0.03346  0.05360  0.04954  0.11224  0.18833  0.00000  4.98561  1.12376  0.53660  0.47658  2.63434

  1 h-m-p  0.0000 0.0011 4616.3270 +YYCCCCC   900.580959  6 0.0000    43 | 0/27
  2 h-m-p  0.0002 0.0012 142.4912 +YYYCCC   891.809987  5 0.0009    81 | 0/27
  3 h-m-p  0.0002 0.0009 121.4907 +YCCCC   889.761758  4 0.0005   119 | 0/27
  4 h-m-p  0.0004 0.0022 170.2008 +YYCCC   885.756339  4 0.0013   156 | 0/27
  5 h-m-p  0.0003 0.0016 326.8269 YCYCCC   879.613232  5 0.0008   194 | 0/27
  6 h-m-p  0.0006 0.0030  86.6593 CYCCC   877.503806  4 0.0011   231 | 0/27
  7 h-m-p  0.0012 0.0060  59.2467 +YYCCCC   873.490623  5 0.0040   270 | 0/27
  8 h-m-p  0.0004 0.0020 204.9688 CCC     872.105786  2 0.0006   304 | 0/27
  9 h-m-p  0.0025 0.0139  46.6145 CYCCC   871.347496  4 0.0018   341 | 0/27
 10 h-m-p  0.0015 0.0117  57.9501 +YYYCCC   868.316143  5 0.0053   379 | 0/27
 11 h-m-p  0.0025 0.0123 109.9725 CCCC    865.627838  3 0.0032   415 | 0/27
 12 h-m-p  0.0016 0.0078 119.6048 YCCCC   862.894569  4 0.0032   452 | 0/27
 13 h-m-p  0.0016 0.0081  57.9596 CCC     862.261722  2 0.0017   486 | 0/27
 14 h-m-p  0.0013 0.0065  56.0973 CCCC    861.572237  3 0.0020   522 | 0/27
 15 h-m-p  0.0011 0.0053  31.4819 YYC     861.443120  2 0.0008   554 | 0/27
 16 h-m-p  0.0021 0.0153  12.4442 CCCC    861.283527  3 0.0033   590 | 0/27
 17 h-m-p  0.0012 0.0093  34.3763 +YYCC   860.843365  3 0.0034   625 | 0/27
 18 h-m-p  0.0018 0.0097  65.6106 CCCC    860.297915  3 0.0023   661 | 0/27
 19 h-m-p  0.0028 0.0138  27.1021 YCCC    860.199002  3 0.0011   696 | 0/27
 20 h-m-p  0.0020 0.0251  15.2640 CCCC    860.057544  3 0.0028   732 | 0/27
 21 h-m-p  0.0039 0.0194   6.4270 YCC     860.012631  2 0.0021   765 | 0/27
 22 h-m-p  0.0014 0.0644   9.6002 ++YCYCCCC   858.816262  6 0.0288   807 | 0/27
 23 h-m-p  0.0010 0.0052 205.6978 YCCCCC   856.699280  5 0.0023   846 | 0/27
 24 h-m-p  0.0004 0.0018 419.3060 YCYCCC   855.211844  5 0.0008   884 | 0/27
 25 h-m-p  0.0047 0.0233   7.7764 CCC     855.186626  2 0.0011   918 | 0/27
 26 h-m-p  0.0070 1.0084   1.2057 +++CYCCC   851.584973  4 0.5430   958 | 0/27
 27 h-m-p  0.1420 0.7100   1.7014 YCCC    850.177945  3 0.2493   993 | 0/27
 28 h-m-p  0.1688 0.8442   0.7902 +YCYCCC   848.963006  5 0.4933  1032 | 0/27
 29 h-m-p  0.4140 2.2072   0.9415 CCC     848.330111  2 0.3914  1093 | 0/27
 30 h-m-p  0.5204 2.6021   0.6222 YCCCC   847.477717  4 0.9915  1157 | 0/27
 31 h-m-p  1.1776 7.2159   0.5238 YCCC    847.135848  3 0.7566  1219 | 0/27
 32 h-m-p  0.7572 5.2217   0.5234 CCC     846.897606  2 0.7439  1280 | 0/27
 33 h-m-p  0.5364 6.0096   0.7258 CCC     846.719303  2 0.6531  1341 | 0/27
 34 h-m-p  0.7971 8.0000   0.5947 YCCC    846.471227  3 1.6953  1403 | 0/27
 35 h-m-p  1.5117 7.5587   0.5998 YYC     846.352889  2 1.3322  1462 | 0/27
 36 h-m-p  0.9798 8.0000   0.8155 CYC     846.272242  2 1.1025  1522 | 0/27
 37 h-m-p  1.0932 8.0000   0.8225 CCC     846.203127  2 1.5176  1583 | 0/27
 38 h-m-p  1.1426 8.0000   1.0925 CC      846.149745  1 1.5281  1642 | 0/27
 39 h-m-p  1.0758 8.0000   1.5518 CCC     846.095109  2 1.6958  1676 | 0/27
 40 h-m-p  1.1918 8.0000   2.2082 CC      846.042024  1 1.6995  1708 | 0/27
 41 h-m-p  1.6000 8.0000   1.6027 YC      846.031300  1 0.8781  1739 | 0/27
 42 h-m-p  1.6000 8.0000   0.4209 CC      846.029880  1 0.5975  1771 | 0/27
 43 h-m-p  1.6000 8.0000   0.0163 YC      846.029824  1 0.8201  1829 | 0/27
 44 h-m-p  1.6000 8.0000   0.0025 Y       846.029821  0 0.7723  1886 | 0/27
 45 h-m-p  1.6000 8.0000   0.0006 Y       846.029821  0 0.7763  1943 | 0/27
 46 h-m-p  1.6000 8.0000   0.0003 Y       846.029821  0 0.8988  2000 | 0/27
 47 h-m-p  1.0359 8.0000   0.0002 C       846.029821  0 1.2082  2057 | 0/27
 48 h-m-p  1.4873 8.0000   0.0002 +C      846.029821  0 5.9247  2115 | 0/27
 49 h-m-p  0.7235 8.0000   0.0016 ++      846.029820  m 8.0000  2172 | 0/27
 50 h-m-p  0.6903 8.0000   0.0183 ++      846.029819  m 8.0000  2229 | 0/27
 51 h-m-p  1.0047 8.0000   0.1457 ++      846.029808  m 8.0000  2286 | 0/27
 52 h-m-p  1.6000 8.0000   0.4908 C       846.029796  0 2.0178  2343 | 0/27
 53 h-m-p  1.6000 8.0000   0.5146 C       846.029791  0 1.8338  2400 | 0/27
 54 h-m-p  1.6000 8.0000   0.5331 C       846.029789  0 2.0688  2457 | 0/27
 55 h-m-p  1.6000 8.0000   0.5347 C       846.029787  0 2.2811  2514 | 0/27
 56 h-m-p  1.6000 8.0000   0.5470 C       846.029787  0 2.1273  2571 | 0/27
 57 h-m-p  1.6000 8.0000   0.5554 C       846.029787  0 1.9824  2628 | 0/27
 58 h-m-p  1.6000 8.0000   0.6006 C       846.029787  0 1.6000  2685 | 0/27
 59 h-m-p  1.4590 8.0000   0.6586 C       846.029787  0 2.0783  2742 | 0/27
 60 h-m-p  1.6000 8.0000   0.5701 C       846.029786  0 1.7619  2799 | 0/27
 61 h-m-p  1.6000 8.0000   0.5267 C       846.029786  0 2.4162  2856 | 0/27
 62 h-m-p  1.6000 8.0000   0.5921 C       846.029786  0 2.2930  2913 | 0/27
 63 h-m-p  1.6000 8.0000   0.5054 C       846.029786  0 2.1948  2970 | 0/27
 64 h-m-p  1.6000 8.0000   0.3459 C       846.029786  0 2.0217  3027 | 0/27
 65 h-m-p  0.3833 8.0000   1.8248 C       846.029786  0 0.5459  3084 | 0/27
 66 h-m-p  0.9248 8.0000   1.0773 -Y      846.029786  0 0.1126  3115 | 0/27
 67 h-m-p  1.6000 8.0000   0.0076 Y       846.029786  0 0.2310  3145 | 0/27
 68 h-m-p  1.6000 8.0000   0.0010 C       846.029786  0 1.4636  3202 | 0/27
 69 h-m-p  0.1525 8.0000   0.0093 C       846.029786  0 0.0381  3259 | 0/27
 70 h-m-p  0.0188 8.0000   0.0188 C       846.029786  0 0.0047  3316 | 0/27
 71 h-m-p  0.0160 8.0000   0.0344 --Y     846.029786  0 0.0002  3375 | 0/27
 72 h-m-p  0.0160 8.0000   0.0009 Y       846.029786  0 0.0040  3432 | 0/27
 73 h-m-p  0.0160 8.0000   0.0008 ------------Y   846.029786  0 0.0000  3501
Out..
lnL  =  -846.029786
3502 lfun, 14008 eigenQcodon, 231132 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) =  -857.070894  S =  -821.337703   -28.437509
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  71 patterns   1:09
	did  20 /  71 patterns   1:09
	did  30 /  71 patterns   1:10
	did  40 /  71 patterns   1:10
	did  50 /  71 patterns   1:10
	did  60 /  71 patterns   1:10
	did  70 /  71 patterns   1:10
	did  71 /  71 patterns   1:10
Time used:  1:10


Model 3: discrete

TREE #  1
(1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
   1    2.810010
   2    2.805961
   3    2.805734
   4    2.805680
   5    2.805677
   6    2.805676
    0.206368    0.078624    0.026420    0.305899    0.062409    0.029501    0.087772    0.024731    0.013112    0.038878    0.033056    0.072895    0.058416    0.060211    0.042901    0.014938    0.016878    0.054910    0.030739    0.134288    0.206600    0.000000    4.985593    0.962090    0.577279    0.069065    0.155625    0.289914

ntime & nrate & np:    22     4    28

Bounds (np=28):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 6.945321

np =    28
lnL0 =  -871.560338

Iterating by ming2
Initial: fx=   871.560338
x=  0.20637  0.07862  0.02642  0.30590  0.06241  0.02950  0.08777  0.02473  0.01311  0.03888  0.03306  0.07290  0.05842  0.06021  0.04290  0.01494  0.01688  0.05491  0.03074  0.13429  0.20660  0.00000  4.98559  0.96209  0.57728  0.06907  0.15563  0.28991

