Back

A_C - Muscle

Download 
--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Nov 06 09:45:48 WET 2017
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS1/Zikaomegamapresults/C/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -904.32          -928.62
2       -905.06          -929.06
--------------------------------------
TOTAL     -904.62          -928.86
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.596162    0.008314    0.430291    0.775473    0.587543   1202.83   1351.91    1.000
r(A<->C){all}   0.031876    0.000437    0.000029    0.072190    0.028215    837.49    921.55    1.000
r(A<->G){all}   0.300426    0.004537    0.183088    0.445040    0.297105    513.89    573.29    1.000
r(A<->T){all}   0.122645    0.001542    0.047636    0.196706    0.117938    614.31    653.59    1.000
r(C<->G){all}   0.025682    0.000412    0.000077    0.064511    0.021067    543.71    659.97    1.001
r(C<->T){all}   0.473610    0.007317    0.306951    0.639662    0.471423    500.12    502.99    1.001
r(G<->T){all}   0.045762    0.000644    0.002256    0.093212    0.042011    684.73    809.80    1.000
pi(A){all}      0.313542    0.000554    0.266559    0.356358    0.313504   1208.42   1302.18    1.000
pi(C){all}      0.192577    0.000413    0.153156    0.232237    0.192017   1192.06   1235.91    1.001
pi(G){all}      0.280818    0.000543    0.235507    0.325112    0.280091    989.47   1139.25    1.001
pi(T){all}      0.213063    0.000429    0.172701    0.253739    0.212570   1041.84   1170.64    1.000
alpha{1,2}      0.095377    0.004184    0.000229    0.210169    0.088981    809.61    905.28    1.000
alpha{3}        1.473509    0.422139    0.507450    2.776763    1.345862   1243.14   1350.30    1.001
pinvar{all}     0.185639    0.013253    0.000304    0.401313    0.170090    838.63   1001.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-872.698599
Model 2: PositiveSelection	-872.147493
Model 0: one-ratio	-884.837533
Model 3: discrete	-872.697382
Model 7: beta	-872.796177
Model 8: beta&w>1	-871.987318


Model 0 vs 1	24.277868000000126

Model 2 vs 1	1.1022119999997813

Model 8 vs 7	1.617717999999968
Download 
>C1
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C2
MKNPKEEIRRIRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C3
MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C4
MKNPKRKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C5
MKNPKKRSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C6
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C7
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C8
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGTVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C9
MKNPKKKSGRFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C10
MKNPKKKSGGFRIVNMLGRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C11
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFMAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C12
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C13
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIMKKFKKDLAAMLRIINARKE
KKRR
>C14
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINAGKE
KKRR
>C15
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=15, Len=104 

C1              MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C2              MKNPKEEIRRIRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C3              MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C4              MKNPKRKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C5              MKNPKKRSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C6              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C7              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C8              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C9              MKNPKKKSGRFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C10             MKNPKKKSGGFRIVNMLGRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C11             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C12             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C13             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C14             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C15             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
                *****..   :****** ******.*:***********************

C1              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C2              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C3              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C4              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C5              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C6              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C7              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C8              LAFLRFTAIKPSLGLINRWGTVGKKEAMEIIKKFKKDLAAMLRIINARKE
C9              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C10             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C11             LAFLRFMAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C12             LAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKE
C13             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIMKKFKKDLAAMLRIINARKE
C14             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINAGKE
C15             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
                ****** *************:****:****:**************** **

C1              KKRR
C2              KKRR
C3              RKRR
C4              RKRR
C5              RKRR
C6              RKRR
C7              KKRR
C8              RKRR
C9              RKRR
C10             KKRR
C11             KKRR
C12             KKRR
C13             KKRR
C14             KKRR
C15             KKKR
                :*:*




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [21840]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [21840]--->[21840]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.752 Mb, Max= 31.347 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C2              MKNPKEEIRRIRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C3              MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C4              MKNPKRKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C5              MKNPKKRSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C6              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C7              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C8              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C9              MKNPKKKSGRFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
C10             MKNPKKKSGGFRIVNMLGRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C11             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C12             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C13             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C14             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
C15             MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
                *****..   :****** ******.*:***********************

C1              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C2              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C3              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C4              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C5              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C6              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C7              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C8              LAFLRFTAIKPSLGLINRWGTVGKKEAMEIIKKFKKDLAAMLRIINARKE
C9              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C10             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C11             LAFLRFMAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
C12             LAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKE
C13             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIMKKFKKDLAAMLRIINARKE
C14             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINAGKE
C15             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
                ****** *************:****:****:**************** **

C1              KKRR
C2              KKRR
C3              RKRR
C4              RKRR
C5              RKRR
C6              RKRR
C7              KKRR
C8              RKRR
C9              RKRR
C10             KKRR
C11             KKRR
C12             KKRR
C13             KKRR
C14             KKRR
C15             KKKR
                :*:*




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# SEQ_INDEX C15 14
# PW_SEQ_DISTANCES 
BOT	    0    1	 94.23  C1	  C2	 94.23
TOP	    1    0	 94.23  C2	  C1	 94.23
BOT	    0    2	 91.35  C1	  C3	 91.35
TOP	    2    0	 91.35  C3	  C1	 91.35
BOT	    0    3	 96.15  C1	  C4	 96.15
TOP	    3    0	 96.15  C4	  C1	 96.15
BOT	    0    4	 96.15  C1	  C5	 96.15
TOP	    4    0	 96.15  C5	  C1	 96.15
BOT	    0    5	 97.12  C1	  C6	 97.12
TOP	    5    0	 97.12  C6	  C1	 97.12
BOT	    0    6	 98.08  C1	  C7	 98.08
TOP	    6    0	 98.08  C7	  C1	 98.08
BOT	    0    7	 96.15  C1	  C8	 96.15
TOP	    7    0	 96.15  C8	  C1	 96.15
BOT	    0    8	 96.15  C1	  C9	 96.15
TOP	    8    0	 96.15  C9	  C1	 96.15
BOT	    0    9	 99.04  C1	 C10	 99.04
TOP	    9    0	 99.04 C10	  C1	 99.04
BOT	    0   10	 99.04  C1	 C11	 99.04
TOP	   10    0	 99.04 C11	  C1	 99.04
BOT	    0   11	 99.04  C1	 C12	 99.04
TOP	   11    0	 99.04 C12	  C1	 99.04
BOT	    0   12	 99.04  C1	 C13	 99.04
TOP	   12    0	 99.04 C13	  C1	 99.04
BOT	    0   13	 99.04  C1	 C14	 99.04
TOP	   13    0	 99.04 C14	  C1	 99.04
BOT	    0   14	 99.04  C1	 C15	 99.04
TOP	   14    0	 99.04 C15	  C1	 99.04
BOT	    1    2	 97.12  C2	  C3	 97.12
TOP	    2    1	 97.12  C3	  C2	 97.12
BOT	    1    3	 91.35  C2	  C4	 91.35
TOP	    3    1	 91.35  C4	  C2	 91.35
BOT	    1    4	 91.35  C2	  C5	 91.35
TOP	    4    1	 91.35  C5	  C2	 91.35
BOT	    1    5	 91.35  C2	  C6	 91.35
TOP	    5    1	 91.35  C6	  C2	 91.35
BOT	    1    6	 92.31  C2	  C7	 92.31
TOP	    6    1	 92.31  C7	  C2	 92.31
BOT	    1    7	 90.38  C2	  C8	 90.38
TOP	    7    1	 90.38  C8	  C2	 90.38
BOT	    1    8	 92.31  C2	  C9	 92.31
TOP	    8    1	 92.31  C9	  C2	 92.31
BOT	    1    9	 93.27  C2	 C10	 93.27
TOP	    9    1	 93.27 C10	  C2	 93.27
BOT	    1   10	 93.27  C2	 C11	 93.27
TOP	   10    1	 93.27 C11	  C2	 93.27
BOT	    1   11	 93.27  C2	 C12	 93.27
TOP	   11    1	 93.27 C12	  C2	 93.27
BOT	    1   12	 93.27  C2	 C13	 93.27
TOP	   12    1	 93.27 C13	  C2	 93.27
BOT	    1   13	 93.27  C2	 C14	 93.27
TOP	   13    1	 93.27 C14	  C2	 93.27
BOT	    1   14	 93.27  C2	 C15	 93.27
TOP	   14    1	 93.27 C15	  C2	 93.27
BOT	    2    3	 94.23  C3	  C4	 94.23
TOP	    3    2	 94.23  C4	  C3	 94.23
BOT	    2    4	 94.23  C3	  C5	 94.23
TOP	    4    2	 94.23  C5	  C3	 94.23
BOT	    2    5	 94.23  C3	  C6	 94.23
TOP	    5    2	 94.23  C6	  C3	 94.23
BOT	    2    6	 93.27  C3	  C7	 93.27
TOP	    6    2	 93.27  C7	  C3	 93.27
BOT	    2    7	 93.27  C3	  C8	 93.27
TOP	    7    2	 93.27  C8	  C3	 93.27
BOT	    2    8	 95.19  C3	  C9	 95.19
TOP	    8    2	 95.19  C9	  C3	 95.19
BOT	    2    9	 90.38  C3	 C10	 90.38
TOP	    9    2	 90.38 C10	  C3	 90.38
BOT	    2   10	 90.38  C3	 C11	 90.38
TOP	   10    2	 90.38 C11	  C3	 90.38
BOT	    2   11	 90.38  C3	 C12	 90.38
TOP	   11    2	 90.38 C12	  C3	 90.38
BOT	    2   12	 90.38  C3	 C13	 90.38
TOP	   12    2	 90.38 C13	  C3	 90.38
BOT	    2   13	 90.38  C3	 C14	 90.38
TOP	   13    2	 90.38 C14	  C3	 90.38
BOT	    2   14	 90.38  C3	 C15	 90.38
TOP	   14    2	 90.38 C15	  C3	 90.38
BOT	    3    4	 98.08  C4	  C5	 98.08
TOP	    4    3	 98.08  C5	  C4	 98.08
BOT	    3    5	 99.04  C4	  C6	 99.04
TOP	    5    3	 99.04  C6	  C4	 99.04
BOT	    3    6	 98.08  C4	  C7	 98.08
TOP	    6    3	 98.08  C7	  C4	 98.08
BOT	    3    7	 98.08  C4	  C8	 98.08
TOP	    7    3	 98.08  C8	  C4	 98.08
BOT	    3    8	 98.08  C4	  C9	 98.08
TOP	    8    3	 98.08  C9	  C4	 98.08
BOT	    3    9	 95.19  C4	 C10	 95.19
TOP	    9    3	 95.19 C10	  C4	 95.19
BOT	    3   10	 95.19  C4	 C11	 95.19
TOP	   10    3	 95.19 C11	  C4	 95.19
BOT	    3   11	 95.19  C4	 C12	 95.19
TOP	   11    3	 95.19 C12	  C4	 95.19
BOT	    3   12	 95.19  C4	 C13	 95.19
TOP	   12    3	 95.19 C13	  C4	 95.19
BOT	    3   13	 95.19  C4	 C14	 95.19
TOP	   13    3	 95.19 C14	  C4	 95.19
BOT	    3   14	 95.19  C4	 C15	 95.19
TOP	   14    3	 95.19 C15	  C4	 95.19
BOT	    4    5	 99.04  C5	  C6	 99.04
TOP	    5    4	 99.04  C6	  C5	 99.04
BOT	    4    6	 98.08  C5	  C7	 98.08
TOP	    6    4	 98.08  C7	  C5	 98.08
BOT	    4    7	 98.08  C5	  C8	 98.08
TOP	    7    4	 98.08  C8	  C5	 98.08
BOT	    4    8	 98.08  C5	  C9	 98.08
TOP	    8    4	 98.08  C9	  C5	 98.08
BOT	    4    9	 95.19  C5	 C10	 95.19
TOP	    9    4	 95.19 C10	  C5	 95.19
BOT	    4   10	 95.19  C5	 C11	 95.19
TOP	   10    4	 95.19 C11	  C5	 95.19
BOT	    4   11	 95.19  C5	 C12	 95.19
TOP	   11    4	 95.19 C12	  C5	 95.19
BOT	    4   12	 95.19  C5	 C13	 95.19
TOP	   12    4	 95.19 C13	  C5	 95.19
BOT	    4   13	 95.19  C5	 C14	 95.19
TOP	   13    4	 95.19 C14	  C5	 95.19
BOT	    4   14	 95.19  C5	 C15	 95.19
TOP	   14    4	 95.19 C15	  C5	 95.19
BOT	    5    6	 99.04  C6	  C7	 99.04
TOP	    6    5	 99.04  C7	  C6	 99.04
BOT	    5    7	 99.04  C6	  C8	 99.04
TOP	    7    5	 99.04  C8	  C6	 99.04
BOT	    5    8	 99.04  C6	  C9	 99.04
TOP	    8    5	 99.04  C9	  C6	 99.04
BOT	    5    9	 96.15  C6	 C10	 96.15
TOP	    9    5	 96.15 C10	  C6	 96.15
BOT	    5   10	 96.15  C6	 C11	 96.15
TOP	   10    5	 96.15 C11	  C6	 96.15
BOT	    5   11	 96.15  C6	 C12	 96.15
TOP	   11    5	 96.15 C12	  C6	 96.15
BOT	    5   12	 96.15  C6	 C13	 96.15
TOP	   12    5	 96.15 C13	  C6	 96.15
BOT	    5   13	 96.15  C6	 C14	 96.15
TOP	   13    5	 96.15 C14	  C6	 96.15
BOT	    5   14	 96.15  C6	 C15	 96.15
TOP	   14    5	 96.15 C15	  C6	 96.15
BOT	    6    7	 98.08  C7	  C8	 98.08
TOP	    7    6	 98.08  C8	  C7	 98.08
BOT	    6    8	 98.08  C7	  C9	 98.08
TOP	    8    6	 98.08  C9	  C7	 98.08
BOT	    6    9	 97.12  C7	 C10	 97.12
TOP	    9    6	 97.12 C10	  C7	 97.12
BOT	    6   10	 97.12  C7	 C11	 97.12
TOP	   10    6	 97.12 C11	  C7	 97.12
BOT	    6   11	 97.12  C7	 C12	 97.12
TOP	   11    6	 97.12 C12	  C7	 97.12
BOT	    6   12	 97.12  C7	 C13	 97.12
TOP	   12    6	 97.12 C13	  C7	 97.12
BOT	    6   13	 97.12  C7	 C14	 97.12
TOP	   13    6	 97.12 C14	  C7	 97.12
BOT	    6   14	 97.12  C7	 C15	 97.12
TOP	   14    6	 97.12 C15	  C7	 97.12
BOT	    7    8	 98.08  C8	  C9	 98.08
TOP	    8    7	 98.08  C9	  C8	 98.08
BOT	    7    9	 95.19  C8	 C10	 95.19
TOP	    9    7	 95.19 C10	  C8	 95.19
BOT	    7   10	 95.19  C8	 C11	 95.19
TOP	   10    7	 95.19 C11	  C8	 95.19
BOT	    7   11	 95.19  C8	 C12	 95.19
TOP	   11    7	 95.19 C12	  C8	 95.19
BOT	    7   12	 95.19  C8	 C13	 95.19
TOP	   12    7	 95.19 C13	  C8	 95.19
BOT	    7   13	 95.19  C8	 C14	 95.19
TOP	   13    7	 95.19 C14	  C8	 95.19
BOT	    7   14	 95.19  C8	 C15	 95.19
TOP	   14    7	 95.19 C15	  C8	 95.19
BOT	    8    9	 95.19  C9	 C10	 95.19
TOP	    9    8	 95.19 C10	  C9	 95.19
BOT	    8   10	 95.19  C9	 C11	 95.19
TOP	   10    8	 95.19 C11	  C9	 95.19
BOT	    8   11	 95.19  C9	 C12	 95.19
TOP	   11    8	 95.19 C12	  C9	 95.19
BOT	    8   12	 95.19  C9	 C13	 95.19
TOP	   12    8	 95.19 C13	  C9	 95.19
BOT	    8   13	 95.19  C9	 C14	 95.19
TOP	   13    8	 95.19 C14	  C9	 95.19
BOT	    8   14	 95.19  C9	 C15	 95.19
TOP	   14    8	 95.19 C15	  C9	 95.19
BOT	    9   10	 98.08 C10	 C11	 98.08
TOP	   10    9	 98.08 C11	 C10	 98.08
BOT	    9   11	 98.08 C10	 C12	 98.08
TOP	   11    9	 98.08 C12	 C10	 98.08
BOT	    9   12	 98.08 C10	 C13	 98.08
TOP	   12    9	 98.08 C13	 C10	 98.08
BOT	    9   13	 98.08 C10	 C14	 98.08
TOP	   13    9	 98.08 C14	 C10	 98.08
BOT	    9   14	 98.08 C10	 C15	 98.08
TOP	   14    9	 98.08 C15	 C10	 98.08
BOT	   10   11	 98.08 C11	 C12	 98.08
TOP	   11   10	 98.08 C12	 C11	 98.08
BOT	   10   12	 98.08 C11	 C13	 98.08
TOP	   12   10	 98.08 C13	 C11	 98.08
BOT	   10   13	 98.08 C11	 C14	 98.08
TOP	   13   10	 98.08 C14	 C11	 98.08
BOT	   10   14	 98.08 C11	 C15	 98.08
TOP	   14   10	 98.08 C15	 C11	 98.08
BOT	   11   12	 98.08 C12	 C13	 98.08
TOP	   12   11	 98.08 C13	 C12	 98.08
BOT	   11   13	 98.08 C12	 C14	 98.08
TOP	   13   11	 98.08 C14	 C12	 98.08
BOT	   11   14	 98.08 C12	 C15	 98.08
TOP	   14   11	 98.08 C15	 C12	 98.08
BOT	   12   13	 98.08 C13	 C14	 98.08
TOP	   13   12	 98.08 C14	 C13	 98.08
BOT	   12   14	 98.08 C13	 C15	 98.08
TOP	   14   12	 98.08 C15	 C13	 98.08
BOT	   13   14	 98.08 C14	 C15	 98.08
TOP	   14   13	 98.08 C15	 C14	 98.08
AVG	 0	  C1	   *	 97.12
AVG	 1	  C2	   *	 92.86
AVG	 2	  C3	   *	 92.51
AVG	 3	  C4	   *	 96.02
AVG	 4	  C5	   *	 96.02
AVG	 5	  C6	   *	 96.77
AVG	 6	  C7	   *	 96.98
AVG	 7	  C8	   *	 95.88
AVG	 8	  C9	   *	 96.15
AVG	 9	 C10	   *	 96.22
AVG	 10	 C11	   *	 96.22
AVG	 11	 C12	   *	 96.22
AVG	 12	 C13	   *	 96.22
AVG	 13	 C14	   *	 96.22
AVG	 14	 C15	   *	 96.22
TOT	 TOT	   *	 95.84
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAAAAACCCTAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C2              ATGAAAAACCCCAAAGAAGAAATCCGGAGGATCCGGATTGTCAATATGCT
C3              ATGAAAAACCCCAAAGAAGAAATCCGGAGGATCCGGATTGTCAATATGCT
C4              ATGAAAAACCCAAAGAGGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C5              ATGAAAAACCCAAAGAAGAGATCCGGAGGATTCCGGATTGTCAATATGCT
C6              ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C7              ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C8              ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C9              ATGAAAAACCCAAAGAAGAAATCCGGAAGATTCCGGATTGTCAATATGCT
C10             ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C11             ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C12             ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C13             ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C14             ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
C15             ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
                *********** **......*: * *..*.:*******************