  1 h-m-p  0.0000 0.0011 1448.0033 ++CYYCCC   855.323782  5 0.0001    43 | 0/28
  2 h-m-p  0.0003 0.0015 107.0089 +YCYCCC   850.177239  5 0.0008    83 | 0/28
  3 h-m-p  0.0004 0.0022  89.0579 CYCCC   849.459277  4 0.0004   121 | 0/28
  4 h-m-p  0.0004 0.0034  81.3458 +YCYC   847.864425  3 0.0010   157 | 0/28
  5 h-m-p  0.0011 0.0055  68.8682 YCCC    847.119305  3 0.0008   193 | 0/28
  6 h-m-p  0.0003 0.0013  43.5811 CYCCC   846.856033  4 0.0005   231 | 0/28
  7 h-m-p  0.0005 0.0026  32.1351 CCCC    846.670722  3 0.0007   268 | 0/28
  8 h-m-p  0.0007 0.0082  33.2602 YCCC    846.593349  3 0.0004   304 | 0/28
  9 h-m-p  0.0005 0.0070  28.4271 YC      846.473382  1 0.0008   336 | 0/28
 10 h-m-p  0.0011 0.0055  15.2818 YYC     846.427876  2 0.0008   369 | 0/28
 11 h-m-p  0.0010 0.0188  12.2687 +YCC    846.338444  2 0.0027   404 | 0/28
 12 h-m-p  0.0027 0.0144  11.8718 YC      846.302588  1 0.0014   436 | 0/28
 13 h-m-p  0.0009 0.0106  17.6749 CC      846.269502  1 0.0010   469 | 0/28
 14 h-m-p  0.0047 0.0614   3.6547 CC      846.263051  1 0.0015   502 | 0/28
 15 h-m-p  0.0015 0.0309   3.5167 YC      846.260783  1 0.0007   534 | 0/28
 16 h-m-p  0.0018 0.1037   1.3885 CC      846.259410  1 0.0017   567 | 0/28
 17 h-m-p  0.0025 0.1457   0.9199 YC      846.258510  1 0.0020   599 | 0/28
 18 h-m-p  0.0008 0.1243   2.2402 YC      846.256560  1 0.0017   659 | 0/28
 19 h-m-p  0.0036 0.1645   1.0344 CC      846.253966  1 0.0039   692 | 0/28
 20 h-m-p  0.0009 0.0612   4.3891 CC      846.249448  1 0.0015   725 | 0/28
 21 h-m-p  0.0027 0.0781   2.4182 YC      846.246302  1 0.0015   757 | 0/28
 22 h-m-p  0.0010 0.1219   3.6675 ++YCC   846.196935  2 0.0130   793 | 0/28
 23 h-m-p  0.0008 0.0075  56.9379 CCC     846.146613  2 0.0008   828 | 0/28
 24 h-m-p  0.0047 0.0548  10.2828 CCC     846.129984  2 0.0017   863 | 0/28
 25 h-m-p  0.0032 0.0173   5.3442 CC      846.126655  1 0.0007   896 | 0/28
 26 h-m-p  0.0009 0.1673   4.0829 +CY     846.115020  1 0.0040   930 | 0/28
 27 h-m-p  0.9344 8.0000   0.0173 YC      846.103634  1 1.8020   962 | 0/28
 28 h-m-p  1.6000 8.0000   0.0099 +CC     846.073384  1 5.9658  1024 | 0/28
 29 h-m-p  1.6000 8.0000   0.0152 CCC     846.034270  2 2.3721  1087 | 0/28
 30 h-m-p  1.3163 8.0000   0.0274 CC      846.029917  1 1.1323  1148 | 0/28
 31 h-m-p  1.6000 8.0000   0.0016 YC      846.029790  1 1.1025  1208 | 0/28
 32 h-m-p  1.6000 8.0000   0.0004 Y       846.029787  0 0.9996  1267 | 0/28
 33 h-m-p  1.6000 8.0000   0.0000 Y       846.029786  0 0.9390  1326 | 0/28
 34 h-m-p  1.6000 8.0000   0.0000 Y       846.029786  0 1.1503  1385 | 0/28
 35 h-m-p  1.6000 8.0000   0.0000 -------------C   846.029786  0 0.0000  1457
Out..
lnL  =  -846.029786
1458 lfun, 5832 eigenQcodon, 96228 P(t)

Time used:  1:28


Model 7: beta

TREE #  1
(1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
   1    2.773337
   2    1.395295
   3    1.275581
   4    1.273006
   5    1.272813
   6    1.272802
   7    1.272800
   8    1.272799
    0.234834    0.064287    0.024814    0.366338    0.045954    0.031049    0.073209    0.036616    0.018480    0.034787    0.025852    0.066154    0.047282    0.035434    0.048682    0.014356    0.030033    0.024054    0.021135    0.130490    0.265103    0.000000    4.985593    0.578325    1.546757

ntime & nrate & np:    22     1    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 5.585425

np =    25
lnL0 =  -877.195698

Iterating by ming2
Initial: fx=   877.195698
x=  0.23483  0.06429  0.02481  0.36634  0.04595  0.03105  0.07321  0.03662  0.01848  0.03479  0.02585  0.06615  0.04728  0.03543  0.04868  0.01436  0.03003  0.02405  0.02113  0.13049  0.26510  0.00000  4.98559  0.57833  1.54676

  1 h-m-p  0.0000 0.0008 1310.7420 ++CYCCC   861.184195  4 0.0001    39 | 0/25
  2 h-m-p  0.0002 0.0008  96.4738 +YYYCCC   858.244953  5 0.0006    75 | 0/25
  3 h-m-p  0.0003 0.0015 112.2786 CYC     857.307685  2 0.0003   106 | 0/25
  4 h-m-p  0.0006 0.0034  63.8476 YCCC    855.773613  3 0.0013   139 | 0/25
  5 h-m-p  0.0007 0.0036  84.1172 CCCC    854.466034  3 0.0010   173 | 0/25
  6 h-m-p  0.0006 0.0028  41.2869 CCCC    854.172199  3 0.0006   207 | 0/25
  7 h-m-p  0.0005 0.0026  19.9974 CCCC    854.079101  3 0.0007   241 | 0/25
  8 h-m-p  0.0005 0.0059  30.1023 YC      853.954061  1 0.0008   270 | 0/25
  9 h-m-p  0.0011 0.0219  22.0454 C       853.862167  0 0.0011   298 | 0/25
 10 h-m-p  0.0005 0.0026  23.3493 YCC     853.817192  2 0.0005   329 | 0/25
 11 h-m-p  0.0005 0.0099  23.4314 YC      853.737121  1 0.0011   358 | 0/25
 12 h-m-p  0.0013 0.0136  20.1830 YCC     853.687681  2 0.0009   389 | 0/25
 13 h-m-p  0.0014 0.0337  13.3816 YC      853.583491  1 0.0036   418 | 0/25
 14 h-m-p  0.0042 0.0460  11.3100 YCC     853.543393  2 0.0020   449 | 0/25
 15 h-m-p  0.0008 0.0109  27.1504 YCCC    853.469480  3 0.0016   482 | 0/25
 16 h-m-p  0.0012 0.0168  35.3995 YCCC    853.329571  3 0.0024   515 | 0/25
 17 h-m-p  0.0015 0.0169  59.4034 CCC     853.158020  2 0.0019   547 | 0/25
 18 h-m-p  0.0011 0.0084 103.5137 +YCCC   852.628534  3 0.0032   581 | 0/25
 19 h-m-p  0.0006 0.0058 585.4162 +YCCC   851.365574  3 0.0015   615 | 0/25
 20 h-m-p  0.0020 0.0099 107.6089 YCCC    851.187441  3 0.0012   648 | 0/25
 21 h-m-p  0.0010 0.0054 130.9893 CCCCC   850.928680  4 0.0013   684 | 0/25
 22 h-m-p  0.0030 0.0266  56.1519 CYC     850.692571  2 0.0030   715 | 0/25
 23 h-m-p  0.0007 0.0034  78.6160 YYC     850.635604  2 0.0005   745 | 0/25
 24 h-m-p  0.0122 0.0610   1.2456 -YC     850.634269  1 0.0014   775 | 0/25
 25 h-m-p  0.0039 1.9251   3.4130 +++YCCC   849.501113  3 0.4585   811 | 0/25
 26 h-m-p  1.6000 8.0000   0.9132 YCCC    848.362712  3 3.2822   844 | 0/25
 27 h-m-p  1.6000 8.0000   1.3729 YYCC    847.732862  3 2.3163   901 | 0/25
 28 h-m-p  1.6000 8.0000   1.9774 CCCC    847.255053  3 2.3656   935 | 0/25
 29 h-m-p  1.6000 8.0000   2.3816 CCC     847.002066  2 1.9943   967 | 0/25
 30 h-m-p  1.6000 8.0000   1.8286 CCC     846.925959  2 1.8957   999 | 0/25
 31 h-m-p  1.6000 8.0000   0.9049 +YC     846.865542  1 4.8771  1029 | 0/25
 32 h-m-p  1.6000 8.0000   1.8544 ++      846.579194  m 8.0000  1082 | 0/25
 33 h-m-p  1.6000 8.0000   6.9251 CCC     846.381220  2 2.1851  1114 | 0/25
 34 h-m-p  1.2165 6.0826   6.8659 YC      846.316820  1 2.0896  1143 | 0/25
 35 h-m-p  0.6984 3.4922   7.8516 ++      846.255899  m 3.4922  1171 | 1/25
 36 h-m-p  0.0132 0.0660 258.6366 CCC     846.220187  2 0.0039  1203 | 1/25
 37 h-m-p  1.6000 8.0000   0.0529 YC      846.212643  1 1.1272  1232 | 1/25
 38 h-m-p  1.6000 8.0000   0.0266 ----------------..  | 1/25
 39 h-m-p  0.0000 0.0054   5.3725 ++YC    846.208201  1 0.0003  1353 | 1/25
 40 h-m-p  0.0005 0.0234   2.9534 YC      846.207060  1 0.0003  1382 | 1/25
 41 h-m-p  0.0009 0.0939   1.0560 CC      846.206683  1 0.0008  1412 | 1/25
 42 h-m-p  0.0012 0.2604   0.6922 C       846.206513  0 0.0010  1440 | 1/25
 43 h-m-p  0.0030 0.2123   0.2335 C       846.206496  0 0.0008  1492 | 1/25
 44 h-m-p  0.0004 0.1976   0.4601 C       846.206481  0 0.0004  1544 | 1/25
 45 h-m-p  0.0023 1.1678   0.1006 C       846.206479  0 0.0005  1596 | 1/25
 46 h-m-p  0.0056 2.7906   0.0516 C       846.206477  0 0.0013  1648 | 1/25
 47 h-m-p  0.0122 6.1246   0.0294 C       846.206476  0 0.0041  1700 | 1/25
 48 h-m-p  0.0066 3.2969   0.1634 -Y      846.206476  0 0.0003  1753 | 1/25
 49 h-m-p  0.0040 2.0199   0.0606 C       846.206475  0 0.0008  1805 | 1/25
 50 h-m-p  0.0135 6.7357   0.0732 Y       846.206474  0 0.0020  1857 | 1/25
 51 h-m-p  0.0160 8.0000   0.0402 C       846.206473  0 0.0062  1909 | 1/25
 52 h-m-p  0.0080 3.9829   0.1933 Y       846.206466  0 0.0054  1961 | 1/25
 53 h-m-p  0.0052 2.6239   2.2434 Y       846.206411  0 0.0041  2013 | 1/25
 54 h-m-p  0.0031 1.3204   2.9921 YC      846.206375  1 0.0020  2042 | 1/25
 55 h-m-p  0.0018 0.4887   3.3838 Y       846.206348  0 0.0013  2070 | 1/25
 56 h-m-p  0.0050 2.4906   1.2313 YC      846.206327  1 0.0028  2099 | 1/25
 57 h-m-p  0.0010 0.3632   3.4324 Y       846.206312  0 0.0007  2127 | 1/25
 58 h-m-p  0.0089 4.4474   0.5697 Y       846.206300  0 0.0038  2155 | 1/25
 59 h-m-p  0.0531 1.9908   0.0413 --Y     846.206299  0 0.0005  2209 | 1/25
 60 h-m-p  0.0160 8.0000   0.0214 ++++YC   846.206078  1 2.5676  2266 | 1/25
 61 h-m-p  0.0007 0.0976  74.6671 C       846.205846  0 0.0008  2318 | 1/25
 62 h-m-p  1.6000 8.0000   0.0069 -----C   846.205846  0 0.0005  2351 | 1/25
 63 h-m-p  0.0160 8.0000   0.0022 +++Y    846.205843  0 0.6828  2406 | 1/25
 64 h-m-p  1.6000 8.0000   0.0003 Y       846.205842  0 0.8134  2458 | 1/25
 65 h-m-p  1.6000 8.0000   0.0001 C       846.205842  0 1.2898  2510 | 1/25
 66 h-m-p  1.6000 8.0000   0.0000 Y       846.205842  0 0.4000  2562
Out..
lnL  =  -846.205842
2563 lfun, 28193 eigenQcodon, 563860 P(t)

Time used:  3:14


Model 8: beta&w>1

TREE #  1
(1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
   1    5.147225
   2    4.708249
   3    4.653972
   4    4.641225
   5    4.640922
   6    4.640869
   7    4.640859
   8    4.640859
initial w for M8:NSbetaw>1 reset.

    0.198890    0.081369    0.027614    0.255627    0.053934    0.041100    0.087509    0.025669    0.059217    0.041030    0.038791    0.040637    0.047437    0.035877    0.042664    0.038641    0.052593    0.039873    0.019930    0.119382    0.187281    0.000000    4.991725    0.900000    0.527635    1.408724    2.182527

ntime & nrate & np:    22     2    27

Bounds (np=27):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 4.342093

np =    27
lnL0 =  -897.489510

Iterating by ming2
Initial: fx=   897.489510
x=  0.19889  0.08137  0.02761  0.25563  0.05393  0.04110  0.08751  0.02567  0.05922  0.04103  0.03879  0.04064  0.04744  0.03588  0.04266  0.03864  0.05259  0.03987  0.01993  0.11938  0.18728  0.00000  4.99173  0.90000  0.52763  1.40872  2.18253

  1 h-m-p  0.0000 0.0008 2707.2619 +YCYCCC   875.234035  5 0.0001    41 | 0/27
  2 h-m-p  0.0002 0.0009 166.8968 ++      859.791678  m 0.0009    71 | 1/27
  3 h-m-p  0.0001 0.0005  97.1874 YCCCC   858.930252  4 0.0003   108 | 1/27
  4 h-m-p  0.0003 0.0017  95.5572 +YCCC   857.261716  3 0.0007   144 | 1/27
  5 h-m-p  0.0003 0.0017  93.1264 YCCC    855.955523  3 0.0008   179 | 1/27
  6 h-m-p  0.0006 0.0030  87.7656 YCCC    855.421910  3 0.0004   214 | 1/27
  7 h-m-p  0.0005 0.0026  30.4360 CCCC    855.252430  3 0.0006   250 | 1/27
  8 h-m-p  0.0014 0.0072  12.9490 YYC     855.181461  2 0.0011   282 | 1/27
  9 h-m-p  0.0005 0.0143  28.1306 CYC     855.107812  2 0.0007   315 | 1/27
 10 h-m-p  0.0009 0.0069  22.3147 CCC     855.029262  2 0.0010   349 | 1/27
 11 h-m-p  0.0009 0.0224  25.4995 YC      854.887353  1 0.0019   380 | 1/27
 12 h-m-p  0.0012 0.0062  25.3984 YCC     854.833327  2 0.0008   413 | 1/27
 13 h-m-p  0.0022 0.0511   9.3335 YCC     854.753269  2 0.0042   446 | 1/27
 14 h-m-p  0.0017 0.0090  23.7088 YYCC    854.683199  3 0.0015   480 | 1/27
 15 h-m-p  0.0008 0.0248  46.5821 +YCCC   854.221715  3 0.0055   516 | 1/27
 16 h-m-p  0.0013 0.0107 200.5997 +YCC    853.005835  2 0.0036   550 | 1/27
 17 h-m-p  0.0011 0.0053 288.1053 CCC     852.403212  2 0.0012   584 | 1/27
 18 h-m-p  0.0014 0.0072  92.9322 CCCC    852.138614  3 0.0016   620 | 1/27
 19 h-m-p  0.0012 0.0065 125.5449 YCC     851.963819  2 0.0008   653 | 1/27
 20 h-m-p  0.0019 0.0187  56.3739 CC      851.695659  1 0.0029   685 | 1/27
 21 h-m-p  0.0012 0.0061  97.8562 YCC     851.618372  2 0.0005   718 | 1/27
 22 h-m-p  0.0143 0.0717   1.4042 -YC     851.616541  1 0.0016   750 | 1/27
 23 h-m-p  0.0006 0.0934   3.9366 +YC     851.600601  1 0.0049   782 | 1/27
 24 h-m-p  0.0042 0.3865   4.6186 ++YCCCC   850.963697  4 0.1525   821 | 1/27
 25 h-m-p  0.0005 0.0025 1241.0184 CCC     850.203147  2 0.0008   855 | 1/27
 26 h-m-p  0.8606 8.0000   1.0954 +CCC    848.718831  2 3.1795   890 | 1/27
 27 h-m-p  1.6000 8.0000   1.6532 CCCC    847.759978  3 1.9506   926 | 1/27
 28 h-m-p  0.5466 2.7331   1.8659 YC      847.395802  1 1.3045   957 | 1/27
 29 h-m-p  1.6000 8.0000   0.9267 YCC     847.307081  2 1.2601   990 | 1/27
 30 h-m-p  1.6000 8.0000   0.2636 YC      847.259553  1 3.2799  1047 | 1/27
 31 h-m-p  1.2041 8.0000   0.7180 ++      846.923759  m 8.0000  1103 | 1/27
 32 h-m-p  0.3970 1.9848   5.0518 ++      846.609135  m 1.9848  1159 | 2/27
 33 h-m-p  1.5289 8.0000   6.5520 +YCCC   846.397573  3 3.8641  1195 | 2/27
 34 h-m-p  1.2880 6.4400   6.6917 CC      846.295146  1 2.0415  1227 | 2/27
 35 h-m-p  0.6464 3.2322   9.1054 ++      846.220941  m 3.2322  1257 | 3/27
 36 h-m-p  0.0823 0.4114  39.7011 -CC     846.218102  1 0.0073  1290 | 3/27
 37 h-m-p  1.6000 8.0000   0.0327 C       846.209257  0 1.6000  1320 | 3/27
 38 h-m-p  1.6000 8.0000   0.0262 C       846.206434  0 1.6747  1374 | 3/27
 39 h-m-p  1.6000 8.0000   0.0098 YC      846.206278  1 1.0018  1429 | 3/27
 40 h-m-p  1.6000 8.0000   0.0017 Y       846.206269  0 1.0427  1483 | 3/27
 41 h-m-p  1.6000 8.0000   0.0002 Y       846.206268  0 1.0065  1537 | 3/27
 42 h-m-p  1.6000 8.0000   0.0001 Y       846.206268  0 0.9982  1591 | 3/27
 43 h-m-p  1.6000 8.0000   0.0000 Y       846.206268  0 1.0870  1645 | 3/27
 44 h-m-p  1.6000 8.0000   0.0000 C       846.206268  0 1.6000  1699
Out..
lnL  =  -846.206268
1700 lfun, 20400 eigenQcodon, 411400 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) =  -860.561891  S =  -821.316540   -32.913312
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  71 patterns   4:33
	did  20 /  71 patterns   4:34
	did  30 /  71 patterns   4:34
	did  40 /  71 patterns   4:34
	did  50 /  71 patterns   4:34
	did  60 /  71 patterns   4:34
	did  70 /  71 patterns   4:34
	did  71 /  71 patterns   4:34
Time used:  4:34
CodeML output code: -1
Download 
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=19, Len=75 

gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                         SVSLRYHYTRKLQTRSQTWLESREYKKHLIMVENWIFRNPGFAIVSVAIT
gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                        AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                          AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                           AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M   AVTLPSHSTRKLQARSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M         AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAVIA
gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                         AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                     AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                      AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIA
gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                         AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIA
gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                    AVTLPSHSTRKLQTRPQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                    AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIA
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M    AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIA
gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M              AVTLPSHSTRELQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M              AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                 AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                AVTLPSHSTRKLQTRSQTWLESREYTKHLIRIENWIFRNPGFALAAAAIA
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                            AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFTLVAVAIA
                                                                                                                                                 :*:*  * **:**:*.*********.**** :***::****:::.:..*:

gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                         WLMGSLTSQKVIYLVMIVLIVPAYS
gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                        WLLGSSTSQKVIYLVMILLIAPAYS
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                          WLLGSSTSQKVIYLVMILLIAPAYS
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                           WLLGSSTSQKVIYLIMILLIAPAYS
gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M   WLLGSSTSQKVIYLVMILLIAPAYS
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M         WLLGSSTSQKVIYLVMILLIAPAYS
gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                         WLLGSSTSKKVIYLVMILLIAPAYS
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                     WLLGSSTRQKVIYLVMILLIAPAYS
gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                      WLLGSSTSQKVIYLVMILLIAPAYS
gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                         WLLGSSTSQKVIYLVMILLIAPAYS
gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                    WLLGSSTSQKVIYLVMILLIAPAYS
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                              WLFGSSTSQKVIYLVMILLIAPAYS
gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                    WLLGSSTSQKVIYLVMILLIAPAYS
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M    WLLGSSTSQKVIYLVMILLIAPAYS
gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M              WLLGSSTSQKVIYLVMILLIAPAYS
gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M              WLLGSSTSQKVICLVMILLIAPAYS
gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                 WLLGSSTSQKVIYLVMILLIALAYS
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                WLLGSSTSQKVIYLVMILLIAPAYS
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                                            WLLGSSTSQKVIYLVMILLIAPAYS
                                                                                                                                                 **:** * :*** *:**:**. ***
Download 
>gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
TCTGTGTCGCTCCGTTATCACTATACAAGGAAGTTGCAAACGCGGTCGCA
GACATGGTTAGAATCAAGAGAATACAAGAAGCACTTGATCATGGTCGAAA
ACTGGATATTCAGGAACCCCGGGTTTGCCATAGTGTCCGTTGCCATTACC
TGGCTGATGGGAAGCTTGACGAGCCAAAAAGTCATATACTTGGTCATGAT
AGTGTTGATTGTCCCGGCATACAGT
>gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTTCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
GACCTGGTTGGAATCAAGAGAATACACTAAGCACTTGATCAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATCGCCCCGGCATACAGC
>gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCTTCTCACTCTACAAGGAAGTTGCAAACGCGGTCGCA
GACCTGGTTAGAATCAAGAGAATACACGAAGCACCTGATCAAGGTTGAAA
ACTGGATATTTAGGAACCCCGGGTTTGCGCTCGCAGCTGTTGCCATTGCC
TGGCTTTTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTTATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCTTCTCACTCCACAAGGAAGTTGCAAACGCGGTCGCA
GACCTGGTTAGAATCAAGAGAATACACGAAGCACTTGATCAAGGTTGAAA
ACTGGATATTCAGGAACCCCGGGTTTGCGCTAGCGGCTGTTGCCATTGCT
TGGCTTCTGGGAAGTTCGACGAGCCAAAAAGTCATATACTTGATCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAGCGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATATAGC
>gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
GACCTGGTTGGAATCAAGAGAATACACAAAGCACCTGATTAGAGTTGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGTCATCGCT
TGGCTTTTGGGAAGTTCAACGAGCCAAAAAGTCATATATCTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGTTCAACGAGCAAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGCGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATACTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATATTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ACTGGATGTTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGCCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCATTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACAAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGCTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTTGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCTGTGACGCTCCCCTCCCATTCCACTAGAAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGCCTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCCGTGACGCTTCCTTCTCACTCTACAAGGAAGTTGCAAACGCGATCGCA
GACTTGGCTAGAATCAAGAGAATACACAAAGCACCTGATCAAGGTTGAGA
ATTGGATATTCAGGAACCCCGGGTTTGCGCTAGTGGCTGTAGCTATTGCC
TGGCTCCTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTCATGAT
ATTGTTGATTGCCCCGGCATACAGT
>gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCCGTGACGCTCCCCTCCCATTCCACTAGGGAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATGCTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAGTCGAAA
ATTGGATATTCAGGAACCCTGGTTTCGCTTTAGCAGCAGCTGCCATCGCG
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCTGGCATACAGC
>gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCCGTGACGCTCCCCTCCCATTCCACTAGGAAGCTGCAAACGCGGTCGCA
AACCTGGTTGGAATCAAGAGAATACACAAAGCACTTGATTAGAATCGAAA
ATTGGATATTCAGGAACCCTGGCTTCGCGTTAGCAGCAGCTGCCATCGCT
TGGCTTTTGGGAAGCTCAACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGC
>gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
GCCGTCACGCTCCCATCTCACTCCACAAGGAAATTGCAAACGCGGTCGCA
GACTTGGCTAGAATCAAGAGAATACACAAAGCACCTGATCAAGGTTGAAA
ATTGGATATTCAGGAACCCTGGTTTTACGCTAGTGGCTGTCGCCATCGCC
TGGCTTTTGGGAAGCTCGACGAGCCAAAAAGTCATATACTTGGTCATGAT
ACTGCTGATTGCCCCGGCATACAGT
Download 
>gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
SVSLRYHYTRKLQTRSQTWLESREYKKHLIMVENWIFRNPGFAIVSVAIT
WLMGSLTSQKVIYLVMIVLIVPAYS
>gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALAAVAIA
WLLGSSTSQKVIYLIMILLIAPAYS
>gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQARSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAVIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSKKVIYLVMILLIAPAYS
>gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTRQKVIYLVMILLIAPAYS
>gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWILRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWMFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRPQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLFGSSTSQKVIYLVMILLIAPAYS
>gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGLALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFALVAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRELQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVICLVMILLIAPAYS
>gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIALAYS
>gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIRIENWIFRNPGFALAAAAIA
WLLGSSTSQKVIYLVMILLIAPAYS
>gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M
AVTLPSHSTRKLQTRSQTWLESREYTKHLIKVENWIFRNPGFTLVAVAIA
WLLGSSTSQKVIYLVMILLIAPAYS
Download 
Reading sequence file aligned.fasta
Allocating space for 19 taxa and 225 sites
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig):  8.0%
Found 36 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to:      Phi.inf.list
Using a window size of 100 with k as 16

Calculating analytical mean and variance

Doing permutation test for PHI

Doing permutation test for NSS

Doing Permutation test for MAXCHI

 Writing  alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 52 polymorphic sites

       p-Value(s)
       ----------

NSS:                 2.20e-02  (1000 permutations)
Max Chi^2:           6.00e-02  (1000 permutations)
PHI (Permutation):   4.35e-01  (1000 permutations)
PHI (Normal):        4.38e-01
Download 
#NEXUS

[ID: 5127899372]
begin taxa;
	dimensions ntax=19;
	taxlabels
		gb_KF383118|Organism_Zika_virus|Strain_Name_ArD157995|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KX051560|Organism_Zika_virus|Strain_Name_SK364/13AS|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KF268948|Organism_Zika_virus|Strain_Name_ARB13565|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KF383115|Organism_Zika_virus|Strain_Name_ArB1362|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KY014296|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KU681082|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KX447516|Organism_Zika_virus|Strain_Name_1_0111_PF|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KX520666|Organism_Zika_virus|Strain_Name_HS-2015-BA-01|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KU870645|Organism_Zika_virus|Strain_Name_FB-GWUH-2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KX806557|Organism_Zika_virus|Strain_Name_TS17-2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KX811222|Organism_Zika_virus|Strain_Name_Brazil_2015_MG|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_LC219720|Organism_Zika_virus|Strain_Name_ZIKV/Hu/NIID123/2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KX369547|Organism_Zika_virus|Strain_Name_PF13/251013-18|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_MF574557|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_MF574556|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KU922923|Organism_Zika_virus|Strain_Name_MEX/InDRE/Lm/2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KY075932|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		gb_KY288905|Organism_Zika_virus|Strain_Name_MP1751|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		;
end;
begin trees;
	translate
		1	gb_KF383118|Organism_Zika_virus|Strain_Name_ArD157995|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		2	gb_KX051560|Organism_Zika_virus|Strain_Name_SK364/13AS|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		3	gb_KF268948|Organism_Zika_virus|Strain_Name_ARB13565|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		4	gb_KF383115|Organism_Zika_virus|Strain_Name_ArB1362|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		5	gb_KY014296|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		6	gb_KU681082|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		7	gb_KX447516|Organism_Zika_virus|Strain_Name_1_0111_PF|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		8	gb_KX520666|Organism_Zika_virus|Strain_Name_HS-2015-BA-01|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		9	gb_KU870645|Organism_Zika_virus|Strain_Name_FB-GWUH-2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		10	gb_KX806557|Organism_Zika_virus|Strain_Name_TS17-2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		11	gb_KX811222|Organism_Zika_virus|Strain_Name_Brazil_2015_MG|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		12	gb_LC219720|Organism_Zika_virus|Strain_Name_ZIKV/Hu/NIID123/2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		13	gb_KX369547|Organism_Zika_virus|Strain_Name_PF13/251013-18|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		14	gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		15	gb_MF574557|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		16	gb_MF574556|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		17	gb_KU922923|Organism_Zika_virus|Strain_Name_MEX/InDRE/Lm/2016|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		18	gb_KY075932|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M,
		19	gb_KY288905|Organism_Zika_virus|Strain_Name_MP1751|Protein_Name_membrane_glycoprotein_M|Gene_Symbol_M
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.2452862,3:0.04469793,4:0.03149061,(2:0.03319871,5:0.01835806,6:0.04659167,7:0.01822004,8:0.01165624,9:0.01774229,10:0.01880209,11:0.0253177,12:0.01908918,13:0.01918623,(15:0.01162159,16:0.01164781,17:0.01911161)0.995:0.0222393,18:0.01581809)1.000:0.2180581,(14:0.08323588,19:0.08449086)0.787:0.05377443);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.2452862,3:0.04469793,4:0.03149061,(2:0.03319871,5:0.01835806,6:0.04659167,7:0.01822004,8:0.01165624,9:0.01774229,10:0.01880209,11:0.0253177,12:0.01908918,13:0.01918623,(15:0.01162159,16:0.01164781,17:0.01911161):0.0222393,18:0.01581809):0.2180581,(14:0.08323588,19:0.08449086):0.05377443);
end;
Download 
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -887.53          -913.93
2       -887.57          -913.11
--------------------------------------
TOTAL     -887.55          -913.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         1.300527    0.043026    0.915982    1.704101    1.280521   1165.79   1316.67    1.000
r(A<->C){all}   0.058255    0.000512    0.019518    0.105700    0.055677    654.21    714.43    1.000
r(A<->G){all}   0.127391    0.001397    0.061657    0.201820    0.123346    808.09    815.21    1.000
r(A<->T){all}   0.051789    0.000687    0.006683    0.103001    0.048009    696.51    797.61    1.000
r(C<->G){all}   0.031111    0.000259    0.004645    0.063440    0.028918    966.08    979.90    1.000
r(C<->T){all}   0.675380    0.003695    0.558757    0.791371    0.679130    641.62    712.42    1.000
r(G<->T){all}   0.056074    0.000575    0.015137    0.104595    0.052951    807.70    873.45    1.000
pi(A){all}      0.259548    0.000681    0.203418    0.306126    0.258711    801.38    872.05    1.000
pi(C){all}      0.265909    0.000615    0.217328    0.313980    0.265031   1086.55   1130.95    1.000
pi(G){all}      0.234106    0.000622    0.183494    0.280000    0.233549   1019.79   1159.56    1.000
pi(T){all}      0.240437    0.000557    0.193100    0.286278    0.239537   1112.39   1132.00    1.000
alpha{1,2}      0.270047    0.005681    0.145839    0.412255    0.256582    989.21   1119.05    1.000
alpha{3}        2.172421    0.611152    0.921732    3.784606    2.050679   1429.54   1446.20    1.000
pinvar{all}     0.072886    0.003304    0.000048    0.183398    0.059947   1215.79   1321.85    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
Download 
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS1/ZikaADOPSresults/M/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =  19  ls =  75