C1              AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C2              AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C3              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
C4              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
C5              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
C6              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
C7              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
C8              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGCTGC
C9              AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
C10             AGGACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C11             AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C12             AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C13             AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C14             AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
C15             AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
                *..******************.*.****** **.** ********* ***

C1              CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
C2              CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATA
C3              CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
C4              CAGCCGGACTTCTGCTGGGTCATGGACCCATTAGAATGGTTTTGGCGATA
C5              CGGCCGGACTTCTGCTGGGCCATGGACCCATCAGAATGGTTTTGGCGATA
C6              CGGCCGGACTCCTGCTGGGCCATGGACCCATCAGAATGGTTTTGGCGATA
C7              CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
C8              CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
C9              CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
C10             CAGCTGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
C11             CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
C12             CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
C13             CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
C14             CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
C15             CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCAATA
                *.** ***** ******** *****.***** **.***** *****.**:

C1              CTAGCCTTTTTGAGATTCACGGCTATCAAGCCATCACTGGGTCTCATCAA
C2              CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
C3              CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTTATCAA
C4              CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTCATCAA
C5              CTAGCCTTTTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
C6              CTAGCCTTCTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
C7              CTAGCCTTTTTGAGGTTCACGGCAATCAAGCCATCACTGGGCCTTATCAA
C8              TTAGCCTTTTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
C9              CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTTATCAA
C10             CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
C11             CTAGCCTTTTTGAGATTCATGGCAATCAAGCCATCACTGGGTCTCATCAA
C12             CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
C13             CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
C14             CTAGCCTTCTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
C15             CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
                 ******* *****.** * .**:***************** ** *****

C1              TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C2              TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C3              CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C4              TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAGATAATAAAGAAGT
C5              TAGATGGGGTTCCGTGGGGAAGAAGGAGGCTATGGAAATAATAAAAAAGT
C6              TAGATGGGGTTCCGTGGGGAAGAAGGAGGCTATGGAAATAATAAAAAAGT
C7              CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C8              CAGATGGGGTACCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAAAAAT
C9              CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C10             CAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C11             TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C12             TAGATGGGGTTCAGTGGGGAAAAAAGATGCTATGGAAATAATAAAGAAGT
C13             TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATGAAGAAGT
C14             TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
C15             TAGGTGGGGTTCTGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
                 **.******:* ********.**.** ********.*****.**.**.*

C1              TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C2              TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C3              TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAAGAG
C4              TTAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
C5              TCAAGAAAGACCTTGCTGCCATGTTGAGAATTATCAATGCTAGGAAGGAG
C6              TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
C7              TCAAGAAAGATCTTGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C8              TTAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
C9              TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAAGAG
C10             TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C11             TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C12             TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C13             TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
C14             TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTGGGAAGGAG
C15             TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
                * ******** ** ********* *******:*********.****.***

C1              AAGAAGAGACGA
C2              AAGAAGAGACGA
C3              AGGAAGAGACGT
C4              AGGAAGAGACGT
C5              AGGAAGAGACGT
C6              AGGAAGAGACGT
C7              AAGAAGAGACGA
C8              AGGAAGAGACGT
C9              AGGAAGAGACGT
C10             AAGAAGAGACGA
C11             AAGAAGAGACGA
C12             AAGAAGAGACGA
C13             AAGAAGAGACGA
C14             AAGAAGAGACGA
C15             AAGAAGAAACGA
                *.*****.***:



>C1
ATGAAAAACCCTAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCTATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C2
ATGAAAAACCCCAAAGAAGAAATCCGGAGGATCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATA
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C3
ATGAAAAACCCCAAAGAAGAAATCCGGAGGATCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTTATCAA
CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAAGAG
AGGAAGAGACGT
>C4
ATGAAAAACCCAAAGAGGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATTAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAGATAATAAAGAAGT
TTAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>C5
ATGAAAAACCCAAAGAAGAGATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
CGGCCGGACTTCTGCTGGGCCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
TAGATGGGGTTCCGTGGGGAAGAAGGAGGCTATGGAAATAATAAAAAAGT
TCAAGAAAGACCTTGCTGCCATGTTGAGAATTATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>C6
ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
CGGCCGGACTCCTGCTGGGCCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTCTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
TAGATGGGGTTCCGTGGGGAAGAAGGAGGCTATGGAAATAATAAAAAAGT
TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>C7
ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGGTTCACGGCAATCAAGCCATCACTGGGCCTTATCAA
CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTTGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C8
ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
TTAGCCTTTTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
CAGATGGGGTACCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAAAAAT
TTAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>C9
ATGAAAAACCCAAAGAAGAAATCCGGAAGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTTATCAA
CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAAGAG
AGGAAGAGACGT
>C10
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AGGACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCTGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
CAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C11
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCATGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C12
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGATGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C13
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATGAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>C14
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTCTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTGGGAAGGAG
AAGAAGAGACGA
>C15
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCAATA
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGGTGGGGTTCTGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAAACGA
>C1
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C2
MKNPKEEIRRIRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C3
MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C4
MKNPKRKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C5
MKNPKKRSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C6
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C7
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C8
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGTVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C9
MKNPKKKSGRFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>C10
MKNPKKKSGGFRIVNMLGRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C11
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFMAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C12
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKE
KKRR
>C13
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIMKKFKKDLAAMLRIINARKE
KKRR
>C14
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINAGKE
KKRR
>C15
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKKR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 15 taxa and 312 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Taxon 13 -> C13
      Taxon 14 -> C14
      Taxon 15 -> C15
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1509960957
      Setting output file names to "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 232376140
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5441657506
      Seed = 37173282
      Swapseed = 1509960957
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 14 unique site patterns
      Division 2 has 12 unique site patterns
      Division 3 has 40 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1687.048800 -- -26.563281
         Chain 2 -- -1771.116039 -- -26.563281
         Chain 3 -- -1733.630518 -- -26.563281
         Chain 4 -- -1762.552912 -- -26.563281

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1671.878155 -- -26.563281
         Chain 2 -- -1705.324835 -- -26.563281
         Chain 3 -- -1711.347869 -- -26.563281
         Chain 4 -- -1695.411131 -- -26.563281


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1687.049] (-1771.116) (-1733.631) (-1762.553) * [-1671.878] (-1705.325) (-1711.348) (-1695.411) 
        500 -- (-974.242) (-961.525) (-990.139) [-961.051] * (-959.007) (-987.207) (-983.530) [-967.747] -- 0:00:00
       1000 -- (-934.330) [-930.461] (-950.944) (-939.519) * (-946.908) (-951.292) (-966.341) [-949.285] -- 0:00:00
       1500 -- [-940.840] (-927.524) (-952.332) (-919.502) * (-951.580) (-952.603) (-958.556) [-941.206] -- 0:00:00
       2000 -- (-926.562) [-921.554] (-935.506) (-927.228) * (-930.958) (-938.830) (-945.835) [-931.873] -- 0:08:19
       2500 -- (-924.950) [-917.895] (-920.293) (-932.876) * (-934.085) (-932.533) [-925.557] (-932.419) -- 0:06:39
       3000 -- (-913.848) [-917.684] (-940.589) (-935.523) * (-932.725) (-923.344) [-920.743] (-927.100) -- 0:05:32
       3500 -- (-923.991) [-910.429] (-925.597) (-929.566) * (-951.359) (-917.360) [-924.215] (-919.022) -- 0:04:44
       4000 -- (-929.431) [-922.383] (-928.455) (-917.342) * (-931.948) (-910.774) (-915.982) [-923.755] -- 0:04:09
       4500 -- (-916.743) (-919.479) (-923.669) [-916.153] * (-930.161) [-906.875] (-916.759) (-917.329) -- 0:07:22
       5000 -- (-915.764) (-938.005) (-923.292) [-905.961] * (-925.092) (-920.486) [-912.533] (-917.375) -- 0:06:38

      Average standard deviation of split frequencies: 0.089185

       5500 -- (-911.295) (-942.467) (-917.779) [-913.166] * (-914.262) [-921.682] (-925.930) (-924.804) -- 0:06:01
       6000 -- [-910.790] (-916.653) (-930.801) (-928.116) * (-916.660) (-932.617) [-910.315] (-917.053) -- 0:05:31
       6500 -- (-922.178) (-924.584) [-905.228] (-935.098) * (-920.218) (-913.499) (-944.323) [-915.159] -- 0:05:05
       7000 -- (-911.709) [-921.834] (-920.813) (-925.792) * (-925.370) (-917.064) (-931.906) [-908.991] -- 0:04:43
       7500 -- (-917.022) [-917.523] (-914.814) (-928.013) * (-912.346) (-910.849) (-916.441) [-906.741] -- 0:06:37
       8000 -- (-929.031) [-914.704] (-915.437) (-920.351) * [-910.877] (-930.252) (-941.437) (-909.487) -- 0:06:12
       8500 -- (-926.643) (-914.267) [-912.502] (-916.899) * (-918.209) [-913.110] (-929.001) (-912.645) -- 0:05:49
       9000 -- (-925.107) (-918.628) [-911.429] (-911.000) * [-911.598] (-914.548) (-927.115) (-926.832) -- 0:05:30
       9500 -- (-935.561) [-913.948] (-923.042) (-914.487) * (-923.270) (-916.703) [-913.039] (-915.372) -- 0:05:12
      10000 -- (-929.310) [-928.255] (-912.143) (-913.550) * (-908.094) (-922.811) [-905.575] (-910.263) -- 0:04:57

      Average standard deviation of split frequencies: 0.091335

      10500 -- (-918.568) (-920.384) (-920.177) [-906.200] * [-906.029] (-920.080) (-921.308) (-923.061) -- 0:06:16
      11000 -- (-923.444) [-911.943] (-917.369) (-915.367) * (-915.932) (-920.702) [-921.533] (-908.404) -- 0:05:59
      11500 -- (-931.471) (-929.446) (-944.724) [-921.979] * [-908.395] (-907.968) (-921.674) (-913.381) -- 0:05:43
      12000 -- [-924.302] (-910.613) (-928.641) (-928.657) * (-912.874) (-919.866) [-912.222] (-921.603) -- 0:05:29
      12500 -- (-915.478) (-915.573) (-920.232) [-916.908] * [-904.413] (-910.329) (-913.110) (-928.980) -- 0:05:16
      13000 -- (-936.131) [-916.801] (-941.833) (-912.464) * [-909.798] (-910.872) (-918.747) (-911.623) -- 0:05:03
      13500 -- (-929.421) (-943.552) (-921.042) [-908.587] * (-902.018) (-933.170) [-912.058] (-923.501) -- 0:06:05
      14000 -- (-924.076) [-921.765] (-920.492) (-934.184) * [-917.015] (-928.990) (-920.149) (-920.779) -- 0:05:52
      14500 -- (-924.580) [-920.737] (-914.185) (-909.861) * (-912.151) (-918.172) [-907.664] (-915.242) -- 0:05:39
      15000 -- (-917.383) (-924.917) (-931.612) [-906.135] * (-918.975) (-929.412) [-907.201] (-918.423) -- 0:05:28

      Average standard deviation of split frequencies: 0.070383

      15500 -- (-929.438) (-919.083) (-936.638) [-909.232] * [-916.234] (-923.356) (-919.178) (-919.282) -- 0:05:17
      16000 -- (-931.706) (-916.054) (-926.248) [-916.415] * (-922.074) (-940.871) [-907.045] (-922.664) -- 0:05:07
      16500 -- (-930.827) (-907.968) (-913.591) [-909.007] * (-929.474) (-922.271) [-914.777] (-916.967) -- 0:05:57
      17000 -- (-916.663) [-912.390] (-929.512) (-918.265) * (-913.303) (-942.230) (-919.350) [-910.446] -- 0:05:46
      17500 -- (-922.869) [-914.408] (-958.963) (-921.648) * [-918.494] (-925.020) (-921.916) (-923.104) -- 0:05:36
      18000 -- (-921.629) [-906.421] (-933.606) (-924.484) * [-912.881] (-927.229) (-926.155) (-923.086) -- 0:05:27
      18500 -- [-923.239] (-919.564) (-923.768) (-923.550) * (-923.572) (-912.902) [-910.676] (-919.781) -- 0:05:18
      19000 -- [-908.600] (-912.663) (-921.429) (-923.779) * (-911.437) [-918.826] (-922.871) (-913.386) -- 0:05:09
      19500 -- (-922.358) (-919.618) (-923.113) [-912.682] * (-929.808) (-913.809) (-925.871) [-909.877] -- 0:05:01
      20000 -- [-912.555] (-915.446) (-907.695) (-913.831) * (-927.054) (-917.938) (-933.808) [-921.624] -- 0:05:43

      Average standard deviation of split frequencies: 0.059657

      20500 -- (-931.781) [-920.107] (-914.862) (-925.130) * (-908.902) (-913.054) (-921.677) [-921.557] -- 0:05:34
      21000 -- [-914.151] (-923.458) (-921.356) (-924.876) * (-912.128) [-914.284] (-921.592) (-931.244) -- 0:05:26
      21500 -- (-909.847) (-916.767) (-924.352) [-908.587] * [-914.666] (-924.717) (-926.233) (-919.057) -- 0:05:18
      22000 -- (-914.496) [-918.311] (-932.870) (-946.779) * (-911.448) (-932.953) [-917.524] (-928.904) -- 0:05:11
      22500 -- (-916.567) [-905.259] (-940.693) (-927.540) * (-920.810) (-918.224) (-916.936) [-912.558] -- 0:05:04
      23000 -- (-907.701) [-907.971] (-928.263) (-920.107) * (-910.015) (-921.589) [-919.593] (-916.188) -- 0:05:39
      23500 -- (-914.566) [-922.968] (-910.717) (-932.794) * (-907.283) (-917.133) [-915.262] (-921.106) -- 0:05:32
      24000 -- [-908.915] (-919.713) (-911.131) (-926.718) * [-910.114] (-911.782) (-907.050) (-933.270) -- 0:05:25
      24500 -- [-910.124] (-915.833) (-914.301) (-908.922) * (-907.676) [-913.156] (-917.507) (-918.160) -- 0:05:18
      25000 -- [-910.643] (-922.292) (-917.731) (-935.679) * (-913.025) (-917.657) (-920.239) [-924.842] -- 0:05:12

      Average standard deviation of split frequencies: 0.041595

      25500 -- (-910.630) [-919.217] (-918.685) (-921.865) * (-919.239) (-911.402) [-912.112] (-929.621) -- 0:05:05
      26000 -- (-908.293) (-919.086) [-907.319] (-917.818) * [-914.336] (-913.698) (-921.247) (-923.204) -- 0:05:37
      26500 -- (-913.872) (-930.217) [-907.802] (-913.088) * [-919.936] (-919.197) (-921.217) (-920.962) -- 0:05:30
      27000 -- [-916.032] (-923.917) (-908.653) (-923.493) * (-923.323) [-907.942] (-922.381) (-916.497) -- 0:05:24
      27500 -- (-926.451) [-916.936] (-913.959) (-935.205) * [-921.183] (-914.170) (-933.785) (-933.091) -- 0:05:18
      28000 -- (-914.338) (-920.306) [-909.239] (-928.513) * [-917.428] (-914.098) (-926.915) (-915.228) -- 0:05:12
      28500 -- (-938.008) (-931.577) [-926.657] (-918.796) * (-911.727) (-916.739) (-942.363) [-916.274] -- 0:05:40
      29000 -- (-923.215) (-925.862) [-904.109] (-923.225) * [-914.964] (-915.312) (-933.180) (-924.546) -- 0:05:34
      29500 -- (-925.767) (-923.569) [-914.151] (-914.010) * (-922.013) (-915.028) (-918.593) [-923.841] -- 0:05:28
      30000 -- (-928.086) (-929.054) (-914.513) [-908.664] * (-923.951) (-916.189) [-917.515] (-933.882) -- 0:05:23