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   0   2   1   0   0 | Ser TCT   1   0   2   1   0   0 | Tyr TAT   2   0   0   0   1   1 | Cys TGT   0   0   0   0   0   0
    TTC   1   2   0   1   2   2 |     TCC   1   2   0   1   2   2 |     TAC   3   3   3   3   2   2 |     TGC   0   0   0   0   0   0
Leu TTA   1   1   1   1   1   1 |     TCA   1   2   1   1   2   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   5   4   3   3   4   2 |     TCG   2   1   2   2   1   1 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   0   2   1   1   1   1 | Pro CCT   0   1   1   1   1   1 | His CAT   0   1   0   0   1   1 | Arg CGT   1   0   0   0   0   0
    CTC   1   0   2   1   1   1 |     CCC   1   1   1   1   1   1 |     CAC   2   1   2   2   1   1 |     CGC   0   0   0   0   0   0
    CTA   0   0   0   1   0   0 |     CCA   0   0   0   0   0   0 | Gln CAA   2   2   2   2   3   2 |     CGA   0   0   0   0   0   0
    CTG   1   3   3   3   3   5 |     CCG   1   1   1   1   1   1 |     CAG   1   1   1   1   0   1 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   0   2   2   2   2 | Thr ACT   0   2   0   0   1   1 | Asn AAT   0   1   0   0   1   1 | Ser AGT   1   0   0   1   0   1
    ATC   1   3   1   2   1   1 |     ACC   1   1   1   1   1   1 |     AAC   2   1   2   2   1   1 |     AGC   2   3   3   2   3   2
    ATA   4   3   3   3   3   3 |     ACA   2   0   1   1   1   1 | Lys AAA   1   1   1   1   1   1 | Arg AGA   1   2   1   1   2   2
Met ATG   3   1   1   1   1   1 |     ACG   2   3   4   4   2   3 |     AAG   3   2   3   3   2   2 |     AGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   0   3   2   0   1 | Ala GCT   0   3   2   3   3   3 | Asp GAT   0   0   0   0   0   0 | Gly GGT   0   0   0   0   0   0
    GTC   4   3   1   1   3   3 |     GCC   2   2   3   2   2   1 |     GAC   0   0   0   0   0   0 |     GGC   0   1   0   0   1   1
    GTA   0   0   0   0   0   0 |     GCA   1   3   2   1   3   3 | Glu GAA   3   3   3   3   3   3 |     GGA   1   1   1   1   1   1
    GTG   3   1   1   1   1   1 |     GCG   0   1   1   2   2   1 |     GAG   0   0   0   0   0   0 |     GGG   1   0   1   1   0   0
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   0   0   0   0   0   1 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   1   0   0   0 | Cys TGT   0   0   0   0   0   0
    TTC   2   2   1   2   2   2 |     TCC   2   2   2   2   2   2 |     TAC   3   3   2   3   3   3 |     TGC   0   0   0   0   0   0
Leu TTA   1   1   1   1   1   1 |     TCA   2   2   2   2   2   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   4   4   4   4   4   3 |     TCG   1   1   1   1   0   1 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   1   1   1   1   1   1 | Pro CCT   1   1   1   1   1   1 | His CAT   1   1   1   1   2   1 | Arg CGT   0   0   0   0   0   0
    CTC   1   1   2   1   1   1 |     CCC   1   1   1   1   1   1 |     CAC   1   1   1   1   0   1 |     CGC   0   1   0   0   0   1
    CTA   0   0   0   0   0   0 |     CCA   0   0   0   0   0   0 | Gln CAA   2   3   3   3   3   3 |     CGA   0   0   0   0   0   0
    CTG   3   3   3   3   3   3 |     CCG   1   1   1   1   2   1 |     CAG   0   0   0   0   0   0 |     CGG   1   1   1   1   1   0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   2   2   2   2   2 | Thr ACT   1   1   1   1   1   1 | Asn AAT   1   1   1   0   1   1 | Ser AGT   1   0   0   0   0   0
    ATC   1   1   1   1   1   1 |     ACC   1   1   1   1   1   1 |     AAC   1   1   1   2   1   1 |     AGC   2   2   3   3   3   3
    ATA   3   3   3   2   3   3 |     ACA   1   1   1   1   2   1 | Lys AAA   2   1   1   1   1   1 | Arg AGA   2   2   2   2   2   2
Met ATG   1   1   1   2   1   1 |     ACG   3   3   3   3   2   3 |     AAG   2   2   2   2   2   2 |     AGG   2   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   0   0   0   0   0   0 | Ala GCT   3   3   3   3   3   3 | Asp GAT   0   0   0   0   0   0 | Gly GGT   0   0   0   0   0   0
    GTC   3   3   3   3   3   3 |     GCC   2   2   2   2   2   2 |     GAC   0   0   0   0   0   0 |     GGC   1   1   1   1   1   1
    GTA   0   0   0   0   0   0 |     GCA   3   3   3   3   3   3 | Glu GAA   3   3   3   3   3   3 |     GGA   1   1   1   1   1   1
    GTG   1   1   1   1   1   1 |     GCG   1   1   1   1   1   1 |     GAG   0   0   0   0   0   0 |     GGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   0   1   0   0   0   0 | Ser TCT   0   2   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   0   0   0   0   0   0
    TTC   1   1   2   2   2   2 |     TCC   2   0   2   2   2   2 |     TAC   3   3   3   2   3   3 |     TGC   0   0   0   1   0   0
Leu TTA   1   0   1   1   1   1 |     TCA   2   1   2   2   2   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   4   4   4   4   4   4 |     TCG   1   2   1   1   1   1 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   1   1   1   1   1   1 | Pro CCT   1   1   1   1   1   1 | His CAT   1   0   1   1   1   1 | Arg CGT   0   0   0   0   0   0
    CTC   2   1   1   1   1   1 |     CCC   1   1   1   1   1   1 |     CAC   1   2   1   1   1   1 |     CGC   0   0   0   0   0   0
    CTA   0   2   0   0   0   0 |     CCA   0   0   0   0   0   0 | Gln CAA   3   2   3   3   3   3 |     CGA   0   1   0   0   0   0
    CTG   3   2   3   3   4   3 |     CCG   1   1   1   1   0   1 |     CAG   0   1   0   0   0   0 |     CGG   1   0   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   2   2   2   2   2 | Thr ACT   1   1   1   1   1   1 | Asn AAT   1   1   1   1   1   1 | Ser AGT   0   1   0   0   0   0
    ATC   1   1   1   1   1   2 |     ACC   1   0   1   1   1   1 |     AAC   1   1   1   1   1   1 |     AGC   3   2   3   3   3   3
    ATA   3   3   3   3   3   3 |     ACA   1   2   1   1   1   1 | Lys AAA   1   1   1   1   1   1 | Arg AGA   3   1   2   2   2   2
Met ATG   1   1   1   1   1   1 |     ACG   3   3   3   3   3   3 |     AAG   2   3   1   2   2   2 |     AGG   1   2   2   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   0   1   0   0   0   0 | Ala GCT   3   2   3   3   2   2 | Asp GAT   0   0   0   0   0   0 | Gly GGT   0   0   1   1   1   0
    GTC   3   2   3   3   3   2 |     GCC   2   3   3   3   3   3 |     GAC   0   0   0   0   0   0 |     GGC   1   0   0   0   0   1
    GTA   0   1   0   0   0   0 |     GCA   3   1   3   3   3   3 | Glu GAA   3   2   3   3   3   3 |     GGA   1   1   1   1   1   1
    GTG   1   2   1   1   1   1 |     GCG   1   1   0   0   1   1 |     GAG   0   1   1   0   0   0 |     GGG   0   1   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------

------------------------------------------------------
Phe TTT   1 | Ser TCT   1 | Tyr TAT   0 | Cys TGT   0
    TTC   1 |     TCC   1 |     TAC   3 |     TGC   0
Leu TTA   0 |     TCA   1 | *** TAA   0 | *** TGA   0
    TTG   3 |     TCG   2 |     TAG   0 | Trp TGG   3
------------------------------------------------------
Leu CTT   1 | Pro CCT   1 | His CAT   0 | Arg CGT   0
    CTC   1 |     CCC   0 |     CAC   2 |     CGC   0
    CTA   2 |     CCA   1 | Gln CAA   2 |     CGA   0
    CTG   3 |     CCG   1 |     CAG   1 |     CGG   1
------------------------------------------------------
Ile ATT   1 | Thr ACT   1 | Asn AAT   1 | Ser AGT   1
    ATC   2 |     ACC   0 |     AAC   1 |     AGC   2
    ATA   3 |     ACA   2 | Lys AAA   2 | Arg AGA   1
Met ATG   1 |     ACG   4 |     AAG   2 |     AGG   2
------------------------------------------------------
Val GTT   1 | Ala GCT   1 | Asp GAT   0 | Gly GGT   1
    GTC   4 |     GCC   4 |     GAC   0 |     GGC   0
    GTA   0 |     GCA   1 | Glu GAA   3 |     GGA   1
    GTG   1 |     GCG   0 |     GAG   0 |     GGG   0
------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.28000    C:0.14667    A:0.36000    G:0.21333
position  2:    T:0.37333    C:0.20000    A:0.25333    G:0.17333
position  3:    T:0.12000    C:0.28000    A:0.22667    G:0.37333
Average         T:0.25778    C:0.20889    A:0.28000    G:0.25333

#2: gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.24000    C:0.18667    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.13333    C:0.30667    A:0.24000    G:0.32000
Average         T:0.22667    C:0.26667    A:0.26222    G:0.24444

#3: gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.22667    C:0.20000    A:0.33333    G:0.24000
position  2:    T:0.32000    C:0.29333    A:0.22667    G:0.16000
position  3:    T:0.17333    C:0.25333    A:0.21333    G:0.36000
Average         T:0.24000    C:0.24889    A:0.25778    G:0.25333

#4: gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.22667    C:0.20000    A:0.34667    G:0.22667
position  2:    T:0.32000    C:0.29333    A:0.22667    G:0.16000
position  3:    T:0.16000    C:0.25333    A:0.21333    G:0.37333
Average         T:0.23556    C:0.24889    A:0.26222    G:0.25333

#5: gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.24000    C:0.18667    A:0.32000    G:0.25333
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.14667    C:0.28000    A:0.26667    G:0.30667
Average         T:0.23111    C:0.25778    A:0.26667    G:0.24444

#6: gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.21333    C:0.21333    A:0.33333    G:0.24000
position  2:    T:0.32000    C:0.29333    A:0.21333    G:0.17333
position  3:    T:0.17333    C:0.25333    A:0.25333    G:0.32000
Average         T:0.23556    C:0.25333    A:0.26667    G:0.24444

#7: gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.24000    C:0.17333    A:0.34667    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.14667    C:0.28000    A:0.26667    G:0.30667
Average         T:0.23111    C:0.25333    A:0.27556    G:0.24000

#8: gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.24000    C:0.20000    A:0.32000    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.13333    C:0.29333    A:0.26667    G:0.30667
Average         T:0.22667    C:0.26667    A:0.26667    G:0.24000

#9: gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M             
position  1:    T:0.22667    C:0.20000    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.14667    C:0.28000    A:0.26667    G:0.30667
Average         T:0.22667    C:0.26222    A:0.27111    G:0.24000

#10: gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.24000    C:0.18667    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.12000    C:0.30667    A:0.25333    G:0.32000
Average         T:0.22222    C:0.26667    A:0.26667    G:0.24444

#11: gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.22667    C:0.20000    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.14667    C:0.28000    A:0.28000    G:0.29333
Average         T:0.22667    C:0.26222    A:0.27556    G:0.23556

#12: gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.24000    C:0.18667    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.14667    C:0.30667    A:0.26667    G:0.28000
Average         T:0.23111    C:0.26667    A:0.27111    G:0.23111

#13: gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.22667    C:0.20000    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.13333    C:0.29333    A:0.28000    G:0.29333
Average         T:0.22222    C:0.26667    A:0.27556    G:0.23556

#14: gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.22667    C:0.20000    A:0.33333    G:0.24000
position  2:    T:0.33333    C:0.28000    A:0.22667    G:0.16000
position  3:    T:0.17333    C:0.22667    A:0.24000    G:0.36000
Average         T:0.24444    C:0.23556    A:0.26667    G:0.25333

#15: gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.24000    C:0.18667    A:0.32000    G:0.25333
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.14667    C:0.29333    A:0.26667    G:0.29333
Average         T:0.23111    C:0.26222    A:0.26667    G:0.24000

#16: gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.24000    C:0.18667    A:0.33333    G:0.24000
position  2:    T:0.30667    C:0.30667    A:0.20000    G:0.18667
position  3:    T:0.14667    C:0.29333    A:0.26667    G:0.29333
Average         T:0.23111    C:0.26222    A:0.26667    G:0.24000

#17: gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.24000    C:0.18667    A:0.33333    G:0.24000
position  2:    T:0.32000    C:0.29333    A:0.21333    G:0.17333
position  3:    T:0.13333    C:0.29333    A:0.26667    G:0.30667
Average         T:0.23111    C:0.25778    A:0.27111    G:0.24000

#18: gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.24000    C:0.18667    A:0.34667    G:0.22667
position  2:    T:0.30667    C:0.30667    A:0.21333    G:0.17333
position  3:    T:0.12000    C:0.30667    A:0.26667    G:0.30667
Average         T:0.22222    C:0.26667    A:0.27556    G:0.23556

#19: gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M            
position  1:    T:0.21333    C:0.21333    A:0.34667    G:0.22667
position  2:    T:0.33333    C:0.28000    A:0.22667    G:0.16000
position  3:    T:0.14667    C:0.28000    A:0.25333    G:0.32000
Average         T:0.23111    C:0.25778    A:0.27556    G:0.23556

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT       7 | Ser S TCT       7 | Tyr Y TAT       5 | Cys C TGT       0
      TTC      30 |       TCC      31 |       TAC      53 |       TGC       1
Leu L TTA      17 |       TCA      33 | *** * TAA       0 | *** * TGA       0
      TTG      71 |       TCG      23 |       TAG       0 | Trp W TGG      57
------------------------------------------------------------------------------
Leu L CTT      19 | Pro P CCT      18 | His H CAT      15 | Arg R CGT       1
      CTC      21 |       CCC      18 |       CAC      23 |       CGC       2
      CTA       5 |       CCA       1 | Gln Q CAA      49 |       CGA       1
      CTG      57 |       CCG      19 |       CAG       7 |       CGG      17
------------------------------------------------------------------------------
Ile I ATT      35 | Thr T ACT      17 | Asn N AAT      15 | Ser S AGT       6
      ATC      24 |       ACC      17 |       AAC      23 |       AGC      50
      ATA      57 |       ACA      22 | Lys K AAA      21 | Arg R AGA      34
Met M ATG      22 |       ACG      57 |       AAG      41 |       AGG      37
------------------------------------------------------------------------------
Val V GTT       9 | Ala A GCT      48 | Asp D GAT       0 | Gly G GGT       4
      GTC      53 |       GCC      45 |       GAC       0 |       GGC      11
      GTA       1 |       GCA      48 | Glu E GAA      56 |       GGA      19
      GTG      22 |       GCG      17 |       GAG       2 |       GGG       4
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.23509    C:0.19158    A:0.33544    G:0.23789
position  2:    T:0.31579    C:0.29544    A:0.21754    G:0.17123
position  3:    T:0.14456    C:0.28211    A:0.25544    G:0.31789
Average         T:0.23181    C:0.25637    A:0.26947    G:0.24234


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  
gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.1571 (0.1065 0.6779)
gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.3509 (0.0931 0.2653) 0.0284 (0.0180 0.6326)
gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.4660 (0.0998 0.2141) 0.0325 (0.0180 0.5541) 0.0329 (0.0059 0.1806)
gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.1465 (0.1099 0.7501) 0.0517 (0.0059 0.1151) 0.0357 (0.0241 0.6752) 0.0406 (0.0241 0.5923)
gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.1227 (0.1103 0.8993) 0.0336 (0.0060 0.1778) 0.0389 (0.0242 0.6219) 0.0443 (0.0242 0.5453) 0.0892 (0.0120 0.1345)
gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.1465 (0.1099 0.7501) 0.0517 (0.0059 0.1151) 0.0357 (0.0241 0.6752) 0.0465 (0.0241 0.5177) 0.3280 (0.0119 0.0364) 0.1282 (0.0120 0.0935)
gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.1587 (0.1101 0.6937) 0.0634 (0.0060 0.0940) 0.0385 (0.0241 0.6264) 0.0439 (0.0241 0.5490) 0.6696 (0.0120 0.0179) 0.1064 (0.0120 0.1130) 0.6696 (0.0120 0.0179)
gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                   0.1485 (0.1101 0.7418) 0.0522 (0.0060 0.1143) 0.0361 (0.0241 0.6684) 0.0411 (0.0241 0.5867) 0.3308 (0.0120 0.0362) 0.1293 (0.0120 0.0929) 0.3308 (0.0120 0.0362) 0.6752 (0.0120 0.0178)
gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1656 (0.1096 0.6622) 0.0513 (0.0059 0.1158) 0.0402 (0.0240 0.5980) 0.0460 (0.0240 0.5224) 0.3252 (0.0119 0.0367) 0.0884 (0.0120 0.1354) 0.3252 (0.0119 0.0367) 0.6640 (0.0119 0.0180) 0.3280 (0.0119 0.0364)
gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1367 (0.1098 0.8036) 0.0437 (0.0059 0.1362) 0.0334 (0.0241 0.7212) 0.0380 (0.0241 0.6334) 0.2157 (0.0119 0.0554) 0.0769 (0.0120 0.1559) 0.2157 (0.0119 0.0554) 0.3304 (0.0120 0.0362) 0.2176 (0.0120 0.0550) 0.2139 (0.0119 0.0557)
gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1443 (0.1096 0.7597) 0.0512 (0.0059 0.1159) 0.0352 (0.0240 0.6829) 0.0401 (0.0240 0.5987) 0.3248 (0.0119 0.0367) 0.0883 (0.0120 0.1355) 0.3248 (0.0119 0.0367) 0.6633 (0.0119 0.0180) 0.3276 (0.0119 0.0365) 0.3221 (0.0119 0.0369) 0.2136 (0.0119 0.0558)
gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1487 (0.1102 0.7408) 0.0522 (0.0060 0.1142) 0.0361 (0.0241 0.6676) 0.0412 (0.0241 0.5860) 0.3311 (0.0120 0.0362) 0.0901 (0.0120 0.1334) 0.3311 (0.0120 0.0362) 0.6759 (0.0120 0.0178) 0.3339 (0.0120 0.0359) 0.3283 (0.0119 0.0364) 0.2178 (0.0120 0.0550) 0.3280 (0.0119 0.0364)
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.2489 (0.0866 0.3480) 0.0158 (0.0180 1.1390) 0.0133 (0.0059 0.4489) 0.0286 (0.0119 0.4172) 0.0182 (0.0241 1.3217) 0.0203 (0.0242 1.1923) 0.0182 (0.0241 1.3217) 0.0200 (0.0242 1.2059) 0.0186 (0.0242 1.2996) 0.0179 (0.0240 1.3447) 0.0168 (0.0241 1.4363) 0.0193 (0.0240 1.2469) 0.0186 (0.0242 1.2969)
gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1465 (0.1099 0.7501) 0.0377 (0.0059 0.1577) 0.0334 (0.0241 0.7203) 0.0381 (0.0241 0.6326) 0.1599 (0.0119 0.0747) 0.0674 (0.0120 0.1778) 0.1599 (0.0119 0.0747) 0.2178 (0.0120 0.0550) 0.1613 (0.0120 0.0742) 0.1585 (0.0119 0.0752) 0.1261 (0.0119 0.0947) 0.1583 (0.0119 0.0753) 0.1615 (0.0120 0.0742) 0.0197 (0.0241 1.2248)
gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1462 (0.1098 0.7512) 0.0377 (0.0059 0.1578) 0.0334 (0.0241 0.7212) 0.0380 (0.0241 0.6334) 0.1597 (0.0119 0.0748) 0.0674 (0.0120 0.1779) 0.1597 (0.0119 0.0748) 0.2176 (0.0120 0.0550) 0.1611 (0.0120 0.0743) 0.1583 (0.0119 0.0753) 0.1260 (0.0119 0.0948) 0.1582 (0.0119 0.0753) 0.1613 (0.0120 0.0742) 0.0196 (0.0241 1.2272)-1.0000 (0.0119 0.0000)
gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1475 (0.1100 0.7459) 0.0332 (0.0060 0.1793) 0.0336 (0.0241 0.7165) 0.0359 (0.0241 0.6718) 0.1268 (0.0120 0.0943) 0.0601 (0.0120 0.1997) 0.1268 (0.0120 0.0943) 0.1620 (0.0120 0.0740) 0.1279 (0.0120 0.0937) 0.1257 (0.0119 0.0949) 0.1042 (0.0120 0.1148) 0.1256 (0.0119 0.0950) 0.1281 (0.0120 0.0936) 0.0199 (0.0241 1.2153) 0.6668 (0.0120 0.0179) 0.6661 (0.0120 0.0179)
gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1455 (0.1098 0.7544) 0.0515 (0.0059 0.1154) 0.0354 (0.0240 0.6786) 0.0404 (0.0240 0.5951) 0.3266 (0.0119 0.0365) 0.0888 (0.0120 0.1349) 0.3266 (0.0119 0.0365) 0.6668 (0.0120 0.0179) 0.3294 (0.0120 0.0363) 0.3238 (0.0119 0.0368) 0.2148 (0.0119 0.0555) 0.3235 (0.0119 0.0368) 0.3297 (0.0120 0.0363) 0.0210 (0.0241 1.1474) 0.3266 (0.0119 0.0365) 0.3262 (0.0119 0.0366) 0.2159 (0.0119 0.0553)
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M                  0.1973 (0.0934 0.4732) 0.0339 (0.0241 0.7110) 0.0289 (0.0120 0.4146) 0.0469 (0.0180 0.3845) 0.0426 (0.0303 0.7110) 0.0464 (0.0304 0.6553) 0.0426 (0.0303 0.7110) 0.0460 (0.0304 0.6601) 0.0431 (0.0304 0.7037) 0.0421 (0.0302 0.7184) 0.0399 (0.0303 0.7590) 0.0420 (0.0302 0.7194) 0.0432 (0.0304 0.7028) 0.0168 (0.0060 0.3541) 0.0485 (0.0303 0.6249) 0.0484 (0.0303 0.6257) 0.0488 (0.0303 0.6219) 0.0482 (0.0303 0.6280)


Model 0: one-ratio


TREE #  1:  (1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
lnL(ntime: 22  np: 24):   -846.029786      +0.000000
  20..1    20..3    20..4    20..21   21..2    21..5    21..6    21..7    21..8    21..9    21..10   21..11   21..12   21..13   21..22   22..15   22..16   22..17   21..18   20..23   23..14   23..19 
 0.402703 0.073037 0.069874 0.391999 0.070542 0.027166 0.097339 0.027025 0.013499 0.027075 0.027232 0.040920 0.027653 0.027094 0.041396 0.013528 0.013514 0.027284 0.027162 0.118937 0.131509 0.134351 4.985594 0.138130

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.83084

(1: 0.402703, 3: 0.073037, 4: 0.069874, (2: 0.070542, 5: 0.027166, 6: 0.097339, 7: 0.027025, 8: 0.013499, 9: 0.027075, 10: 0.027232, 11: 0.040920, 12: 0.027653, 13: 0.027094, (15: 0.013528, 16: 0.013514, 17: 0.027284): 0.041396, 18: 0.027162): 0.391999, (14: 0.131509, 19: 0.134351): 0.118937);

(gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.402703, gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.073037, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.069874, (gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.070542, gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027166, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.097339, gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027025, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013499, gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027075, gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027232, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.040920, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027653, gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027094, (gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013528, gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013514, gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027284): 0.041396, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027162): 0.391999, (gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.131509, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.134351): 0.118937);

Detailed output identifying parameters

kappa (ts/tv) =  4.98559

omega (dN/dS) =  0.13813

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  20..1      0.403   160.5    64.5  0.1381  0.0481  0.3484   7.7  22.5
  20..3      0.073   160.5    64.5  0.1381  0.0087  0.0632   1.4   4.1
  20..4      0.070   160.5    64.5  0.1381  0.0084  0.0605   1.3   3.9
  20..21     0.392   160.5    64.5  0.1381  0.0468  0.3391   7.5  21.9
  21..2      0.071   160.5    64.5  0.1381  0.0084  0.0610   1.4   3.9
  21..5      0.027   160.5    64.5  0.1381  0.0032  0.0235   0.5   1.5
  21..6      0.097   160.5    64.5  0.1381  0.0116  0.0842   1.9   5.4
  21..7      0.027   160.5    64.5  0.1381  0.0032  0.0234   0.5   1.5
  21..8      0.013   160.5    64.5  0.1381  0.0016  0.0117   0.3   0.8
  21..9      0.027   160.5    64.5  0.1381  0.0032  0.0234   0.5   1.5
  21..10     0.027   160.5    64.5  0.1381  0.0033  0.0236   0.5   1.5
  21..11     0.041   160.5    64.5  0.1381  0.0049  0.0354   0.8   2.3
  21..12     0.028   160.5    64.5  0.1381  0.0033  0.0239   0.5   1.5
  21..13     0.027   160.5    64.5  0.1381  0.0032  0.0234   0.5   1.5
  21..22     0.041   160.5    64.5  0.1381  0.0049  0.0358   0.8   2.3
  22..15     0.014   160.5    64.5  0.1381  0.0016  0.0117   0.3   0.8
  22..16     0.014   160.5    64.5  0.1381  0.0016  0.0117   0.3   0.8
  22..17     0.027   160.5    64.5  0.1381  0.0033  0.0236   0.5   1.5
  21..18     0.027   160.5    64.5  0.1381  0.0032  0.0235   0.5   1.5
  20..23     0.119   160.5    64.5  0.1381  0.0142  0.1029   2.3   6.6
  23..14     0.132   160.5    64.5  0.1381  0.0157  0.1138   2.5   7.3
  23..19     0.134   160.5    64.5  0.1381  0.0161  0.1162   2.6   7.5

tree length for dN:       0.2188
tree length for dS:       1.5840


Time used:  0:12


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
lnL(ntime: 22  np: 25):   -846.030213      +0.000000
  20..1    20..3    20..4    20..21   21..2    21..5    21..6    21..7    21..8    21..9    21..10   21..11   21..12   21..13   21..22   22..15   22..16   22..17   21..18   20..23   23..14   23..19 
 0.402706 0.073038 0.069875 0.392003 0.070543 0.027166 0.097340 0.027025 0.013499 0.027076 0.027233 0.040920 0.027653 0.027094 0.041397 0.013528 0.013514 0.027284 0.027163 0.118938 0.131510 0.134352 4.985612 0.999990 0.138130

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.83086

(1: 0.402706, 3: 0.073038, 4: 0.069875, (2: 0.070543, 5: 0.027166, 6: 0.097340, 7: 0.027025, 8: 0.013499, 9: 0.027076, 10: 0.027233, 11: 0.040920, 12: 0.027653, 13: 0.027094, (15: 0.013528, 16: 0.013514, 17: 0.027284): 0.041397, 18: 0.027163): 0.392003, (14: 0.131510, 19: 0.134352): 0.118938);

(gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.402706, gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.073038, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.069875, (gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.070543, gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027166, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.097340, gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027025, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013499, gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027076, gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027233, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.040920, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027653, gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027094, (gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013528, gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013514, gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027284): 0.041397, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027163): 0.392003, (gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.131510, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.134352): 0.118938);

Detailed output identifying parameters

kappa (ts/tv) =  4.98561


dN/dS (w) for site classes (K=2)

p:   0.99999  0.00001
w:   0.13813  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  20..1       0.403    160.5     64.5   0.1381   0.0481   0.3484    7.7   22.5
  20..3       0.073    160.5     64.5   0.1381   0.0087   0.0632    1.4    4.1
  20..4       0.070    160.5     64.5   0.1381   0.0084   0.0605    1.3    3.9
  20..21      0.392    160.5     64.5   0.1381   0.0468   0.3391    7.5   21.9
  21..2       0.071    160.5     64.5   0.1381   0.0084   0.0610    1.4    3.9
  21..5       0.027    160.5     64.5   0.1381   0.0032   0.0235    0.5    1.5
  21..6       0.097    160.5     64.5   0.1381   0.0116   0.0842    1.9    5.4
  21..7       0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..8       0.013    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  21..9       0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..10      0.027    160.5     64.5   0.1381   0.0033   0.0236    0.5    1.5
  21..11      0.041    160.5     64.5   0.1381   0.0049   0.0354    0.8    2.3
  21..12      0.028    160.5     64.5   0.1381   0.0033   0.0239    0.5    1.5
  21..13      0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..22      0.041    160.5     64.5   0.1381   0.0049   0.0358    0.8    2.3
  22..15      0.014    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  22..16      0.014    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  22..17      0.027    160.5     64.5   0.1381   0.0033   0.0236    0.5    1.5
  21..18      0.027    160.5     64.5   0.1381   0.0032   0.0235    0.5    1.5
  20..23      0.119    160.5     64.5   0.1381   0.0142   0.1029    2.3    6.6
  23..14      0.132    160.5     64.5   0.1381   0.0157   0.1138    2.5    7.3
  23..19      0.134    160.5     64.5   0.1381   0.0161   0.1162    2.6    7.5


Time used:  0:26


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
lnL(ntime: 22  np: 27):   -846.029786      +0.000000
  20..1    20..3    20..4    20..21   21..2    21..5    21..6    21..7    21..8    21..9    21..10   21..11   21..12   21..13   21..22   22..15   22..16   22..17   21..18   20..23   23..14   23..19 
 0.402703 0.073037 0.069874 0.391999 0.070542 0.027166 0.097339 0.027025 0.013499 0.027075 0.027232 0.040920 0.027653 0.027094 0.041396 0.013528 0.013514 0.027284 0.027162 0.118937 0.131509 0.134351 4.985593 1.000000 0.000000 0.138130 26.308353

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.83084

(1: 0.402703, 3: 0.073037, 4: 0.069874, (2: 0.070542, 5: 0.027166, 6: 0.097339, 7: 0.027025, 8: 0.013499, 9: 0.027075, 10: 0.027232, 11: 0.040920, 12: 0.027653, 13: 0.027094, (15: 0.013528, 16: 0.013514, 17: 0.027284): 0.041396, 18: 0.027162): 0.391999, (14: 0.131509, 19: 0.134351): 0.118937);

(gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.402703, gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.073037, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.069874, (gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.070542, gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027166, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.097339, gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027025, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013499, gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027075, gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027232, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.040920, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027653, gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027094, (gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013528, gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013514, gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027284): 0.041396, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027162): 0.391999, (gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.131509, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.134351): 0.118937);

Detailed output identifying parameters

kappa (ts/tv) =  4.98559


dN/dS (w) for site classes (K=3)

p:   1.00000  0.00000  0.00000
w:   0.13813  1.00000 26.30835
(note that p[2] is zero)


dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  20..1       0.403    160.5     64.5   0.1381   0.0481   0.3484    7.7   22.5
  20..3       0.073    160.5     64.5   0.1381   0.0087   0.0632    1.4    4.1
  20..4       0.070    160.5     64.5   0.1381   0.0084   0.0605    1.3    3.9
  20..21      0.392    160.5     64.5   0.1381   0.0468   0.3391    7.5   21.9
  21..2       0.071    160.5     64.5   0.1381   0.0084   0.0610    1.4    3.9
  21..5       0.027    160.5     64.5   0.1381   0.0032   0.0235    0.5    1.5
  21..6       0.097    160.5     64.5   0.1381   0.0116   0.0842    1.9    5.4
  21..7       0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..8       0.013    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  21..9       0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..10      0.027    160.5     64.5   0.1381   0.0033   0.0236    0.5    1.5
  21..11      0.041    160.5     64.5   0.1381   0.0049   0.0354    0.8    2.3
  21..12      0.028    160.5     64.5   0.1381   0.0033   0.0239    0.5    1.5
  21..13      0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..22      0.041    160.5     64.5   0.1381   0.0049   0.0358    0.8    2.3
  22..15      0.014    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  22..16      0.014    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  22..17      0.027    160.5     64.5   0.1381   0.0033   0.0236    0.5    1.5
  21..18      0.027    160.5     64.5   0.1381   0.0032   0.0235    0.5    1.5
  20..23      0.119    160.5     64.5   0.1381   0.0142   0.1029    2.3    6.6
  23..14      0.132    160.5     64.5   0.1381   0.0157   0.1138    2.5    7.3
  23..19      0.134    160.5     64.5   0.1381   0.0161   0.1162    2.6    7.5


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.000  0.999  0.001  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.151  0.104  0.095  0.093  0.093  0.093  0.093  0.093  0.093  0.093

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.013 0.981

sum of density on p0-p1 =   1.000000

Time used:  1:10


Model 3: discrete (3 categories)


TREE #  1:  (1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
lnL(ntime: 22  np: 28):   -846.029786      +0.000000
  20..1    20..3    20..4    20..21   21..2    21..5    21..6    21..7    21..8    21..9    21..10   21..11   21..12   21..13   21..22   22..15   22..16   22..17   21..18   20..23   23..14   23..19 
 0.402703 0.073037 0.069874 0.391999 0.070542 0.027166 0.097339 0.027025 0.013499 0.027075 0.027232 0.040920 0.027653 0.027094 0.041396 0.013528 0.013514 0.027284 0.027162 0.118938 0.131509 0.134351 4.985593 0.301082 0.174156 0.138130 0.138130 0.138130

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.83084

(1: 0.402703, 3: 0.073037, 4: 0.069874, (2: 0.070542, 5: 0.027166, 6: 0.097339, 7: 0.027025, 8: 0.013499, 9: 0.027075, 10: 0.027232, 11: 0.040920, 12: 0.027653, 13: 0.027094, (15: 0.013528, 16: 0.013514, 17: 0.027284): 0.041396, 18: 0.027162): 0.391999, (14: 0.131509, 19: 0.134351): 0.118938);

(gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.402703, gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.073037, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.069874, (gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.070542, gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027166, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.097339, gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027025, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013499, gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027075, gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027232, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.040920, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027653, gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027094, (gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013528, gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013514, gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027284): 0.041396, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027162): 0.391999, (gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.131509, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.134351): 0.118938);