      Average standard deviation of split frequencies: 0.044977

      30500 -- (-932.922) [-922.520] (-921.401) (-915.146) * [-916.098] (-921.822) (-918.234) (-928.327) -- 0:05:17
      31000 -- (-920.924) (-916.955) [-907.461] (-919.533) * [-911.506] (-913.645) (-919.215) (-923.765) -- 0:05:12
      31500 -- (-920.020) (-924.837) [-924.969] (-916.584) * (-922.259) (-915.316) (-919.951) [-910.701] -- 0:05:07
      32000 -- (-925.873) [-914.080] (-923.291) (-919.888) * (-917.435) (-928.916) (-924.301) [-908.344] -- 0:05:32
      32500 -- [-911.293] (-922.545) (-912.017) (-927.706) * (-923.358) (-914.804) [-916.322] (-923.464) -- 0:05:27
      33000 -- [-907.769] (-926.728) (-910.863) (-916.083) * [-927.803] (-917.497) (-919.132) (-932.608) -- 0:05:22
      33500 -- (-924.055) (-927.199) [-903.090] (-919.053) * (-932.772) (-920.613) (-921.578) [-908.072] -- 0:05:17
      34000 -- (-935.195) (-916.007) [-906.259] (-935.892) * (-927.718) [-904.953] (-919.608) (-932.193) -- 0:05:12
      34500 -- [-906.738] (-918.768) (-922.405) (-913.265) * [-915.502] (-917.480) (-909.896) (-919.065) -- 0:05:07
      35000 -- [-904.947] (-917.870) (-921.128) (-920.888) * (-931.369) [-923.041] (-915.631) (-918.071) -- 0:05:30

      Average standard deviation of split frequencies: 0.034046

      35500 -- (-921.348) (-935.405) [-910.931] (-923.843) * (-932.490) (-920.936) [-913.416] (-926.165) -- 0:05:26
      36000 -- (-916.828) (-924.024) [-906.114] (-913.968) * (-937.757) [-908.428] (-915.032) (-926.713) -- 0:05:21
      36500 -- (-917.477) (-911.094) (-931.251) [-915.994] * (-932.527) [-912.817] (-914.098) (-915.031) -- 0:05:16
      37000 -- (-917.392) (-909.407) (-921.748) [-915.560] * (-931.842) (-912.431) [-915.036] (-931.603) -- 0:05:12
      37500 -- (-916.935) (-909.455) [-910.038] (-921.706) * (-925.752) (-913.438) [-912.623] (-934.377) -- 0:05:08
      38000 -- (-915.573) (-923.578) (-915.389) [-913.004] * (-932.430) (-933.903) [-915.625] (-916.185) -- 0:05:29
      38500 -- (-914.658) (-917.229) [-913.753] (-917.193) * (-935.169) [-921.692] (-924.353) (-923.457) -- 0:05:24
      39000 -- (-916.719) (-916.273) (-922.244) [-906.633] * (-923.856) (-922.496) (-925.056) [-920.656] -- 0:05:20
      39500 -- [-910.911] (-935.031) (-943.140) (-914.921) * [-912.640] (-914.506) (-917.632) (-920.624) -- 0:05:16
      40000 -- (-927.300) (-917.040) [-922.166] (-907.469) * (-922.278) (-925.748) [-925.293] (-928.994) -- 0:05:12

      Average standard deviation of split frequencies: 0.038021

      40500 -- (-912.989) (-922.783) (-936.133) [-911.556] * (-925.558) (-917.737) [-924.785] (-926.871) -- 0:05:07
      41000 -- (-920.603) (-929.573) (-912.415) [-913.394] * [-922.597] (-928.589) (-930.565) (-909.426) -- 0:05:27
      41500 -- (-925.012) (-920.690) (-912.774) [-909.662] * (-920.868) (-921.849) (-915.167) [-910.460] -- 0:05:23
      42000 -- [-917.912] (-945.536) (-919.044) (-936.916) * (-931.564) [-908.717] (-926.056) (-916.908) -- 0:05:19
      42500 -- [-911.050] (-925.858) (-931.356) (-930.722) * (-938.970) (-912.696) (-921.639) [-916.594] -- 0:05:15
      43000 -- (-912.346) (-924.313) [-914.328] (-915.433) * (-923.389) [-916.762] (-921.166) (-917.071) -- 0:05:11
      43500 -- (-908.923) (-937.750) [-917.284] (-916.949) * [-914.855] (-924.626) (-919.371) (-919.583) -- 0:05:07
      44000 -- (-928.087) [-912.617] (-924.068) (-913.506) * [-917.935] (-909.924) (-916.717) (-920.344) -- 0:05:25
      44500 -- [-906.999] (-912.924) (-915.052) (-912.502) * (-926.044) (-922.579) (-927.761) [-915.077] -- 0:05:22
      45000 -- [-910.347] (-915.406) (-924.234) (-925.862) * (-919.723) (-917.604) [-913.282] (-918.733) -- 0:05:18

      Average standard deviation of split frequencies: 0.046292

      45500 -- [-912.136] (-934.105) (-939.428) (-933.947) * (-918.661) (-913.844) (-926.039) [-903.892] -- 0:05:14
      46000 -- (-919.740) (-913.851) (-920.218) [-913.852] * (-916.550) (-921.498) (-920.746) [-915.664] -- 0:05:11
      46500 -- (-917.278) (-921.680) (-911.556) [-916.819] * (-915.747) (-932.237) (-916.034) [-912.193] -- 0:05:07
      47000 -- (-926.329) (-921.347) [-908.332] (-918.917) * (-918.125) (-917.112) (-910.427) [-906.101] -- 0:05:24
      47500 -- (-914.226) (-919.667) [-904.120] (-909.810) * (-918.925) [-911.912] (-912.726) (-916.141) -- 0:05:20
      48000 -- (-928.593) (-922.112) [-914.861] (-903.566) * (-906.462) (-918.447) (-919.903) [-923.221] -- 0:05:17
      48500 -- (-916.085) (-919.543) (-920.703) [-908.197] * (-915.000) (-917.011) (-915.620) [-911.371] -- 0:05:13
      49000 -- (-926.931) (-928.068) [-916.429] (-920.154) * (-916.946) (-914.858) (-914.986) [-912.132] -- 0:05:10
      49500 -- (-933.649) (-913.593) [-911.687] (-923.420) * [-907.288] (-909.301) (-923.454) (-916.343) -- 0:05:07
      50000 -- [-918.341] (-922.315) (-926.051) (-916.320) * [-908.479] (-933.290) (-919.727) (-916.471) -- 0:05:23

      Average standard deviation of split frequencies: 0.043915

      50500 -- (-927.662) [-918.896] (-917.966) (-914.035) * (-915.689) (-916.777) (-914.923) [-915.420] -- 0:05:19
      51000 -- (-924.067) (-927.419) (-905.851) [-912.173] * (-910.239) [-914.255] (-928.524) (-913.876) -- 0:05:16
      51500 -- (-915.391) (-915.942) [-913.284] (-925.068) * (-920.048) (-912.116) (-918.799) [-915.623] -- 0:05:13
      52000 -- (-910.618) [-913.587] (-926.195) (-932.330) * (-932.451) (-922.581) (-918.790) [-910.248] -- 0:05:09
      52500 -- [-923.841] (-918.757) (-926.630) (-927.684) * (-927.824) (-907.633) [-910.403] (-915.490) -- 0:05:06
      53000 -- (-942.666) [-918.947] (-910.070) (-914.641) * (-918.316) [-909.338] (-927.119) (-915.794) -- 0:05:21
      53500 -- (-936.266) (-910.138) (-926.156) [-920.052] * (-919.038) (-907.536) (-912.602) [-902.482] -- 0:05:18
      54000 -- [-914.692] (-925.150) (-935.100) (-922.622) * (-926.326) (-925.256) [-913.029] (-908.107) -- 0:05:15
      54500 -- (-927.130) [-909.097] (-921.940) (-928.059) * [-915.410] (-914.932) (-914.072) (-923.955) -- 0:05:12
      55000 -- (-919.190) (-917.589) [-908.023] (-922.009) * (-927.509) [-912.383] (-925.171) (-920.204) -- 0:05:09

      Average standard deviation of split frequencies: 0.037580

      55500 -- (-917.022) (-914.886) [-912.154] (-917.661) * (-917.499) [-913.694] (-915.977) (-909.242) -- 0:05:06
      56000 -- (-919.732) (-915.423) (-925.917) [-912.072] * [-914.088] (-906.774) (-913.957) (-920.059) -- 0:05:20
      56500 -- [-912.814] (-920.724) (-922.001) (-939.444) * (-925.624) [-909.074] (-919.409) (-918.209) -- 0:05:17
      57000 -- [-907.268] (-915.569) (-939.215) (-914.662) * (-929.124) (-963.345) (-923.651) [-912.656] -- 0:05:14
      57500 -- (-914.257) [-920.486] (-921.383) (-912.231) * (-919.039) [-907.642] (-913.850) (-920.967) -- 0:05:11
      58000 -- (-922.746) (-925.404) [-904.650] (-916.857) * (-937.747) (-921.986) (-915.714) [-912.025] -- 0:05:08
      58500 -- [-910.795] (-925.757) (-903.782) (-913.980) * (-918.285) (-926.987) (-920.004) [-918.217] -- 0:05:05
      59000 -- (-912.582) [-927.713] (-916.683) (-937.275) * [-915.673] (-935.206) (-927.221) (-929.457) -- 0:05:18
      59500 -- [-921.932] (-923.165) (-922.815) (-941.373) * (-914.193) (-920.919) [-914.196] (-929.770) -- 0:05:16
      60000 -- (-937.158) [-914.421] (-921.787) (-927.994) * (-924.195) (-940.952) (-918.350) [-931.028] -- 0:05:13

      Average standard deviation of split frequencies: 0.042737

      60500 -- (-919.247) (-934.983) [-909.636] (-918.749) * (-921.326) (-929.162) (-914.574) [-914.194] -- 0:05:10
      61000 -- (-908.996) (-927.404) [-915.765] (-930.303) * [-906.388] (-932.362) (-922.588) (-913.269) -- 0:05:07
      61500 -- (-928.853) (-942.936) [-920.948] (-927.239) * (-913.249) [-914.419] (-943.722) (-917.415) -- 0:05:05
      62000 -- (-918.028) (-923.161) (-909.043) [-919.082] * (-915.251) [-911.539] (-926.510) (-926.282) -- 0:05:17
      62500 -- (-913.059) (-937.772) (-914.375) [-911.964] * (-924.511) [-911.540] (-925.551) (-912.343) -- 0:05:15
      63000 -- [-919.335] (-928.574) (-915.339) (-923.012) * [-912.858] (-911.356) (-933.024) (-925.082) -- 0:05:12
      63500 -- (-933.863) (-931.824) (-913.533) [-911.304] * (-930.839) [-919.308] (-920.158) (-946.537) -- 0:05:09
      64000 -- [-919.514] (-937.417) (-915.572) (-915.158) * (-913.526) (-918.533) [-917.435] (-932.642) -- 0:05:07
      64500 -- (-917.873) (-935.680) (-913.700) [-907.787] * (-914.728) (-910.066) [-909.519] (-933.918) -- 0:05:04
      65000 -- (-919.767) (-933.418) (-936.873) [-902.941] * (-936.576) [-915.699] (-922.593) (-931.976) -- 0:05:16

      Average standard deviation of split frequencies: 0.032906

      65500 -- (-914.619) (-926.595) [-914.912] (-911.281) * (-911.563) (-921.990) [-909.455] (-913.747) -- 0:05:13
      66000 -- (-922.351) (-937.985) (-912.124) [-916.755] * (-908.625) [-915.901] (-914.424) (-915.512) -- 0:05:11
      66500 -- [-921.372] (-926.247) (-917.337) (-915.956) * (-913.042) [-913.633] (-917.464) (-927.148) -- 0:05:08
      67000 -- (-930.748) (-935.654) [-910.837] (-938.375) * [-914.773] (-922.072) (-922.628) (-928.676) -- 0:05:06
      67500 -- (-935.631) [-920.358] (-921.516) (-922.543) * (-944.335) (-924.250) [-912.395] (-933.286) -- 0:05:03
      68000 -- (-924.785) (-934.753) (-929.059) [-911.215] * (-934.439) [-920.119] (-922.346) (-928.365) -- 0:05:15
      68500 -- [-913.659] (-927.908) (-924.611) (-917.702) * (-921.943) (-926.757) [-909.849] (-926.814) -- 0:05:12
      69000 -- (-915.556) (-919.947) (-919.307) [-914.706] * (-938.206) [-909.448] (-911.080) (-925.333) -- 0:05:10
      69500 -- (-930.837) (-926.868) [-919.704] (-918.521) * (-928.790) [-915.935] (-921.116) (-919.770) -- 0:05:07
      70000 -- (-912.213) (-925.968) (-927.280) [-909.244] * (-930.553) (-913.119) [-915.934] (-920.223) -- 0:05:05

      Average standard deviation of split frequencies: 0.031130

      70500 -- (-926.814) [-910.411] (-918.893) (-920.834) * (-916.656) (-919.303) (-939.937) [-921.644] -- 0:05:03
      71000 -- (-924.027) [-921.846] (-914.282) (-920.541) * (-921.160) (-909.433) [-918.512] (-930.548) -- 0:05:00
      71500 -- (-921.221) (-924.443) (-923.299) [-910.325] * (-923.814) (-916.189) (-931.890) [-922.174] -- 0:05:11
      72000 -- (-913.221) [-915.078] (-918.666) (-916.209) * (-920.916) (-922.773) [-914.029] (-931.640) -- 0:05:09
      72500 -- [-909.223] (-912.815) (-916.498) (-923.287) * (-928.736) (-917.935) [-920.774] (-932.412) -- 0:05:07
      73000 -- (-921.491) (-935.779) (-923.565) [-913.906] * (-929.598) (-920.103) [-920.998] (-923.969) -- 0:05:04
      73500 -- (-934.213) [-914.879] (-925.232) (-923.306) * (-917.475) (-921.259) (-918.852) [-912.613] -- 0:05:02
      74000 -- (-923.325) [-907.350] (-911.405) (-914.451) * (-926.487) (-923.023) [-919.697] (-927.303) -- 0:05:00
      74500 -- [-921.877] (-919.993) (-917.717) (-914.120) * (-910.229) (-920.319) (-920.619) [-919.921] -- 0:05:10
      75000 -- (-918.001) (-920.670) [-921.371] (-920.694) * (-918.134) (-937.241) [-913.791] (-929.715) -- 0:05:08

      Average standard deviation of split frequencies: 0.031703

      75500 -- (-927.262) (-921.842) [-910.504] (-928.318) * (-912.777) (-914.215) [-915.887] (-925.920) -- 0:05:06
      76000 -- (-933.906) [-906.361] (-923.558) (-920.626) * (-919.397) (-933.875) [-912.157] (-905.972) -- 0:05:03
      76500 -- [-922.201] (-915.748) (-915.256) (-914.138) * [-909.874] (-914.724) (-919.252) (-920.851) -- 0:05:01
      77000 -- (-921.651) [-910.819] (-918.394) (-919.015) * (-931.738) [-910.033] (-913.429) (-914.146) -- 0:04:59
      77500 -- (-918.727) [-908.809] (-916.492) (-917.449) * (-913.110) [-913.493] (-923.815) (-921.406) -- 0:05:09
      78000 -- (-932.111) (-921.002) (-905.012) [-913.960] * (-928.249) [-909.921] (-917.303) (-930.619) -- 0:05:07
      78500 -- (-942.502) (-902.827) [-915.604] (-923.413) * (-905.001) [-915.576] (-927.571) (-919.324) -- 0:05:05
      79000 -- (-929.350) [-908.149] (-910.463) (-925.528) * (-917.383) (-920.971) (-920.439) [-912.616] -- 0:05:03
      79500 -- [-908.797] (-916.741) (-921.047) (-918.435) * [-915.070] (-917.856) (-933.010) (-920.859) -- 0:05:01
      80000 -- (-918.924) (-908.738) (-925.306) [-910.875] * [-909.020] (-918.360) (-922.405) (-921.268) -- 0:04:59

      Average standard deviation of split frequencies: 0.028354

      80500 -- (-919.132) [-915.093] (-921.524) (-922.684) * (-926.003) (-915.682) [-907.462] (-920.451) -- 0:05:08
      81000 -- (-923.134) (-923.872) (-927.267) [-910.408] * [-923.655] (-915.611) (-940.360) (-928.265) -- 0:05:06
      81500 -- (-922.846) (-914.845) (-926.317) [-925.425] * (-919.111) (-928.507) (-918.752) [-913.372] -- 0:05:04
      82000 -- (-919.501) [-918.630] (-916.902) (-926.205) * (-942.836) (-943.673) [-928.482] (-928.745) -- 0:05:02
      82500 -- (-943.477) (-917.784) (-915.522) [-911.890] * (-928.360) (-925.643) [-915.287] (-918.932) -- 0:05:00
      83000 -- (-931.170) (-918.762) [-916.373] (-917.995) * (-912.631) [-924.063] (-929.472) (-923.876) -- 0:04:58
      83500 -- (-921.824) (-913.458) (-925.955) [-904.757] * [-911.232] (-914.245) (-917.497) (-921.063) -- 0:05:07
      84000 -- [-915.395] (-930.689) (-920.854) (-918.894) * (-923.160) [-918.153] (-937.618) (-922.252) -- 0:05:05
      84500 -- (-912.366) (-923.993) (-934.403) [-911.528] * (-909.008) (-914.362) [-914.992] (-921.608) -- 0:05:03
      85000 -- [-909.741] (-917.027) (-922.900) (-909.058) * (-932.011) (-917.110) (-920.905) [-924.845] -- 0:05:01

      Average standard deviation of split frequencies: 0.025397

      85500 -- (-952.328) (-920.743) (-923.011) [-923.746] * (-920.420) (-922.641) (-926.953) [-919.273] -- 0:04:59
      86000 -- (-925.192) [-913.028] (-916.525) (-904.978) * (-916.396) (-915.827) (-931.517) [-911.557] -- 0:04:57
      86500 -- (-931.776) (-951.340) (-918.095) [-916.842] * (-922.979) (-929.178) (-938.032) [-916.966] -- 0:04:55
      87000 -- (-929.269) (-930.679) [-915.914] (-918.827) * (-928.988) (-908.881) (-927.182) [-918.231] -- 0:05:04
      87500 -- (-914.687) (-918.896) [-914.179] (-922.268) * (-919.625) (-916.794) [-913.740] (-926.617) -- 0:05:02
      88000 -- (-914.509) (-932.937) (-908.873) [-913.209] * (-925.293) (-918.187) (-921.563) [-916.741] -- 0:05:00
      88500 -- (-925.521) (-924.057) [-913.216] (-925.489) * [-908.909] (-920.525) (-917.630) (-911.587) -- 0:04:58
      89000 -- (-909.157) (-940.296) [-912.095] (-910.723) * (-931.990) (-927.560) [-905.082] (-918.077) -- 0:04:56
      89500 -- (-907.907) (-923.676) (-921.510) [-908.477] * (-929.839) (-929.470) (-920.073) [-917.028] -- 0:04:55
      90000 -- [-913.038] (-927.121) (-910.395) (-912.919) * (-928.124) [-906.478] (-910.140) (-915.272) -- 0:05:03

      Average standard deviation of split frequencies: 0.027431

      90500 -- (-926.827) (-916.056) [-919.246] (-921.374) * (-921.566) (-922.435) [-911.450] (-912.606) -- 0:05:01
      91000 -- (-929.340) [-913.220] (-904.840) (-928.165) * (-917.330) (-931.323) (-936.940) [-909.701] -- 0:04:59
      91500 -- (-917.703) (-920.837) [-907.891] (-924.356) * [-913.604] (-919.578) (-919.638) (-930.533) -- 0:04:57
      92000 -- (-917.153) (-928.179) (-913.981) [-919.538] * (-917.399) (-915.652) (-919.531) [-907.843] -- 0:04:56
      92500 -- [-912.994] (-923.876) (-915.981) (-918.122) * [-909.851] (-925.477) (-919.955) (-917.227) -- 0:05:04
      93000 -- (-910.827) [-917.649] (-919.165) (-917.610) * (-925.278) (-915.836) (-932.455) [-912.239] -- 0:05:02
      93500 -- [-909.471] (-922.237) (-919.842) (-927.584) * (-911.304) [-913.565] (-921.243) (-916.385) -- 0:05:00
      94000 -- (-915.339) (-925.222) (-928.728) [-910.001] * (-921.907) [-915.107] (-924.315) (-914.817) -- 0:04:58
      94500 -- (-915.432) (-923.586) (-923.899) [-911.706] * (-914.899) [-919.939] (-950.693) (-917.681) -- 0:04:57
      95000 -- [-918.876] (-920.787) (-916.894) (-920.164) * (-919.939) (-911.084) (-919.998) [-909.008] -- 0:04:55

      Average standard deviation of split frequencies: 0.024026

      95500 -- (-937.504) (-911.772) (-919.178) [-917.713] * (-931.869) (-905.484) (-919.145) [-922.007] -- 0:04:53
      96000 -- (-934.981) [-907.977] (-920.167) (-911.590) * [-912.738] (-923.314) (-908.866) (-918.024) -- 0:05:01
      96500 -- (-915.267) (-923.926) [-919.365] (-920.309) * (-916.345) (-917.578) [-911.584] (-932.092) -- 0:04:59
      97000 -- (-909.858) [-914.138] (-919.315) (-918.938) * [-919.024] (-930.817) (-921.751) (-924.988) -- 0:04:57
      97500 -- (-927.651) (-917.518) (-927.400) [-914.458] * (-928.452) [-912.805] (-924.265) (-916.572) -- 0:04:56
      98000 -- (-926.805) [-911.289] (-923.044) (-927.408) * [-921.278] (-915.886) (-933.261) (-926.741) -- 0:04:54
      98500 -- (-934.991) [-909.365] (-924.038) (-920.345) * (-916.428) [-914.427] (-940.180) (-924.032) -- 0:04:52
      99000 -- (-923.588) [-908.182] (-920.188) (-914.209) * [-919.930] (-916.870) (-940.064) (-930.290) -- 0:05:00
      99500 -- (-910.368) (-919.142) (-914.492) [-914.394] * (-927.636) [-919.480] (-911.202) (-921.445) -- 0:04:58
      100000 -- [-909.300] (-924.879) (-911.744) (-908.339) * (-936.354) (-911.783) [-914.179] (-909.816) -- 0:04:57

      Average standard deviation of split frequencies: 0.025035

      100500 -- [-914.694] (-916.289) (-918.564) (-926.859) * (-931.646) (-901.237) [-926.840] (-926.106) -- 0:04:55
      101000 -- (-915.513) [-910.986] (-933.898) (-926.716) * (-929.184) [-910.560] (-925.789) (-922.344) -- 0:04:53
      101500 -- (-923.599) [-904.553] (-911.820) (-923.477) * [-914.113] (-915.842) (-930.500) (-919.790) -- 0:04:52
      102000 -- [-911.215] (-915.887) (-906.580) (-930.323) * (-920.974) (-923.728) (-932.980) [-915.037] -- 0:04:59
      102500 -- (-911.230) (-910.313) (-922.916) [-906.228] * [-928.882] (-907.356) (-927.222) (-917.761) -- 0:04:57
      103000 -- [-910.163] (-917.970) (-924.864) (-925.240) * [-913.725] (-921.631) (-948.390) (-913.776) -- 0:04:56
      103500 -- (-912.267) [-912.785] (-924.291) (-930.106) * [-918.823] (-919.581) (-917.126) (-914.007) -- 0:04:54
      104000 -- (-926.606) [-911.228] (-925.158) (-930.183) * (-916.216) (-913.693) (-925.283) [-912.169] -- 0:04:52
      104500 -- (-912.692) (-924.963) [-911.477] (-917.665) * [-918.900] (-923.316) (-922.581) (-908.816) -- 0:04:51
      105000 -- (-920.395) (-911.713) (-923.184) [-902.720] * (-916.328) (-934.182) [-912.938] (-930.328) -- 0:04:58

      Average standard deviation of split frequencies: 0.024460

      105500 -- (-921.777) [-914.814] (-921.831) (-926.848) * (-912.593) (-933.952) (-918.057) [-907.140] -- 0:04:56
      106000 -- (-918.233) (-925.249) (-926.823) [-910.915] * [-913.203] (-940.923) (-925.883) (-924.753) -- 0:04:55
      106500 -- [-914.888] (-921.051) (-936.845) (-912.904) * (-917.988) (-931.583) [-916.523] (-916.813) -- 0:04:53
      107000 -- [-916.723] (-921.135) (-928.244) (-916.042) * (-922.770) (-933.543) (-917.156) [-920.632] -- 0:04:52
      107500 -- (-919.524) (-922.984) [-912.841] (-912.598) * [-909.045] (-927.616) (-922.923) (-922.138) -- 0:04:50
      108000 -- (-921.240) (-912.483) [-906.309] (-912.961) * (-931.727) (-929.547) (-923.689) [-911.541] -- 0:04:57
      108500 -- (-934.991) (-921.836) [-916.177] (-921.226) * (-920.027) (-944.203) [-905.516] (-918.755) -- 0:04:55
      109000 -- [-914.124] (-930.936) (-923.006) (-914.320) * (-924.865) (-928.393) (-911.198) [-915.104] -- 0:04:54
      109500 -- (-920.210) (-927.650) (-919.687) [-910.156] * (-940.483) (-913.999) [-919.080] (-929.086) -- 0:04:52
      110000 -- (-917.695) (-926.927) (-930.349) [-911.644] * (-924.715) (-917.539) [-903.240] (-912.494) -- 0:04:51

      Average standard deviation of split frequencies: 0.023980

      110500 -- (-924.947) [-930.731] (-922.030) (-922.725) * (-927.151) (-935.730) [-913.739] (-902.345) -- 0:04:49
      111000 -- (-916.748) (-944.756) [-911.039] (-913.147) * (-910.566) (-923.802) (-919.300) [-911.466] -- 0:04:56
      111500 -- (-909.037) (-927.362) [-916.180] (-926.579) * [-908.781] (-932.159) (-912.617) (-909.837) -- 0:04:54
      112000 -- (-918.762) (-925.279) (-923.134) [-916.594] * [-907.070] (-927.892) (-916.780) (-923.668) -- 0:04:53
      112500 -- (-909.965) (-947.602) [-903.781] (-920.648) * [-925.418] (-938.828) (-924.038) (-911.081) -- 0:04:51
      113000 -- (-909.062) (-940.646) [-912.902] (-926.351) * (-926.886) (-950.900) (-914.056) [-916.829] -- 0:04:50
      113500 -- [-911.351] (-921.039) (-940.767) (-918.842) * (-908.444) (-921.586) [-916.280] (-920.163) -- 0:04:48
      114000 -- (-918.111) (-930.282) (-925.986) [-919.370] * (-920.033) [-920.766] (-922.281) (-935.255) -- 0:04:55
      114500 -- [-910.677] (-932.682) (-921.783) (-913.230) * (-919.096) (-911.685) [-909.585] (-920.033) -- 0:04:53
      115000 -- (-924.755) [-915.841] (-922.776) (-918.112) * [-912.296] (-930.092) (-916.698) (-915.222) -- 0:04:52

      Average standard deviation of split frequencies: 0.022426

      115500 -- [-909.765] (-915.160) (-914.951) (-920.774) * (-915.745) (-918.167) (-934.337) [-908.321] -- 0:04:51
      116000 -- (-925.453) [-918.556] (-918.871) (-918.021) * (-924.498) (-918.575) (-933.346) [-904.523] -- 0:04:49
      116500 -- [-908.079] (-915.182) (-923.332) (-923.192) * [-920.418] (-913.476) (-909.422) (-929.944) -- 0:04:48
      117000 -- (-915.219) [-908.103] (-927.575) (-924.766) * (-911.401) [-916.181] (-912.600) (-917.760) -- 0:04:54
      117500 -- (-926.767) (-909.157) (-923.373) [-912.336] * (-917.516) (-912.239) [-910.210] (-927.650) -- 0:04:52
      118000 -- (-929.652) [-910.475] (-925.177) (-913.540) * (-919.190) (-912.460) [-907.881] (-928.414) -- 0:04:51
      118500 -- [-914.884] (-913.097) (-923.959) (-920.963) * (-929.786) (-920.973) [-907.340] (-920.809) -- 0:04:50
      119000 -- (-914.405) (-933.470) (-920.845) [-924.342] * [-911.916] (-922.346) (-917.472) (-931.019) -- 0:04:48
      119500 -- (-915.010) [-925.493] (-933.168) (-927.256) * (-920.565) [-911.640] (-929.307) (-923.733) -- 0:04:47
      120000 -- [-916.909] (-925.914) (-928.813) (-918.078) * [-915.982] (-915.165) (-908.930) (-919.308) -- 0:04:46

      Average standard deviation of split frequencies: 0.021096

      120500 -- (-917.093) (-919.204) (-931.850) [-911.567] * (-911.543) [-914.371] (-933.801) (-925.667) -- 0:04:51
      121000 -- [-912.982] (-915.330) (-941.913) (-920.289) * (-915.379) (-916.888) [-911.896] (-925.374) -- 0:04:50
      121500 -- (-925.019) (-913.357) (-930.805) [-907.183] * [-911.889] (-924.692) (-933.276) (-921.968) -- 0:04:49
      122000 -- (-932.425) (-914.098) [-923.832] (-928.706) * (-923.074) (-916.216) [-912.808] (-914.487) -- 0:04:47
      122500 -- [-912.052] (-914.596) (-927.085) (-927.204) * [-909.852] (-923.253) (-923.222) (-919.517) -- 0:04:46
      123000 -- (-916.123) (-921.695) (-922.799) [-908.636] * [-910.451] (-942.110) (-913.534) (-908.194) -- 0:04:52
      123500 -- (-935.104) (-918.823) (-919.623) [-911.730] * (-911.728) [-916.672] (-917.372) (-914.975) -- 0:04:50
      124000 -- [-922.478] (-921.210) (-923.336) (-920.846) * [-910.617] (-910.056) (-923.519) (-919.544) -- 0:04:49
      124500 -- [-913.149] (-914.175) (-934.909) (-921.611) * [-914.839] (-930.021) (-924.473) (-923.645) -- 0:04:48
      125000 -- (-918.088) (-925.117) (-923.762) [-914.984] * (-922.746) (-915.585) [-924.348] (-933.779) -- 0:04:47

      Average standard deviation of split frequencies: 0.018407

      125500 -- (-916.280) (-911.057) [-910.214] (-932.463) * (-925.282) (-904.248) (-934.936) [-916.387] -- 0:04:45
      126000 -- (-932.588) [-918.109] (-914.236) (-919.595) * [-912.411] (-913.999) (-931.495) (-951.817) -- 0:04:44
      126500 -- (-916.236) (-915.544) (-926.408) [-915.190] * [-916.309] (-923.314) (-922.155) (-928.604) -- 0:04:50
      127000 -- (-915.939) (-906.093) (-928.040) [-911.916] * (-918.652) (-913.481) [-914.988] (-920.849) -- 0:04:48
      127500 -- [-913.813] (-914.443) (-929.188) (-931.324) * [-909.373] (-917.584) (-922.001) (-923.348) -- 0:04:47
      128000 -- (-917.553) [-919.342] (-930.885) (-912.921) * (-912.057) (-910.208) (-919.231) [-908.410] -- 0:04:46
      128500 -- (-923.935) [-906.629] (-926.943) (-923.774) * [-913.435] (-906.496) (-920.488) (-931.161) -- 0:04:44
      129000 -- [-912.820] (-916.624) (-940.832) (-916.317) * (-926.778) (-928.252) [-913.808] (-926.986) -- 0:04:43
      129500 -- [-917.951] (-917.199) (-925.590) (-918.070) * (-920.896) (-931.225) (-913.308) [-917.497] -- 0:04:49
      130000 -- (-916.727) [-905.547] (-927.476) (-907.768) * (-923.208) (-939.739) [-911.508] (-914.786) -- 0:04:47

      Average standard deviation of split frequencies: 0.018593

      130500 -- [-909.132] (-908.283) (-928.354) (-934.333) * (-924.892) (-915.826) [-920.153] (-909.588) -- 0:04:46
      131000 -- (-931.161) (-922.534) [-915.005] (-918.819) * (-922.602) [-924.166] (-922.405) (-935.861) -- 0:04:45
      131500 -- [-917.502] (-926.953) (-920.958) (-914.519) * (-921.821) (-935.381) (-920.500) [-917.554] -- 0:04:43
      132000 -- [-909.325] (-922.934) (-912.956) (-919.072) * (-911.088) (-928.430) (-920.323) [-917.583] -- 0:04:42
      132500 -- (-909.483) [-917.342] (-929.981) (-919.264) * (-919.844) [-914.897] (-932.098) (-917.185) -- 0:04:48
      133000 -- (-910.463) (-919.568) (-924.898) [-913.353] * (-915.121) (-910.926) [-923.594] (-919.527) -- 0:04:46
      133500 -- (-917.036) [-909.784] (-915.837) (-915.634) * [-911.232] (-922.326) (-917.052) (-923.848) -- 0:04:45
      134000 -- (-921.056) [-908.639] (-920.189) (-917.658) * (-908.738) (-918.495) (-928.046) [-913.961] -- 0:04:44
      134500 -- (-916.799) (-922.890) (-912.336) [-912.371] * [-917.645] (-924.681) (-924.050) (-925.178) -- 0:04:43
      135000 -- [-907.746] (-916.287) (-935.248) (-917.702) * [-905.221] (-916.608) (-915.205) (-925.453) -- 0:04:41