Detailed output identifying parameters

kappa (ts/tv) =  4.98559


dN/dS (w) for site classes (K=3)

p:   0.30108  0.17416  0.52476
w:   0.13813  0.13813  0.13813

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  20..1       0.403    160.5     64.5   0.1381   0.0481   0.3484    7.7   22.5
  20..3       0.073    160.5     64.5   0.1381   0.0087   0.0632    1.4    4.1
  20..4       0.070    160.5     64.5   0.1381   0.0084   0.0605    1.3    3.9
  20..21      0.392    160.5     64.5   0.1381   0.0468   0.3391    7.5   21.9
  21..2       0.071    160.5     64.5   0.1381   0.0084   0.0610    1.4    3.9
  21..5       0.027    160.5     64.5   0.1381   0.0032   0.0235    0.5    1.5
  21..6       0.097    160.5     64.5   0.1381   0.0116   0.0842    1.9    5.4
  21..7       0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..8       0.013    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  21..9       0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..10      0.027    160.5     64.5   0.1381   0.0033   0.0236    0.5    1.5
  21..11      0.041    160.5     64.5   0.1381   0.0049   0.0354    0.8    2.3
  21..12      0.028    160.5     64.5   0.1381   0.0033   0.0239    0.5    1.5
  21..13      0.027    160.5     64.5   0.1381   0.0032   0.0234    0.5    1.5
  21..22      0.041    160.5     64.5   0.1381   0.0049   0.0358    0.8    2.3
  22..15      0.014    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  22..16      0.014    160.5     64.5   0.1381   0.0016   0.0117    0.3    0.8
  22..17      0.027    160.5     64.5   0.1381   0.0033   0.0236    0.5    1.5
  21..18      0.027    160.5     64.5   0.1381   0.0032   0.0235    0.5    1.5
  20..23      0.119    160.5     64.5   0.1381   0.0142   0.1029    2.3    6.6
  23..14      0.132    160.5     64.5   0.1381   0.0157   0.1138    2.5    7.3
  23..19      0.134    160.5     64.5   0.1381   0.0161   0.1162    2.6    7.5


Naive Empirical Bayes (NEB) analysis
Time used:  1:28


Model 7: beta (10 categories)


TREE #  1:  (1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
lnL(ntime: 22  np: 25):   -846.205842      +0.000000
  20..1    20..3    20..4    20..21   21..2    21..5    21..6    21..7    21..8    21..9    21..10   21..11   21..12   21..13   21..22   22..15   22..16   22..17   21..18   20..23   23..14   23..19 
 0.402671 0.073073 0.069912 0.392015 0.070560 0.027175 0.097370 0.027033 0.013504 0.027085 0.027241 0.040932 0.027661 0.027103 0.041407 0.013532 0.013518 0.027291 0.027169 0.118946 0.131556 0.134368 4.991725 16.134754 99.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.83112

(1: 0.402671, 3: 0.073073, 4: 0.069912, (2: 0.070560, 5: 0.027175, 6: 0.097370, 7: 0.027033, 8: 0.013504, 9: 0.027085, 10: 0.027241, 11: 0.040932, 12: 0.027661, 13: 0.027103, (15: 0.013532, 16: 0.013518, 17: 0.027291): 0.041407, 18: 0.027169): 0.392015, (14: 0.131556, 19: 0.134368): 0.118946);

(gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.402671, gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.073073, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.069912, (gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.070560, gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027175, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.097370, gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027033, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013504, gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027085, gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027241, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.040932, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027661, gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027103, (gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013532, gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013518, gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027291): 0.041407, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027169): 0.392015, (gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.131556, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.134368): 0.118946);

Detailed output identifying parameters

kappa (ts/tv) =  4.99173

Parameters in M7 (beta):
 p =  16.13475  q =  99.00000


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.09092  0.10699  0.11731  0.12597  0.13404  0.14213  0.15076  0.16070  0.17362  0.19648

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  20..1       0.403    160.5     64.5   0.1399   0.0486   0.3472    7.8   22.4
  20..3       0.073    160.5     64.5   0.1399   0.0088   0.0630    1.4    4.1
  20..4       0.070    160.5     64.5   0.1399   0.0084   0.0603    1.4    3.9
  20..21      0.392    160.5     64.5   0.1399   0.0473   0.3380    7.6   21.8
  21..2       0.071    160.5     64.5   0.1399   0.0085   0.0608    1.4    3.9
  21..5       0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  21..6       0.097    160.5     64.5   0.1399   0.0117   0.0840    1.9    5.4
  21..7       0.027    160.5     64.5   0.1399   0.0033   0.0233    0.5    1.5
  21..8       0.014    160.5     64.5   0.1399   0.0016   0.0116    0.3    0.8
  21..9       0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  21..10      0.027    160.5     64.5   0.1399   0.0033   0.0235    0.5    1.5
  21..11      0.041    160.5     64.5   0.1399   0.0049   0.0353    0.8    2.3
  21..12      0.028    160.5     64.5   0.1399   0.0033   0.0239    0.5    1.5
  21..13      0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  21..22      0.041    160.5     64.5   0.1399   0.0050   0.0357    0.8    2.3
  22..15      0.014    160.5     64.5   0.1399   0.0016   0.0117    0.3    0.8
  22..16      0.014    160.5     64.5   0.1399   0.0016   0.0117    0.3    0.8
  22..17      0.027    160.5     64.5   0.1399   0.0033   0.0235    0.5    1.5
  21..18      0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  20..23      0.119    160.5     64.5   0.1399   0.0143   0.1026    2.3    6.6
  23..14      0.132    160.5     64.5   0.1399   0.0159   0.1134    2.5    7.3
  23..19      0.134    160.5     64.5   0.1399   0.0162   0.1159    2.6    7.5


Time used:  3:14


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 3, 4, (2, 5, 6, 7, 8, 9, 10, 11, 12, 13, (15, 16, 17), 18), (14, 19));   MP score: 115
lnL(ntime: 22  np: 27):   -846.206268      +0.000000
  20..1    20..3    20..4    20..21   21..2    21..5    21..6    21..7    21..8    21..9    21..10   21..11   21..12   21..13   21..22   22..15   22..16   22..17   21..18   20..23   23..14   23..19 
 0.402674 0.073074 0.069913 0.392018 0.070561 0.027175 0.097371 0.027033 0.013504 0.027086 0.027241 0.040932 0.027661 0.027103 0.041408 0.013532 0.013518 0.027292 0.027170 0.118947 0.131558 0.134370 4.991745 0.999990 16.134726 99.000000 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   1.83114

(1: 0.402674, 3: 0.073074, 4: 0.069913, (2: 0.070561, 5: 0.027175, 6: 0.097371, 7: 0.027033, 8: 0.013504, 9: 0.027086, 10: 0.027241, 11: 0.040932, 12: 0.027661, 13: 0.027103, (15: 0.013532, 16: 0.013518, 17: 0.027292): 0.041408, 18: 0.027170): 0.392018, (14: 0.131558, 19: 0.134370): 0.118947);

(gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.402674, gb:KF268948|Organism:Zika_virus|Strain_Name:ARB13565|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.073074, gb:KF383115|Organism:Zika_virus|Strain_Name:ArB1362|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.069913, (gb:KX051560|Organism:Zika_virus|Strain_Name:SK364/13AS|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.070561, gb:KY014296|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/BRA/2016/FC-DQ131D1-URI|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027175, gb:KU681082|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-tc/PHL/2012/CPC-0740|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.097371, gb:KX447516|Organism:Zika_virus|Strain_Name:1_0111_PF|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027033, gb:KX520666|Organism:Zika_virus|Strain_Name:HS-2015-BA-01|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013504, gb:KU870645|Organism:Zika_virus|Strain_Name:FB-GWUH-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027086, gb:KX806557|Organism:Zika_virus|Strain_Name:TS17-2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027241, gb:KX811222|Organism:Zika_virus|Strain_Name:Brazil_2015_MG|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.040932, gb:LC219720|Organism:Zika_virus|Strain_Name:ZIKV/Hu/NIID123/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027661, gb:KX369547|Organism:Zika_virus|Strain_Name:PF13/251013-18|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027103, (gb:MF574557|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00007/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013532, gb:MF574556|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00021/2015|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.013518, gb:KU922923|Organism:Zika_virus|Strain_Name:MEX/InDRE/Lm/2016|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027292): 0.041408, gb:KY075932|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/USA/2016/FL001Sa|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.027170): 0.392018, (gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.131558, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M: 0.134370): 0.118947);

Detailed output identifying parameters

kappa (ts/tv) =  4.99174

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =  16.13473 q =  99.00000
 (p1 =   0.00001) w =   1.00000


dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.09092  0.10699  0.11731  0.12597  0.13404  0.14213  0.15076  0.16070  0.17362  0.19648  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  20..1       0.403    160.5     64.5   0.1399   0.0486   0.3472    7.8   22.4
  20..3       0.073    160.5     64.5   0.1399   0.0088   0.0630    1.4    4.1
  20..4       0.070    160.5     64.5   0.1399   0.0084   0.0603    1.4    3.9
  20..21      0.392    160.5     64.5   0.1399   0.0473   0.3380    7.6   21.8
  21..2       0.071    160.5     64.5   0.1399   0.0085   0.0608    1.4    3.9
  21..5       0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  21..6       0.097    160.5     64.5   0.1399   0.0117   0.0840    1.9    5.4
  21..7       0.027    160.5     64.5   0.1399   0.0033   0.0233    0.5    1.5
  21..8       0.014    160.5     64.5   0.1399   0.0016   0.0116    0.3    0.8
  21..9       0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  21..10      0.027    160.5     64.5   0.1399   0.0033   0.0235    0.5    1.5
  21..11      0.041    160.5     64.5   0.1399   0.0049   0.0353    0.8    2.3
  21..12      0.028    160.5     64.5   0.1399   0.0033   0.0239    0.5    1.5
  21..13      0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  21..22      0.041    160.5     64.5   0.1399   0.0050   0.0357    0.8    2.3
  22..15      0.014    160.5     64.5   0.1399   0.0016   0.0117    0.3    0.8
  22..16      0.014    160.5     64.5   0.1399   0.0016   0.0117    0.3    0.8
  22..17      0.027    160.5     64.5   0.1399   0.0033   0.0235    0.5    1.5
  21..18      0.027    160.5     64.5   0.1399   0.0033   0.0234    0.5    1.5
  20..23      0.119    160.5     64.5   0.1399   0.0143   0.1026    2.3    6.6
  23..14      0.132    160.5     64.5   0.1399   0.0159   0.1134    2.5    7.3
  23..19      0.134    160.5     64.5   0.1399   0.0162   0.1159    2.6    7.5


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:membrane_glycoprotein_M|Gene_Symbol:M)

            Pr(w>1)     post mean +- SE for w




The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.001  0.999
p :   0.212  0.650  0.132  0.007  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.005  0.017  0.032  0.052  0.091  0.160  0.258  0.385
ws:   0.216  0.105  0.089  0.086  0.085  0.084  0.084  0.084  0.084  0.084

Time used:  4:34
Download 
Model 1: NearlyNeutral	-846.030213
Model 2: PositiveSelection	-846.029786
Model 0: one-ratio	-846.029786
Model 3: discrete	-846.029786
Model 7: beta	-846.205842
Model 8: beta&w>1	-846.206268


Model 0 vs 1	8.54000000117594E-4

Model 2 vs 1	8.54000000117594E-4

Model 8 vs 7	8.520000001226435E-4

i3S

Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal

If you use B+, please cite us:

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3

IBMC INEB IPATIMUP UPORTO