      Average standard deviation of split frequencies: 0.017198

      135500 -- (-916.077) [-909.438] (-920.578) (-915.510) * (-921.429) (-928.195) [-906.548] (-929.097) -- 0:04:47
      136000 -- [-912.095] (-926.893) (-915.359) (-926.982) * (-920.799) [-913.930] (-928.933) (-921.311) -- 0:04:45
      136500 -- [-917.390] (-911.637) (-921.983) (-926.538) * (-915.575) (-916.217) [-912.711] (-913.280) -- 0:04:44
      137000 -- (-915.475) [-914.980] (-918.437) (-915.766) * (-926.263) (-908.761) (-919.182) [-911.125] -- 0:04:43
      137500 -- (-917.374) [-914.455] (-916.837) (-927.200) * (-931.959) (-927.017) [-903.839] (-911.299) -- 0:04:42
      138000 -- (-919.373) [-909.395] (-916.019) (-924.004) * (-918.989) (-918.533) [-909.515] (-908.102) -- 0:04:41
      138500 -- (-911.811) [-899.703] (-919.211) (-917.331) * [-921.991] (-923.405) (-913.752) (-918.880) -- 0:04:46
      139000 -- (-911.050) (-909.770) (-927.416) [-912.738] * (-927.546) (-909.477) [-915.450] (-926.473) -- 0:04:44
      139500 -- (-916.845) [-913.331] (-916.112) (-915.431) * (-928.535) (-912.142) (-914.082) [-918.594] -- 0:04:43
      140000 -- (-910.581) [-911.607] (-919.262) (-944.402) * (-927.323) (-899.538) (-932.540) [-908.293] -- 0:04:42

      Average standard deviation of split frequencies: 0.017014

      140500 -- (-922.412) (-916.607) [-910.735] (-960.622) * (-910.351) (-917.034) [-906.307] (-935.369) -- 0:04:41
      141000 -- (-917.527) (-924.668) [-914.068] (-928.243) * (-925.767) [-908.346] (-913.097) (-925.494) -- 0:04:40
      141500 -- (-910.272) (-914.371) [-912.810] (-938.346) * (-923.342) [-907.110] (-917.921) (-909.070) -- 0:04:45
      142000 -- (-920.544) (-930.359) [-915.131] (-926.418) * (-915.181) [-916.914] (-917.477) (-921.459) -- 0:04:43
      142500 -- [-916.860] (-912.665) (-935.292) (-923.016) * (-918.458) [-914.060] (-938.238) (-921.480) -- 0:04:42
      143000 -- [-923.648] (-910.549) (-937.618) (-918.136) * [-907.054] (-910.480) (-925.606) (-940.508) -- 0:04:41
      143500 -- [-923.495] (-918.209) (-930.577) (-913.957) * (-908.328) [-906.761] (-932.392) (-919.335) -- 0:04:40
      144000 -- (-915.131) [-913.945] (-922.491) (-910.775) * (-922.052) (-915.736) [-930.840] (-924.113) -- 0:04:39
      144500 -- (-923.692) [-907.300] (-924.709) (-914.031) * (-919.029) [-912.325] (-927.375) (-920.894) -- 0:04:44
      145000 -- (-926.458) [-920.383] (-910.456) (-917.599) * [-919.905] (-920.761) (-922.930) (-923.568) -- 0:04:43

      Average standard deviation of split frequencies: 0.017262

      145500 -- (-923.250) [-918.775] (-918.965) (-915.335) * [-915.343] (-911.892) (-934.897) (-930.506) -- 0:04:41
      146000 -- (-937.353) (-912.039) (-915.273) [-916.860] * [-917.531] (-922.406) (-921.188) (-921.583) -- 0:04:40
      146500 -- (-933.439) [-922.902] (-913.931) (-929.174) * [-923.354] (-908.212) (-913.117) (-919.999) -- 0:04:39
      147000 -- (-940.038) (-918.499) (-913.551) [-919.237] * [-913.356] (-927.698) (-928.688) (-930.745) -- 0:04:38
      147500 -- (-928.240) (-919.819) [-911.486] (-925.971) * (-910.007) [-906.315] (-928.344) (-927.816) -- 0:04:37
      148000 -- (-929.320) [-917.915] (-917.354) (-917.447) * [-913.424] (-918.983) (-944.738) (-917.128) -- 0:04:42
      148500 -- (-930.749) (-923.377) [-907.077] (-915.375) * (-913.626) [-916.546] (-910.599) (-915.542) -- 0:04:40
      149000 -- (-914.629) [-907.365] (-908.710) (-921.390) * [-925.042] (-911.442) (-935.103) (-936.238) -- 0:04:39
      149500 -- (-931.422) (-908.769) (-929.675) [-905.398] * (-922.082) (-918.770) (-926.556) [-909.609] -- 0:04:38
      150000 -- (-923.125) [-906.704] (-918.919) (-915.252) * (-915.566) (-919.911) (-925.369) [-920.714] -- 0:04:37

      Average standard deviation of split frequencies: 0.018051

      150500 -- (-926.927) (-924.211) [-919.005] (-923.501) * (-933.560) (-910.859) [-920.652] (-931.501) -- 0:04:36
      151000 -- [-926.017] (-912.519) (-925.599) (-908.470) * (-927.129) [-911.965] (-916.251) (-924.099) -- 0:04:41
      151500 -- (-931.010) [-913.377] (-916.385) (-916.451) * [-916.930] (-912.566) (-915.859) (-925.396) -- 0:04:40
      152000 -- (-923.072) (-911.105) (-913.656) [-908.788] * (-920.096) (-919.835) (-927.904) [-914.563] -- 0:04:38
      152500 -- [-919.275] (-915.210) (-920.780) (-923.209) * (-919.303) (-913.759) [-916.293] (-914.961) -- 0:04:37
      153000 -- (-914.812) (-913.547) (-915.417) [-911.814] * (-916.136) [-914.357] (-917.724) (-913.319) -- 0:04:36
      153500 -- (-918.682) (-908.011) [-903.271] (-922.642) * (-908.912) [-922.187] (-919.311) (-923.190) -- 0:04:35
      154000 -- [-907.398] (-907.912) (-920.604) (-914.775) * (-912.174) (-933.507) [-924.464] (-934.950) -- 0:04:40
      154500 -- (-921.016) [-901.171] (-919.868) (-925.051) * [-915.517] (-915.335) (-924.060) (-949.579) -- 0:04:39
      155000 -- (-925.282) (-918.590) (-922.473) [-923.040] * [-912.963] (-932.520) (-920.751) (-924.309) -- 0:04:38

      Average standard deviation of split frequencies: 0.017434

      155500 -- (-922.391) (-930.002) (-919.668) [-914.695] * (-922.512) [-910.190] (-922.202) (-933.922) -- 0:04:36
      156000 -- [-915.636] (-915.737) (-917.083) (-924.705) * [-911.257] (-910.836) (-914.545) (-934.546) -- 0:04:35
      156500 -- (-913.907) (-902.092) (-940.390) [-921.165] * (-913.447) (-922.013) [-925.922] (-945.362) -- 0:04:34
      157000 -- (-921.387) [-910.055] (-946.252) (-915.532) * [-904.048] (-918.316) (-917.209) (-935.259) -- 0:04:39
      157500 -- [-906.051] (-915.924) (-945.635) (-927.627) * (-906.773) (-920.621) [-910.680] (-931.661) -- 0:04:38
      158000 -- [-905.877] (-907.438) (-931.356) (-922.549) * (-914.332) (-929.726) [-912.256] (-932.041) -- 0:04:37
      158500 -- [-910.336] (-914.589) (-940.132) (-918.839) * (-911.525) (-928.957) (-922.146) [-915.329] -- 0:04:36
      159000 -- [-913.589] (-916.191) (-929.305) (-922.788) * (-929.428) (-908.231) [-926.611] (-924.627) -- 0:04:35
      159500 -- (-916.175) (-932.186) [-926.472] (-927.011) * (-919.485) (-913.828) [-908.357] (-931.173) -- 0:04:34
      160000 -- [-910.380] (-912.950) (-921.552) (-922.427) * [-909.533] (-912.844) (-917.027) (-928.706) -- 0:04:38

      Average standard deviation of split frequencies: 0.019748

      160500 -- [-918.056] (-915.231) (-923.340) (-912.551) * (-909.792) (-920.796) (-923.424) [-918.662] -- 0:04:37
      161000 -- (-915.495) (-914.097) [-910.790] (-913.025) * [-919.975] (-927.323) (-927.350) (-926.267) -- 0:04:36
      161500 -- [-916.891] (-914.663) (-927.698) (-924.737) * (-917.721) (-927.190) (-915.353) [-913.976] -- 0:04:35
      162000 -- (-915.185) (-917.301) (-920.082) [-907.304] * (-910.205) (-928.543) (-924.748) [-912.794] -- 0:04:34
      162500 -- (-917.755) (-916.748) (-931.069) [-912.194] * [-906.213] (-935.086) (-921.213) (-922.623) -- 0:04:33
      163000 -- (-927.160) (-916.046) (-913.595) [-908.218] * (-927.891) (-919.014) (-920.010) [-914.166] -- 0:04:37
      163500 -- (-929.844) (-913.399) [-919.020] (-918.169) * [-919.187] (-916.459) (-913.439) (-923.478) -- 0:04:36
      164000 -- (-918.444) (-925.199) [-910.626] (-922.424) * (-923.784) (-923.644) [-918.484] (-922.028) -- 0:04:35
      164500 -- (-917.751) [-907.040] (-917.852) (-926.782) * (-933.019) (-912.930) (-914.602) [-914.919] -- 0:04:34
      165000 -- (-920.971) (-916.590) [-918.146] (-920.007) * (-912.835) (-911.446) (-922.292) [-917.987] -- 0:04:33

      Average standard deviation of split frequencies: 0.023046

      165500 -- (-935.401) [-911.224] (-915.364) (-924.819) * [-920.076] (-909.055) (-928.502) (-920.263) -- 0:04:32
      166000 -- [-908.016] (-933.300) (-918.745) (-918.879) * (-929.751) (-937.133) [-903.038] (-910.418) -- 0:04:31
      166500 -- (-918.842) (-922.075) [-913.104] (-923.582) * (-928.459) (-922.004) (-919.279) [-916.403] -- 0:04:35
      167000 -- (-937.527) [-902.418] (-919.772) (-920.096) * (-913.442) (-913.814) [-911.095] (-919.664) -- 0:04:34
      167500 -- [-915.968] (-913.644) (-917.880) (-914.790) * (-919.706) (-919.573) [-910.076] (-927.546) -- 0:04:33
      168000 -- (-927.450) (-922.237) (-912.405) [-906.597] * [-912.203] (-923.390) (-915.248) (-916.383) -- 0:04:32
      168500 -- (-924.805) (-929.985) (-915.055) [-909.056] * (-912.203) (-922.902) (-915.137) [-918.188] -- 0:04:31
      169000 -- (-932.521) (-942.386) (-908.155) [-918.057] * (-923.523) (-923.260) [-914.689] (-922.699) -- 0:04:30
      169500 -- (-921.592) (-930.591) [-911.443] (-928.949) * (-915.498) (-926.902) [-915.651] (-912.158) -- 0:04:34
      170000 -- (-920.288) (-906.642) [-913.509] (-929.751) * (-908.606) [-907.154] (-903.831) (-917.670) -- 0:04:33

      Average standard deviation of split frequencies: 0.022203

      170500 -- [-909.044] (-923.355) (-919.348) (-919.447) * (-919.582) [-914.946] (-915.053) (-912.270) -- 0:04:32
      171000 -- [-907.422] (-921.527) (-915.633) (-923.748) * (-914.015) (-920.881) [-911.333] (-930.425) -- 0:04:31
      171500 -- [-914.566] (-923.487) (-926.120) (-913.555) * (-906.852) (-922.334) [-916.570] (-921.452) -- 0:04:30
      172000 -- (-929.953) (-932.353) (-920.637) [-916.977] * (-912.725) [-910.358] (-922.860) (-918.919) -- 0:04:29
      172500 -- (-929.963) [-912.927] (-905.857) (-936.151) * (-913.132) (-914.928) (-914.501) [-915.162] -- 0:04:33
      173000 -- (-918.386) [-911.332] (-932.294) (-919.411) * (-918.762) [-911.416] (-919.665) (-925.660) -- 0:04:32
      173500 -- [-913.204] (-921.267) (-944.482) (-908.329) * [-911.917] (-919.929) (-924.818) (-929.855) -- 0:04:31
      174000 -- (-905.265) [-899.321] (-927.398) (-931.533) * (-916.346) [-912.695] (-918.101) (-924.639) -- 0:04:30
      174500 -- [-931.716] (-922.094) (-927.761) (-922.509) * (-940.839) (-914.513) [-917.682] (-911.887) -- 0:04:29
      175000 -- (-939.166) [-910.938] (-913.350) (-911.185) * (-923.131) [-907.934] (-931.253) (-915.020) -- 0:04:28

      Average standard deviation of split frequencies: 0.020397

      175500 -- (-928.390) (-914.446) (-911.556) [-915.169] * (-921.304) (-912.194) [-915.721] (-930.593) -- 0:04:27
      176000 -- (-929.428) (-924.900) [-921.505] (-927.482) * (-910.077) (-924.004) [-911.854] (-928.261) -- 0:04:31
      176500 -- (-940.381) (-918.614) (-924.990) [-920.614] * [-915.319] (-915.764) (-917.999) (-937.039) -- 0:04:30
      177000 -- (-929.521) (-922.796) (-921.330) [-911.072] * (-918.942) (-934.175) [-902.484] (-926.798) -- 0:04:29
      177500 -- (-933.026) (-915.939) [-904.842] (-915.679) * [-914.282] (-936.323) (-916.224) (-927.426) -- 0:04:28
      178000 -- (-951.138) [-909.621] (-920.042) (-922.109) * (-910.800) (-925.423) (-916.176) [-918.416] -- 0:04:27
      178500 -- (-946.700) (-918.815) (-923.883) [-914.318] * (-918.130) (-932.305) [-914.553] (-922.662) -- 0:04:26
      179000 -- [-920.347] (-930.375) (-909.867) (-925.924) * (-913.504) (-920.401) [-907.864] (-928.308) -- 0:04:30
      179500 -- (-919.578) (-926.825) [-910.281] (-924.103) * (-911.738) [-909.680] (-920.232) (-925.476) -- 0:04:29
      180000 -- (-925.998) (-922.378) [-922.783] (-929.544) * (-923.817) (-916.372) [-913.089] (-931.238) -- 0:04:28

      Average standard deviation of split frequencies: 0.021083

      180500 -- (-925.893) [-912.251] (-914.930) (-925.610) * [-908.978] (-912.411) (-910.767) (-928.675) -- 0:04:27
      181000 -- (-919.824) (-910.843) [-917.299] (-935.155) * (-930.053) (-917.581) [-912.751] (-935.213) -- 0:04:26
      181500 -- (-917.004) [-913.908] (-910.835) (-928.860) * (-923.537) (-919.987) [-914.550] (-914.994) -- 0:04:26
      182000 -- (-918.641) (-929.817) [-916.293] (-942.001) * (-920.073) (-928.771) (-913.553) [-917.290] -- 0:04:29
      182500 -- [-926.683] (-915.779) (-914.901) (-927.812) * (-913.660) (-915.530) [-907.098] (-939.306) -- 0:04:28
      183000 -- (-917.367) [-904.872] (-918.191) (-935.913) * (-912.992) [-907.614] (-922.191) (-930.995) -- 0:04:27
      183500 -- (-911.765) [-912.567] (-927.797) (-928.059) * [-907.377] (-912.568) (-908.348) (-926.918) -- 0:04:26
      184000 -- (-910.652) [-902.739] (-911.456) (-923.243) * (-929.596) (-908.050) (-925.167) [-909.746] -- 0:04:26
      184500 -- (-911.064) (-914.195) (-910.843) [-911.313] * (-915.900) [-915.144] (-922.892) (-918.350) -- 0:04:25
      185000 -- (-927.963) (-924.362) [-920.849] (-930.551) * [-917.636] (-926.930) (-927.761) (-910.087) -- 0:04:28

      Average standard deviation of split frequencies: 0.021086

      185500 -- [-912.445] (-922.520) (-923.081) (-939.848) * [-912.553] (-923.524) (-922.961) (-918.291) -- 0:04:27
      186000 -- (-911.463) [-916.323] (-930.441) (-921.881) * (-913.602) (-919.788) (-906.889) [-910.345] -- 0:04:26
      186500 -- (-918.210) (-910.631) [-913.693] (-921.741) * [-920.102] (-927.205) (-914.354) (-912.873) -- 0:04:26
      187000 -- (-902.809) (-937.700) [-924.408] (-941.531) * (-925.351) (-933.529) [-912.119] (-916.743) -- 0:04:25
      187500 -- (-911.458) [-912.200] (-919.925) (-930.168) * (-924.563) (-927.585) (-927.099) [-918.705] -- 0:04:28
      188000 -- (-919.820) (-921.311) (-924.539) [-914.629] * (-925.313) (-941.710) [-919.371] (-914.675) -- 0:04:27
      188500 -- [-915.675] (-920.125) (-915.137) (-923.824) * (-927.435) (-920.858) [-917.308] (-919.429) -- 0:04:26
      189000 -- (-918.637) (-927.834) [-916.685] (-916.160) * [-933.537] (-919.962) (-913.204) (-912.413) -- 0:04:26
      189500 -- (-918.860) (-910.942) (-925.633) [-915.431] * [-910.025] (-930.321) (-907.380) (-917.449) -- 0:04:25
      190000 -- [-914.873] (-913.048) (-924.298) (-926.912) * [-909.355] (-916.873) (-919.907) (-913.974) -- 0:04:24

      Average standard deviation of split frequencies: 0.021658

      190500 -- (-912.346) [-915.024] (-917.592) (-917.807) * [-912.546] (-925.194) (-912.407) (-916.161) -- 0:04:27
      191000 -- [-921.256] (-906.524) (-916.058) (-928.032) * (-920.959) (-913.310) (-918.491) [-918.273] -- 0:04:26
      191500 -- (-916.564) (-914.529) (-922.476) [-915.716] * (-919.970) (-915.259) [-910.747] (-921.274) -- 0:04:25
      192000 -- (-911.848) [-913.823] (-924.588) (-923.070) * [-922.822] (-910.834) (-907.720) (-926.213) -- 0:04:25
      192500 -- (-913.028) (-939.331) [-917.449] (-919.677) * (-916.776) [-914.087] (-919.719) (-920.789) -- 0:04:24
      193000 -- (-922.336) (-921.347) (-916.415) [-908.869] * (-921.378) (-907.047) [-913.551] (-937.196) -- 0:04:23
      193500 -- (-928.365) (-924.849) [-908.565] (-916.316) * [-924.397] (-924.109) (-918.079) (-923.342) -- 0:04:26
      194000 -- (-912.534) (-937.890) (-921.053) [-926.708] * [-913.570] (-919.606) (-924.965) (-932.244) -- 0:04:25
      194500 -- [-925.228] (-923.000) (-927.290) (-913.283) * (-922.011) (-913.591) [-923.225] (-913.407) -- 0:04:25
      195000 -- (-917.858) (-932.438) (-917.332) [-904.310] * (-917.921) (-921.085) (-930.218) [-916.639] -- 0:04:24

      Average standard deviation of split frequencies: 0.020143

      195500 -- (-921.244) (-919.295) [-912.053] (-930.730) * [-919.544] (-909.204) (-933.135) (-904.184) -- 0:04:23
      196000 -- (-942.542) (-924.123) (-916.298) [-914.905] * (-918.128) (-928.126) (-912.367) [-920.188] -- 0:04:22
      196500 -- (-928.960) (-919.482) [-916.971] (-922.038) * [-919.492] (-932.162) (-917.250) (-911.973) -- 0:04:21
      197000 -- [-919.419] (-922.657) (-922.877) (-913.319) * (-928.406) [-908.353] (-910.576) (-914.947) -- 0:04:24
      197500 -- (-919.667) [-910.409] (-924.254) (-917.883) * [-909.927] (-924.336) (-920.742) (-919.159) -- 0:04:24
      198000 -- (-919.255) [-918.831] (-915.727) (-933.598) * (-922.156) [-921.951] (-917.893) (-923.170) -- 0:04:23
      198500 -- (-931.973) [-916.221] (-927.105) (-920.674) * (-918.432) (-911.088) [-922.433] (-915.428) -- 0:04:22
      199000 -- (-923.247) (-919.891) [-912.608] (-925.656) * (-920.133) (-915.276) (-938.697) [-918.904] -- 0:04:21
      199500 -- (-922.061) (-928.544) [-913.216] (-924.584) * (-918.045) (-915.632) (-918.205) [-918.740] -- 0:04:20
      200000 -- (-907.940) (-917.437) (-926.518) [-914.960] * (-908.931) (-926.164) [-920.670] (-929.239) -- 0:04:24

      Average standard deviation of split frequencies: 0.017619

      200500 -- (-915.942) [-913.495] (-911.061) (-921.747) * [-916.682] (-928.930) (-912.594) (-923.206) -- 0:04:23
      201000 -- (-910.921) (-916.280) (-916.390) [-915.695] * (-922.239) (-934.659) (-911.428) [-925.036] -- 0:04:22
      201500 -- (-919.214) (-925.018) (-913.607) [-911.781] * (-929.485) (-916.932) (-916.016) [-921.851] -- 0:04:21
      202000 -- (-911.319) (-923.485) [-907.062] (-910.703) * (-913.874) [-922.002] (-916.836) (-915.730) -- 0:04:20
      202500 -- (-917.436) [-909.542] (-914.048) (-913.577) * [-912.498] (-923.450) (-929.971) (-909.294) -- 0:04:19
      203000 -- [-908.833] (-915.066) (-921.839) (-931.992) * [-922.491] (-924.343) (-914.711) (-922.104) -- 0:04:23
      203500 -- (-925.627) [-906.114] (-930.004) (-925.432) * (-934.953) (-920.010) (-933.647) [-914.352] -- 0:04:22
      204000 -- [-920.021] (-918.311) (-914.923) (-913.228) * [-916.194] (-926.785) (-932.156) (-918.467) -- 0:04:21
      204500 -- (-926.386) (-915.630) [-922.719] (-919.107) * [-919.630] (-930.166) (-922.621) (-916.333) -- 0:04:20
      205000 -- (-918.349) [-915.700] (-916.101) (-909.334) * (-925.945) (-916.351) (-929.030) [-907.612] -- 0:04:19

      Average standard deviation of split frequencies: 0.017849

      205500 -- [-927.408] (-913.913) (-924.427) (-918.833) * (-928.296) (-915.543) (-930.383) [-908.550] -- 0:04:19
      206000 -- (-918.658) [-915.353] (-912.793) (-929.975) * (-922.189) (-913.170) (-925.100) [-912.665] -- 0:04:22
      206500 -- (-913.719) (-916.091) [-906.781] (-929.127) * (-917.940) (-914.786) (-913.046) [-903.186] -- 0:04:21
      207000 -- (-915.574) (-918.722) (-927.589) [-920.977] * (-921.379) (-924.014) (-913.375) [-909.296] -- 0:04:20
      207500 -- [-914.971] (-928.128) (-916.663) (-911.184) * (-925.464) (-927.459) [-921.631] (-916.282) -- 0:04:19
      208000 -- (-911.651) (-912.931) [-922.115] (-931.294) * (-919.051) (-934.383) [-913.082] (-913.617) -- 0:04:18
      208500 -- (-923.556) [-918.287] (-917.186) (-942.500) * (-924.119) (-926.386) (-920.370) [-909.621] -- 0:04:18
      209000 -- [-907.794] (-912.751) (-908.587) (-917.914) * (-919.130) [-917.853] (-914.441) (-910.087) -- 0:04:21
      209500 -- (-922.594) (-920.733) [-919.849] (-916.810) * (-908.127) (-911.730) [-919.652] (-924.823) -- 0:04:20
      210000 -- (-922.995) (-932.606) (-910.440) [-909.381] * (-926.547) (-912.360) [-910.641] (-927.942) -- 0:04:19

      Average standard deviation of split frequencies: 0.019513

      210500 -- (-916.587) (-928.174) (-918.259) [-914.170] * (-916.740) [-914.918] (-913.771) (-915.718) -- 0:04:18
      211000 -- (-921.451) (-909.909) [-910.503] (-919.001) * (-913.890) (-909.620) [-920.638] (-925.362) -- 0:04:18
      211500 -- (-909.923) (-927.981) (-917.788) [-924.481] * (-922.028) (-923.559) [-919.220] (-912.517) -- 0:04:17
      212000 -- (-914.096) (-915.912) (-917.764) [-916.001] * (-934.096) (-928.502) (-908.800) [-922.433] -- 0:04:16
      212500 -- [-915.990] (-928.950) (-916.354) (-914.560) * (-932.014) [-922.925] (-920.189) (-922.953) -- 0:04:19
      213000 -- [-914.766] (-919.026) (-928.078) (-923.257) * (-924.946) [-909.969] (-920.142) (-937.636) -- 0:04:18
      213500 -- [-907.702] (-911.791) (-936.697) (-909.707) * (-929.788) [-922.694] (-943.581) (-913.770) -- 0:04:17
      214000 -- [-914.175] (-931.693) (-933.492) (-915.208) * (-929.093) (-932.251) (-916.162) [-909.812] -- 0:04:17
      214500 -- [-910.895] (-929.215) (-933.550) (-922.355) * [-912.449] (-928.654) (-926.470) (-920.346) -- 0:04:16
      215000 -- (-911.707) (-931.923) [-912.349] (-924.535) * [-912.449] (-921.002) (-924.717) (-917.315) -- 0:04:15

      Average standard deviation of split frequencies: 0.020824

      215500 -- (-917.705) [-906.010] (-929.174) (-924.776) * (-924.053) [-917.790] (-920.630) (-915.566) -- 0:04:18
      216000 -- (-915.402) [-910.704] (-925.880) (-909.943) * (-911.447) (-909.946) (-922.594) [-914.439] -- 0:04:17
      216500 -- [-916.738] (-906.659) (-926.730) (-912.590) * (-927.178) (-914.205) (-924.481) [-906.373] -- 0:04:16
      217000 -- (-914.708) (-917.753) (-911.961) [-913.602] * (-921.590) (-911.379) (-930.100) [-913.668] -- 0:04:16
      217500 -- (-929.809) [-912.114] (-920.595) (-918.237) * (-911.866) (-925.051) [-916.923] (-912.046) -- 0:04:15
      218000 -- (-947.507) (-916.616) [-908.497] (-924.056) * [-915.100] (-921.171) (-920.180) (-912.162) -- 0:04:14
      218500 -- [-913.694] (-924.546) (-931.631) (-916.682) * (-913.853) (-928.586) [-917.572] (-911.092) -- 0:04:17
      219000 -- [-914.843] (-908.986) (-928.912) (-914.390) * [-917.312] (-945.041) (-933.916) (-918.484) -- 0:04:16
      219500 -- (-923.287) (-925.907) (-928.045) [-915.772] * (-931.207) (-930.851) (-919.054) [-916.758] -- 0:04:16
      220000 -- [-918.499] (-925.795) (-914.529) (-922.322) * (-934.417) (-924.531) [-923.994] (-915.964) -- 0:04:15

      Average standard deviation of split frequencies: 0.021270

      220500 -- [-924.759] (-916.801) (-924.746) (-910.260) * [-916.820] (-927.667) (-930.992) (-934.928) -- 0:04:14
      221000 -- (-929.640) (-925.951) (-918.326) [-902.991] * (-925.404) [-915.808] (-930.354) (-932.761) -- 0:04:13
      221500 -- (-926.714) (-916.959) [-909.935] (-917.204) * (-930.789) [-917.632] (-923.751) (-911.664) -- 0:04:16
      222000 -- (-934.162) (-928.192) (-912.940) [-913.462] * (-926.088) (-920.791) [-911.077] (-915.822) -- 0:04:15
      222500 -- [-914.639] (-911.921) (-916.549) (-925.815) * (-921.328) (-919.157) (-924.739) [-905.081] -- 0:04:15
      223000 -- (-921.926) (-908.729) (-918.391) [-907.866] * (-932.267) (-927.593) [-921.418] (-908.548) -- 0:04:14
      223500 -- (-915.201) (-905.008) (-914.749) [-907.536] * [-922.227] (-914.247) (-932.816) (-907.732) -- 0:04:13
      224000 -- (-944.011) [-904.784] (-919.513) (-915.603) * (-913.878) (-905.757) [-909.382] (-919.690) -- 0:04:12
      224500 -- (-922.590) (-908.720) (-933.398) [-913.175] * [-906.023] (-917.423) (-933.752) (-920.238) -- 0:04:15
      225000 -- (-924.915) [-909.677] (-921.734) (-909.101) * [-906.557] (-922.638) (-911.720) (-936.916) -- 0:04:14

      Average standard deviation of split frequencies: 0.020163

      225500 -- (-927.445) [-905.724] (-920.606) (-913.436) * (-912.433) (-914.790) [-908.184] (-950.262) -- 0:04:14
      226000 -- (-921.391) (-928.893) [-919.477] (-910.416) * (-921.741) (-914.030) [-912.989] (-915.960) -- 0:04:13
      226500 -- [-916.777] (-918.880) (-926.218) (-925.697) * (-911.559) (-930.952) [-906.839] (-921.484) -- 0:04:12
      227000 -- (-916.443) [-907.920] (-920.106) (-926.811) * (-932.844) (-918.101) [-915.093] (-904.954) -- 0:04:11
      227500 -- (-916.354) [-906.678] (-930.571) (-915.931) * (-920.986) [-908.589] (-918.969) (-931.143) -- 0:04:14
      228000 -- (-919.206) [-909.561] (-932.431) (-916.163) * [-933.592] (-919.318) (-912.136) (-914.469) -- 0:04:13
      228500 -- (-924.011) (-910.882) [-905.166] (-914.416) * (-937.031) [-918.794] (-923.377) (-934.849) -- 0:04:13
      229000 -- (-908.615) (-916.267) [-917.076] (-919.449) * (-936.371) (-938.810) (-918.873) [-920.741] -- 0:04:12
      229500 -- [-912.917] (-925.941) (-925.922) (-924.148) * (-941.293) (-919.619) [-908.478] (-924.155) -- 0:04:11
      230000 -- (-908.679) [-911.332] (-921.613) (-921.154) * (-945.699) [-921.395] (-932.520) (-926.058) -- 0:04:11

      Average standard deviation of split frequencies: 0.021033

      230500 -- (-917.218) (-929.383) (-917.634) [-922.266] * (-934.068) (-911.547) (-922.376) [-919.502] -- 0:04:10
      231000 -- [-913.875] (-919.764) (-917.872) (-920.311) * (-928.392) (-919.955) (-914.226) [-918.633] -- 0:04:13
      231500 -- (-925.923) (-918.714) [-916.843] (-923.859) * (-926.617) (-931.309) (-919.211) [-911.074] -- 0:04:12
      232000 -- (-930.508) (-913.078) (-931.423) [-923.095] * (-926.119) (-924.549) [-928.442] (-934.716) -- 0:04:11
      232500 -- (-927.600) [-912.299] (-923.184) (-916.838) * (-940.301) [-916.353] (-910.840) (-925.860) -- 0:04:10
      233000 -- (-912.833) [-908.035] (-932.962) (-923.657) * (-934.348) (-917.126) (-925.896) [-909.985] -- 0:04:10
      233500 -- [-908.782] (-910.402) (-930.260) (-916.203) * (-937.061) [-916.843] (-916.759) (-916.833) -- 0:04:12
      234000 -- (-922.078) (-920.801) (-914.585) [-919.947] * (-932.109) [-914.060] (-918.098) (-922.374) -- 0:04:12
      234500 -- (-912.656) (-930.101) [-913.563] (-921.335) * (-945.089) (-914.948) [-907.240] (-917.015) -- 0:04:11
      235000 -- (-907.685) (-923.355) [-913.735] (-924.958) * (-945.413) [-915.414] (-914.611) (-918.353) -- 0:04:10

      Average standard deviation of split frequencies: 0.018057

      235500 -- [-915.851] (-919.980) (-914.249) (-923.677) * (-921.362) (-915.187) (-931.280) [-917.292] -- 0:04:09
      236000 -- (-913.222) (-933.539) (-923.000) [-911.008] * [-919.680] (-927.551) (-921.179) (-929.963) -- 0:04:09
      236500 -- (-920.245) (-914.915) [-912.783] (-902.205) * (-929.078) (-921.522) (-931.039) [-910.846] -- 0:04:11
      237000 -- (-928.954) (-913.980) [-927.479] (-915.680) * (-931.435) (-914.945) (-919.276) [-908.545] -- 0:04:11
      237500 -- (-935.292) [-916.914] (-922.674) (-921.105) * (-941.339) (-928.213) [-912.996] (-922.284) -- 0:04:10
      238000 -- (-925.023) (-929.744) [-923.168] (-918.280) * (-920.673) (-913.911) [-911.222] (-904.874) -- 0:04:09
      238500 -- (-940.908) [-915.150] (-921.167) (-912.099) * [-905.115] (-917.748) (-919.866) (-914.163) -- 0:04:09
      239000 -- (-913.841) (-924.369) [-917.681] (-915.130) * [-913.881] (-913.702) (-923.149) (-918.410) -- 0:04:08
      239500 -- (-930.938) (-930.384) (-919.880) [-918.514] * (-910.695) (-922.268) [-908.803] (-916.708) -- 0:04:10
      240000 -- [-907.682] (-922.357) (-932.033) (-915.928) * [-913.314] (-922.231) (-919.629) (-920.695) -- 0:04:10

      Average standard deviation of split frequencies: 0.017629

      240500 -- (-915.156) [-921.052] (-918.080) (-918.896) * (-926.815) [-917.876] (-918.313) (-925.822) -- 0:04:09
      241000 -- (-918.715) (-919.775) (-918.150) [-913.843] * (-920.011) [-917.275] (-930.932) (-916.228) -- 0:04:08
      241500 -- [-917.162] (-913.857) (-920.731) (-918.692) * (-927.804) [-914.918] (-923.852) (-915.573) -- 0:04:08
      242000 -- (-911.242) [-913.670] (-919.027) (-914.596) * (-912.179) [-917.009] (-917.005) (-924.192) -- 0:04:07
      242500 -- [-915.685] (-924.259) (-914.539) (-926.290) * [-912.415] (-919.517) (-931.590) (-922.020) -- 0:04:06
      243000 -- (-908.485) (-919.747) (-916.145) [-914.188] * (-925.171) (-910.978) (-918.736) [-914.926] -- 0:04:09
      243500 -- (-920.944) (-909.948) (-928.263) [-910.558] * (-922.948) (-920.839) [-911.032] (-915.403) -- 0:04:08
      244000 -- (-914.498) (-910.380) (-924.587) [-908.241] * (-923.589) [-911.053] (-909.654) (-925.612) -- 0:04:07
      244500 -- [-910.883] (-915.753) (-927.610) (-925.754) * (-916.271) (-916.983) [-910.604] (-923.923) -- 0:04:07
      245000 -- (-915.602) [-914.783] (-926.434) (-918.344) * (-916.568) [-911.108] (-911.106) (-930.892) -- 0:04:06

      Average standard deviation of split frequencies: 0.018856

      245500 -- (-914.776) (-922.756) (-917.996) [-904.504] * (-913.956) [-909.941] (-931.638) (-920.973) -- 0:04:05
      246000 -- (-915.608) (-926.054) [-915.558] (-913.287) * (-919.273) [-914.938] (-921.632) (-933.262) -- 0:04:08
      246500 -- (-914.374) (-924.449) [-911.276] (-928.615) * (-936.054) (-916.768) (-927.373) [-910.558] -- 0:04:07
      247000 -- [-914.033] (-939.954) (-913.833) (-924.528) * (-911.668) (-912.378) (-926.390) [-905.848] -- 0:04:06
      247500 -- [-929.795] (-916.879) (-919.091) (-921.808) * (-914.830) (-919.355) [-911.613] (-929.950) -- 0:04:06
      248000 -- [-911.574] (-927.970) (-926.642) (-922.789) * (-920.513) (-908.394) [-921.307] (-932.981) -- 0:04:05
      248500 -- (-906.790) [-912.586] (-928.360) (-922.080) * (-913.681) (-913.391) [-911.154] (-928.641) -- 0:04:04
      249000 -- [-916.082] (-922.818) (-937.121) (-928.433) * (-921.954) [-918.245] (-925.853) (-919.285) -- 0:04:07
      249500 -- (-925.126) [-920.348] (-918.058) (-928.913) * (-921.507) (-926.350) [-903.561] (-916.979) -- 0:04:06
      250000 -- (-920.756) (-920.865) (-928.964) [-903.201] * (-918.001) (-923.925) (-914.413) [-916.572] -- 0:04:06

      Average standard deviation of split frequencies: 0.019107

      250500 -- [-916.677] (-922.169) (-932.068) (-919.500) * (-923.280) (-925.583) [-913.260] (-921.143) -- 0:04:05
      251000 -- (-935.794) (-912.223) [-933.239] (-937.444) * [-906.985] (-915.269) (-927.265) (-913.311) -- 0:04:04
      251500 -- (-935.709) (-920.847) (-914.135) [-908.583] * [-905.080] (-930.651) (-915.855) (-931.337) -- 0:04:04
      252000 -- (-932.326) (-909.076) (-926.790) [-917.809] * (-911.426) (-918.730) [-911.067] (-923.093) -- 0:04:06
      252500 -- (-912.137) [-906.396] (-927.324) (-932.321) * (-928.358) [-903.651] (-913.645) (-916.064) -- 0:04:05
      253000 -- [-910.232] (-917.157) (-921.119) (-939.023) * (-922.475) (-924.226) (-912.813) [-914.542] -- 0:04:05
      253500 -- (-924.608) [-915.021] (-917.927) (-925.366) * (-920.888) (-927.145) (-917.812) [-911.274] -- 0:04:04
      254000 -- (-927.206) (-928.502) (-927.333) [-918.627] * [-915.631] (-939.185) (-916.626) (-928.215) -- 0:04:03
      254500 -- (-914.989) [-917.848] (-911.648) (-925.505) * (-907.188) (-934.197) (-916.225) [-910.969] -- 0:04:03
      255000 -- (-918.698) [-914.274] (-927.246) (-922.140) * (-932.246) (-929.019) (-916.086) [-907.686] -- 0:04:02

      Average standard deviation of split frequencies: 0.017236

      255500 -- (-918.971) (-932.188) (-919.832) [-901.855] * (-922.214) (-920.160) [-910.300] (-913.254) -- 0:04:04
      256000 -- (-912.928) [-921.939] (-919.129) (-916.188) * (-920.446) (-928.450) (-906.567) [-911.933] -- 0:04:04
      256500 -- [-913.161] (-917.006) (-927.756) (-920.901) * [-916.609] (-924.035) (-910.885) (-914.751) -- 0:04:03
      257000 -- [-911.368] (-919.378) (-932.938) (-930.429) * (-928.037) (-917.198) [-915.056] (-923.995) -- 0:04:02
      257500 -- [-916.332] (-938.973) (-923.980) (-919.854) * (-922.071) (-915.937) [-909.407] (-924.233) -- 0:04:02
      258000 -- (-911.888) (-930.308) [-912.186] (-908.928) * [-909.313] (-912.131) (-912.168) (-913.717) -- 0:04:01
      258500 -- (-916.623) (-922.665) (-927.202) [-906.662] * (-920.272) (-909.254) (-927.523) [-911.949] -- 0:04:03
      259000 -- (-924.071) [-909.638] (-927.797) (-906.697) * (-932.440) [-907.624] (-921.403) (-928.532) -- 0:04:03
      259500 -- (-915.820) (-925.593) (-935.797) [-927.489] * [-918.894] (-920.660) (-909.210) (-928.257) -- 0:04:02
      260000 -- (-921.775) [-919.241] (-917.382) (-931.020) * [-911.513] (-929.011) (-914.002) (-923.201) -- 0:04:01

      Average standard deviation of split frequencies: 0.015865

      260500 -- (-933.156) (-916.912) (-926.975) [-909.002] * [-913.749] (-916.814) (-912.991) (-914.144) -- 0:04:01
      261000 -- (-912.746) (-916.499) [-921.104] (-928.248) * (-917.227) [-907.623] (-932.551) (-927.144) -- 0:04:00
      261500 -- [-910.087] (-930.524) (-923.055) (-919.169) * (-926.504) (-924.978) [-923.949] (-912.900) -- 0:04:02
      262000 -- [-905.643] (-918.266) (-917.582) (-916.011) * (-920.888) (-917.304) (-927.501) [-908.979] -- 0:04:02
      262500 -- (-922.863) (-912.516) (-937.236) [-915.469] * (-910.517) (-917.243) (-922.971) [-919.437] -- 0:04:01
      263000 -- (-910.630) [-912.548] (-930.081) (-917.755) * (-909.623) (-907.055) [-917.782] (-916.261) -- 0:04:00
      263500 -- (-910.301) [-905.639] (-914.684) (-926.815) * (-916.426) (-918.206) [-915.425] (-926.454) -- 0:04:00
      264000 -- [-913.392] (-910.307) (-931.938) (-914.919) * [-916.598] (-920.011) (-923.734) (-928.483) -- 0:03:59
      264500 -- (-938.219) [-908.714] (-918.015) (-924.093) * [-918.958] (-918.628) (-921.835) (-931.447) -- 0:04:01
      265000 -- [-912.351] (-901.847) (-920.631) (-918.086) * (-920.169) (-913.085) [-908.214] (-919.699) -- 0:04:01

      Average standard deviation of split frequencies: 0.014916

      265500 -- (-914.872) (-914.784) [-922.053] (-916.933) * (-920.772) (-923.254) [-910.708] (-920.795) -- 0:04:00
      266000 -- [-921.781] (-918.113) (-932.194) (-912.606) * [-915.898] (-916.556) (-926.583) (-929.111) -- 0:04:00
      266500 -- (-921.842) (-933.562) (-919.037) [-913.615] * [-918.646] (-918.390) (-908.840) (-927.806) -- 0:03:59
      267000 -- [-910.844] (-914.277) (-927.326) (-919.282) * (-909.071) (-915.375) [-908.662] (-932.413) -- 0:03:58
      267500 -- (-919.162) (-917.032) (-938.261) [-920.388] * (-914.714) (-910.349) [-921.669] (-921.536) -- 0:04:00
      268000 -- [-916.326] (-940.944) (-920.365) (-913.487) * (-913.461) [-908.272] (-910.301) (-936.074) -- 0:04:00
      268500 -- (-915.602) (-935.689) (-924.126) [-912.838] * (-918.452) [-909.773] (-918.426) (-929.890) -- 0:03:59
      269000 -- (-921.659) [-915.188] (-926.447) (-915.767) * (-917.978) (-917.307) [-908.973] (-953.509) -- 0:03:59
      269500 -- (-916.463) [-927.984] (-920.548) (-916.674) * (-917.308) [-915.591] (-913.934) (-936.446) -- 0:03:58
      270000 -- (-919.583) [-910.063] (-919.483) (-917.451) * [-913.980] (-926.410) (-910.558) (-928.837) -- 0:03:57

      Average standard deviation of split frequencies: 0.015372

      270500 -- (-914.621) (-923.888) (-927.068) [-911.495] * [-918.786] (-921.327) (-910.333) (-932.176) -- 0:04:00
      271000 -- (-911.772) (-912.704) (-938.738) [-935.176] * [-920.766] (-928.869) (-918.132) (-921.961) -- 0:03:59
      271500 -- [-910.383] (-909.682) (-918.788) (-922.050) * (-926.918) (-937.979) [-915.928] (-918.426) -- 0:03:58
      272000 -- [-911.244] (-919.250) (-910.184) (-922.215) * (-928.530) (-921.838) (-932.688) [-931.726] -- 0:03:58
      272500 -- (-913.422) (-921.766) (-927.704) [-911.232] * [-914.177] (-930.886) (-910.611) (-929.949) -- 0:03:57
      273000 -- [-919.363] (-923.991) (-915.997) (-927.570) * [-918.306] (-927.719) (-905.966) (-925.786) -- 0:03:57
      273500 -- (-927.014) (-913.381) [-915.401] (-917.453) * [-914.717] (-929.189) (-910.999) (-933.089) -- 0:03:59
      274000 -- (-929.286) (-939.551) [-915.847] (-912.553) * (-939.267) (-928.666) [-908.495] (-927.977) -- 0:03:58
      274500 -- (-915.947) (-921.009) [-918.034] (-926.889) * (-927.210) (-932.282) [-913.713] (-923.790) -- 0:03:57
      275000 -- [-926.311] (-921.423) (-921.319) (-916.659) * [-918.346] (-956.316) (-915.677) (-925.587) -- 0:03:57

      Average standard deviation of split frequencies: 0.017151

      275500 -- (-923.675) (-935.747) (-927.333) [-918.295] * [-915.490] (-935.745) (-904.105) (-933.749) -- 0:03:56
      276000 -- (-924.063) [-914.903] (-923.705) (-912.411) * [-919.416] (-943.351) (-919.765) (-917.470) -- 0:03:56
      276500 -- (-925.338) (-925.369) [-904.458] (-908.970) * (-922.429) (-924.403) [-924.599] (-925.876) -- 0:03:58
      277000 -- [-901.994] (-922.900) (-929.656) (-922.585) * [-914.493] (-919.468) (-913.210) (-914.646) -- 0:03:57
      277500 -- (-915.819) (-913.876) [-912.479] (-923.880) * (-918.341) (-914.835) (-925.490) [-905.826] -- 0:03:56
      278000 -- [-910.659] (-920.595) (-910.973) (-926.860) * (-917.637) (-909.759) (-911.087) [-913.509] -- 0:03:56
      278500 -- [-923.073] (-919.882) (-919.750) (-917.025) * (-917.951) (-925.302) (-915.006) [-914.369] -- 0:03:55
      279000 -- (-917.699) (-915.238) (-913.390) [-914.283] * [-912.705] (-915.244) (-919.391) (-906.293) -- 0:03:55
      279500 -- (-914.752) (-930.089) (-907.999) [-910.555] * (-913.639) (-927.191) (-914.925) [-918.550] -- 0:03:57
      280000 -- (-913.084) (-943.771) [-922.691] (-922.272) * (-922.395) (-935.467) [-920.942] (-915.318) -- 0:03:56

      Average standard deviation of split frequencies: 0.017076

      280500 -- [-912.521] (-932.937) (-934.677) (-929.267) * [-910.260] (-920.828) (-916.381) (-930.580) -- 0:03:55
      281000 -- [-909.414] (-906.285) (-928.910) (-926.272) * [-918.632] (-931.676) (-912.383) (-928.385) -- 0:03:55
      281500 -- [-915.872] (-930.483) (-911.417) (-919.539) * [-923.135] (-917.285) (-912.308) (-920.726) -- 0:03:54
      282000 -- (-927.434) [-911.005] (-921.029) (-935.120) * (-924.995) [-901.117] (-912.646) (-918.312) -- 0:03:54
      282500 -- (-919.178) (-908.170) [-905.469] (-919.886) * (-933.368) (-918.975) [-906.040] (-922.727) -- 0:03:56
      283000 -- (-914.993) (-911.003) [-906.916] (-919.711) * (-916.873) (-935.030) [-911.239] (-918.905) -- 0:03:55
      283500 -- (-929.381) (-912.502) [-920.113] (-924.127) * (-914.577) (-914.120) [-915.230] (-916.547) -- 0:03:55
      284000 -- (-925.751) (-909.393) [-920.830] (-911.815) * (-945.739) (-928.908) (-922.637) [-908.925] -- 0:03:54
      284500 -- (-922.478) [-921.267] (-923.027) (-922.040) * (-909.538) (-928.809) [-920.134] (-921.305) -- 0:03:53
      285000 -- (-923.959) [-917.167] (-913.952) (-915.465) * [-909.566] (-922.866) (-921.241) (-912.419) -- 0:03:53

      Average standard deviation of split frequencies: 0.017128

      285500 -- (-934.057) (-919.885) [-907.845] (-920.583) * (-903.539) [-914.606] (-913.461) (-916.315) -- 0:03:55
      286000 -- (-926.937) (-923.709) (-929.428) [-919.517] * (-922.889) (-911.324) [-917.612] (-925.007) -- 0:03:54
      286500 -- (-932.550) [-908.251] (-944.924) (-911.256) * (-921.515) [-927.301] (-917.648) (-920.018) -- 0:03:54
      287000 -- (-921.074) [-909.694] (-929.509) (-919.128) * (-910.759) (-924.648) [-911.123] (-907.279) -- 0:03:53
      287500 -- (-919.653) [-905.235] (-922.564) (-925.629) * [-924.006] (-919.106) (-919.561) (-916.657) -- 0:03:52
      288000 -- [-909.103] (-924.181) (-925.810) (-933.715) * (-935.286) [-904.232] (-915.720) (-915.513) -- 0:03:52
      288500 -- (-920.098) (-911.899) [-922.533] (-937.935) * (-922.583) (-922.152) [-907.950] (-915.681) -- 0:03:51
      289000 -- [-919.384] (-922.850) (-915.700) (-916.270) * (-937.840) [-908.818] (-916.582) (-923.102) -- 0:03:53
      289500 -- (-921.049) [-908.488] (-919.381) (-937.596) * (-932.409) (-910.428) (-932.954) [-911.073] -- 0:03:53
      290000 -- (-927.911) (-918.004) (-927.154) [-919.725] * (-918.996) (-920.327) (-913.845) [-916.868] -- 0:03:52

      Average standard deviation of split frequencies: 0.015272

      290500 -- (-921.405) (-911.277) [-902.341] (-909.761) * (-919.929) (-916.653) (-919.899) [-921.185] -- 0:03:52
      291000 -- (-914.151) (-928.950) [-913.935] (-917.463) * (-916.941) (-910.173) (-935.015) [-913.156] -- 0:03:51
      291500 -- (-911.154) (-910.874) (-919.400) [-920.316] * [-906.294] (-912.694) (-924.944) (-910.166) -- 0:03:50
      292000 -- [-914.423] (-919.472) (-912.792) (-914.785) * (-923.839) [-911.690] (-916.023) (-910.761) -- 0:03:52
      292500 -- (-921.734) (-918.949) [-913.421] (-925.396) * [-911.962] (-923.490) (-915.638) (-925.776) -- 0:03:52
      293000 -- (-929.817) (-919.616) [-906.140] (-917.341) * (-915.168) (-919.349) [-911.824] (-910.483) -- 0:03:51
      293500 -- (-913.133) (-911.247) [-905.721] (-930.714) * (-917.728) [-913.436] (-920.006) (-926.053) -- 0:03:51
      294000 -- [-914.569] (-926.745) (-910.831) (-928.733) * (-916.586) (-916.707) [-917.901] (-924.193) -- 0:03:50
      294500 -- (-914.729) (-930.691) [-910.013] (-916.898) * [-935.622] (-932.205) (-918.346) (-909.894) -- 0:03:49
      295000 -- (-909.791) (-953.372) (-919.374) [-913.492] * (-943.441) [-908.329] (-913.281) (-914.120) -- 0:03:51

      Average standard deviation of split frequencies: 0.016411

      295500 -- (-928.791) (-923.983) [-919.889] (-903.658) * (-943.667) [-909.502] (-930.920) (-917.551) -- 0:03:51
      296000 -- [-915.212] (-916.804) (-915.669) (-926.447) * (-945.046) [-913.801] (-918.715) (-920.114) -- 0:03:50
      296500 -- (-925.166) [-910.621] (-906.634) (-915.558) * (-928.837) (-920.555) [-927.479] (-915.648) -- 0:03:50
      297000 -- (-922.435) (-930.529) [-921.518] (-909.940) * (-926.227) (-923.095) (-917.043) [-915.382] -- 0:03:49
      297500 -- (-917.093) (-922.422) [-915.392] (-918.264) * (-918.396) (-918.675) (-938.841) [-913.969] -- 0:03:49
      298000 -- (-919.952) (-917.588) (-926.538) [-917.693] * (-923.589) (-918.626) (-926.313) [-908.785] -- 0:03:50
      298500 -- [-912.885] (-916.476) (-927.414) (-913.789) * (-920.453) (-919.575) (-921.892) [-910.070] -- 0:03:50
      299000 -- [-911.939] (-928.858) (-924.389) (-917.915) * (-930.036) (-929.866) (-918.621) [-920.742] -- 0:03:49
      299500 -- (-907.311) (-926.337) (-920.580) [-909.453] * (-928.084) (-932.256) (-913.592) [-910.153] -- 0:03:49
      300000 -- (-919.527) [-911.876] (-923.709) (-911.651) * (-936.107) (-918.981) [-920.858] (-913.447) -- 0:03:48

      Average standard deviation of split frequencies: 0.015474

      300500 -- [-915.744] (-916.534) (-918.780) (-915.458) * (-913.199) (-913.916) (-922.393) [-911.179] -- 0:03:48
      301000 -- (-908.972) (-920.341) (-925.613) [-908.542] * (-920.175) [-915.366] (-917.650) (-916.431) -- 0:03:49
      301500 -- (-907.245) (-940.153) (-926.432) [-909.492] * (-914.011) (-928.543) (-916.751) [-917.975] -- 0:03:49
      302000 -- (-908.991) (-923.211) [-915.764] (-916.160) * (-925.259) (-922.070) [-918.057] (-917.084) -- 0:03:48
      302500 -- (-913.309) (-927.113) [-913.962] (-912.024) * (-917.798) (-918.671) [-915.898] (-924.716) -- 0:03:48
      303000 -- (-939.233) (-924.656) (-915.096) [-907.373] * (-914.349) (-917.308) [-908.332] (-908.586) -- 0:03:47
      303500 -- [-922.298] (-938.901) (-914.131) (-920.919) * [-912.333] (-916.050) (-918.660) (-912.693) -- 0:03:47
      304000 -- [-920.958] (-920.854) (-916.368) (-913.206) * (-929.916) (-929.989) (-920.874) [-932.851] -- 0:03:48
      304500 -- [-920.871] (-931.691) (-923.251) (-928.152) * (-903.798) (-916.307) [-918.849] (-923.748) -- 0:03:48
      305000 -- (-921.456) (-922.106) (-914.015) [-923.085] * (-914.115) (-913.880) [-905.426] (-927.097) -- 0:03:47

      Average standard deviation of split frequencies: 0.015470

      305500 -- (-927.383) (-913.754) (-917.484) [-921.984] * (-908.930) (-931.002) [-909.961] (-917.354) -- 0:03:47
      306000 -- (-915.792) (-920.847) (-915.984) [-917.398] * (-923.177) (-927.319) [-919.203] (-930.633) -- 0:03:46
      306500 -- (-907.522) (-916.331) [-915.418] (-915.165) * (-923.104) (-920.255) [-911.633] (-913.321) -- 0:03:46
      307000 -- [-906.534] (-918.253) (-915.621) (-920.915) * [-912.641] (-925.903) (-924.420) (-915.502) -- 0:03:47
      307500 -- (-920.406) [-907.058] (-922.005) (-922.828) * (-923.950) (-917.259) (-916.676) [-920.363] -- 0:03:47
      308000 -- (-913.848) (-909.836) [-914.844] (-913.351) * (-930.020) [-912.873] (-916.290) (-932.845) -- 0:03:46
      308500 -- [-922.039] (-920.105) (-910.888) (-921.777) * (-913.954) (-910.666) [-920.083] (-926.368) -- 0:03:46
      309000 -- (-914.103) [-911.464] (-925.141) (-908.613) * (-911.195) [-905.492] (-920.830) (-918.697) -- 0:03:45
      309500 -- (-925.022) (-909.447) [-919.161] (-915.181) * (-922.857) [-911.454] (-931.982) (-906.112) -- 0:03:45
      310000 -- [-914.544] (-919.477) (-911.742) (-913.404) * [-912.331] (-916.792) (-930.833) (-928.493) -- 0:03:47

      Average standard deviation of split frequencies: 0.016438

      310500 -- (-918.663) [-901.831] (-912.513) (-919.873) * (-917.405) (-925.279) [-916.612] (-925.742) -- 0:03:46
      311000 -- (-923.923) [-906.273] (-911.061) (-927.557) * [-916.418] (-929.279) (-914.310) (-933.871) -- 0:03:45
      311500 -- (-908.456) [-913.061] (-913.947) (-938.845) * (-916.128) [-904.585] (-914.573) (-921.120) -- 0:03:45
      312000 -- (-913.469) [-914.013] (-923.619) (-936.733) * (-930.490) (-909.773) (-915.607) [-925.999] -- 0:03:44
      312500 -- (-916.247) [-909.354] (-923.184) (-937.838) * (-924.516) (-912.586) (-919.818) [-921.639] -- 0:03:44
      313000 -- (-929.049) [-914.413] (-909.707) (-944.353) * [-918.510] (-913.685) (-917.479) (-923.190) -- 0:03:46
      313500 -- (-917.317) (-936.033) [-918.450] (-945.211) * (-932.491) (-928.742) (-910.997) [-920.223] -- 0:03:45
      314000 -- (-930.432) (-934.836) (-910.892) [-914.032] * [-919.318] (-923.627) (-917.526) (-924.524) -- 0:03:45
      314500 -- (-924.209) [-923.015] (-913.264) (-924.581) * (-915.430) (-923.690) (-911.126) [-911.618] -- 0:03:44
      315000 -- (-929.748) [-914.679] (-926.898) (-921.686) * [-910.251] (-931.601) (-911.664) (-919.141) -- 0:03:43

      Average standard deviation of split frequencies: 0.014529

      315500 -- (-919.163) (-928.590) [-912.951] (-926.347) * (-919.400) (-902.081) (-918.893) [-905.061] -- 0:03:43
      316000 -- (-918.313) [-909.429] (-914.621) (-926.909) * (-919.882) [-909.966] (-911.185) (-907.921) -- 0:03:45
      316500 -- (-926.289) [-909.381] (-913.253) (-920.945) * (-916.125) (-929.193) (-916.665) [-912.842] -- 0:03:44
      317000 -- (-918.494) [-914.956] (-929.830) (-913.973) * (-925.116) (-918.292) (-912.679) [-912.104] -- 0:03:44
      317500 -- (-925.665) (-922.157) [-906.371] (-910.055) * [-914.650] (-922.914) (-916.316) (-915.214) -- 0:03:43
      318000 -- (-920.251) [-919.768] (-923.644) (-909.756) * (-929.894) (-929.585) [-912.379] (-910.144) -- 0:03:43
      318500 -- (-934.546) (-920.613) (-926.379) [-918.685] * (-914.690) (-921.421) [-917.747] (-917.042) -- 0:03:42
      319000 -- (-926.304) (-901.280) (-912.418) [-923.655] * (-911.243) (-923.787) [-919.888] (-923.200) -- 0:03:44
      319500 -- (-911.905) (-914.874) [-904.549] (-926.013) * [-928.145] (-930.525) (-921.733) (-921.335) -- 0:03:43
      320000 -- [-907.923] (-913.898) (-908.263) (-920.529) * (-934.477) (-932.741) [-923.108] (-924.325) -- 0:03:43

      Average standard deviation of split frequencies: 0.012783

      320500 -- (-916.166) [-913.222] (-914.976) (-930.493) * (-925.278) [-918.855] (-921.780) (-918.008) -- 0:03:42
      321000 -- (-916.136) (-919.320) (-926.001) [-916.881] * (-923.144) (-907.905) (-915.724) [-916.073] -- 0:03:42
      321500 -- (-928.048) [-915.091] (-914.948) (-923.934) * [-933.353] (-926.464) (-920.178) (-934.551) -- 0:03:41
      322000 -- [-918.216] (-923.414) (-923.060) (-926.569) * (-955.278) (-918.228) [-911.070] (-908.465) -- 0:03:43
      322500 -- (-926.962) (-918.368) [-915.372] (-930.080) * (-917.449) [-910.693] (-921.915) (-916.067) -- 0:03:42
      323000 -- (-914.604) [-915.540] (-925.972) (-923.055) * (-916.045) [-912.770] (-915.201) (-918.779) -- 0:03:42
      323500 -- (-921.954) (-909.769) [-908.041] (-923.497) * (-910.510) (-916.660) [-907.916] (-928.343) -- 0:03:41
      324000 -- [-914.802] (-909.866) (-920.428) (-930.668) * [-912.018] (-916.121) (-915.101) (-920.628) -- 0:03:41
      324500 -- (-923.424) [-911.018] (-917.585) (-919.891) * (-914.160) [-911.499] (-926.510) (-927.643) -- 0:03:40
      325000 -- (-920.205) [-920.125] (-915.221) (-936.883) * [-907.598] (-914.401) (-910.759) (-917.678) -- 0:03:42

      Average standard deviation of split frequencies: 0.011207

      325500 -- [-913.822] (-920.070) (-926.757) (-908.190) * (-911.894) [-911.959] (-922.281) (-923.679) -- 0:03:41
      326000 -- (-913.174) (-906.075) [-910.081] (-920.648) * [-907.374] (-910.315) (-910.236) (-928.210) -- 0:03:41
      326500 -- [-915.296] (-909.177) (-922.456) (-918.450) * (-942.501) (-920.128) [-915.519] (-927.552) -- 0:03:40
      327000 -- [-909.245] (-917.194) (-920.684) (-929.057) * (-906.075) [-911.895] (-913.546) (-921.498) -- 0:03:40
      327500 -- (-920.032) (-924.534) (-904.281) [-912.410] * (-920.318) (-916.349) [-916.348] (-924.278) -- 0:03:39
      328000 -- (-910.391) [-916.463] (-910.739) (-920.593) * (-924.601) [-908.567] (-914.472) (-919.964) -- 0:03:39
      328500 -- [-912.456] (-909.428) (-912.016) (-920.946) * (-920.735) [-918.276] (-911.279) (-925.996) -- 0:03:40
      329000 -- [-911.206] (-911.315) (-928.748) (-922.959) * (-921.982) [-909.934] (-922.317) (-921.766) -- 0:03:40
      329500 -- [-923.236] (-918.906) (-909.166) (-912.906) * (-924.105) (-910.124) [-909.519] (-919.019) -- 0:03:39
      330000 -- [-910.622] (-920.216) (-920.870) (-923.074) * (-910.688) (-912.526) [-908.545] (-935.822) -- 0:03:39

      Average standard deviation of split frequencies: 0.011975

      330500 -- [-915.515] (-913.913) (-918.467) (-922.042) * [-912.018] (-912.421) (-916.684) (-930.445) -- 0:03:38
      331000 -- (-922.568) (-919.542) (-930.366) [-920.425] * (-914.827) (-922.977) (-924.935) [-909.538] -- 0:03:38
      331500 -- (-912.911) (-921.000) (-936.736) [-911.830] * [-915.090] (-926.505) (-926.245) (-931.911) -- 0:03:39
      332000 -- [-912.489] (-923.711) (-922.977) (-914.415) * [-915.780] (-919.945) (-936.960) (-907.592) -- 0:03:39
      332500 -- (-912.593) [-916.888] (-924.457) (-918.240) * [-916.416] (-915.426) (-919.397) (-912.792) -- 0:03:38
      333000 -- (-918.330) (-930.092) (-927.480) [-917.531] * [-910.830] (-924.079) (-913.799) (-922.049) -- 0:03:38
      333500 -- (-916.398) [-926.222] (-906.854) (-915.701) * [-918.744] (-917.785) (-927.873) (-908.523) -- 0:03:37
      334000 -- [-911.558] (-919.107) (-908.937) (-911.731) * (-915.723) [-912.250] (-922.097) (-918.427) -- 0:03:37
      334500 -- [-910.569] (-921.827) (-914.414) (-919.358) * (-928.317) [-904.704] (-926.869) (-915.701) -- 0:03:38
      335000 -- (-919.257) (-917.259) [-913.659] (-914.608) * (-926.030) (-918.537) [-908.465] (-914.306) -- 0:03:38

      Average standard deviation of split frequencies: 0.012627

      335500 -- [-913.866] (-923.293) (-925.576) (-920.820) * [-906.374] (-912.780) (-921.868) (-913.164) -- 0:03:37
      336000 -- (-937.945) [-908.222] (-916.692) (-942.874) * (-915.757) [-906.503] (-919.166) (-920.839) -- 0:03:37
      336500 -- (-919.156) (-915.073) [-902.350] (-916.715) * (-921.402) (-928.686) [-918.364] (-922.366) -- 0:03:36
      337000 -- (-914.137) (-913.756) [-907.544] (-921.980) * (-919.690) (-913.767) [-915.442] (-925.074) -- 0:03:36
      337500 -- (-918.608) [-907.996] (-912.893) (-914.576) * (-933.134) (-929.531) (-920.590) [-911.290] -- 0:03:37
      338000 -- [-912.917] (-916.269) (-915.925) (-938.212) * (-922.082) (-925.850) [-932.566] (-918.256) -- 0:03:37
      338500 -- [-911.065] (-915.722) (-923.224) (-921.999) * (-924.701) (-934.812) (-924.513) [-914.554] -- 0:03:36
      339000 -- (-914.021) (-917.156) [-920.358] (-914.327) * (-922.015) [-905.872] (-933.478) (-919.048) -- 0:03:36
      339500 -- (-941.372) (-929.635) (-917.511) [-906.893] * (-917.364) [-917.264] (-923.642) (-929.010) -- 0:03:35
      340000 -- [-920.071] (-936.140) (-919.133) (-916.145) * (-913.529) [-913.337] (-919.628) (-929.088) -- 0:03:35

      Average standard deviation of split frequencies: 0.011912

      340500 -- [-921.173] (-916.931) (-921.867) (-920.250) * (-919.367) (-914.029) [-920.704] (-923.793) -- 0:03:36
      341000 -- (-921.285) [-912.029] (-926.716) (-923.294) * (-920.824) [-912.722] (-927.405) (-912.733) -- 0:03:36
      341500 -- (-924.652) [-907.811] (-921.524) (-919.823) * (-917.408) (-909.844) (-924.159) [-907.790] -- 0:03:35
      342000 -- (-925.448) [-910.955] (-923.669) (-921.578) * (-906.710) [-917.464] (-927.297) (-924.998) -- 0:03:35
      342500 -- [-909.455] (-928.599) (-924.139) (-910.431) * (-925.775) (-916.925) (-911.641) [-917.693] -- 0:03:35
      343000 -- (-925.018) [-921.553] (-913.492) (-922.960) * (-915.187) (-908.990) (-923.116) [-908.979] -- 0:03:34
      343500 -- [-914.992] (-921.605) (-919.769) (-921.091) * [-908.570] (-924.152) (-933.936) (-920.482) -- 0:03:34
      344000 -- (-929.468) (-922.641) [-913.645] (-913.194) * [-912.105] (-913.474) (-921.651) (-925.322) -- 0:03:35
      344500 -- (-932.936) (-933.802) (-917.589) [-916.222] * [-907.850] (-917.949) (-939.221) (-911.975) -- 0:03:35
      345000 -- (-927.937) (-916.790) [-918.862] (-917.116) * (-932.302) (-918.218) [-912.817] (-924.246) -- 0:03:34

      Average standard deviation of split frequencies: 0.012546

      345500 -- (-923.015) (-910.325) [-915.692] (-924.464) * [-911.069] (-911.942) (-907.778) (-934.516) -- 0:03:34
      346000 -- (-938.559) [-912.594] (-923.766) (-908.132) * [-923.867] (-913.354) (-910.320) (-923.773) -- 0:03:33
      346500 -- [-913.616] (-926.581) (-916.320) (-911.875) * (-920.078) (-926.389) [-918.322] (-917.033) -- 0:03:33
      347000 -- (-923.366) (-925.395) (-919.297) [-917.626] * [-909.239] (-916.894) (-926.655) (-917.945) -- 0:03:34
      347500 -- (-916.181) (-932.081) (-919.858) [-906.462] * (-927.881) (-913.982) (-914.899) [-913.613] -- 0:03:34
      348000 -- (-917.535) [-915.772] (-922.854) (-923.032) * (-917.846) [-915.732] (-922.418) (-929.199) -- 0:03:33
      348500 -- (-924.154) (-915.885) (-930.448) [-913.004] * (-919.482) (-940.567) [-915.621] (-913.327) -- 0:03:33
      349000 -- (-912.951) (-922.045) [-916.701] (-911.871) * (-926.866) (-924.717) (-916.828) [-913.378] -- 0:03:32
      349500 -- (-922.760) (-923.582) (-907.661) [-914.415] * (-927.333) (-925.089) [-908.854] (-912.798) -- 0:03:32
      350000 -- (-924.367) (-919.811) (-915.520) [-921.114] * (-909.031) (-924.967) (-916.359) [-918.810] -- 0:03:33

      Average standard deviation of split frequencies: 0.013107

      350500 -- (-920.923) [-918.240] (-911.107) (-917.424) * [-914.258] (-916.553) (-925.582) (-915.016) -- 0:03:33
      351000 -- (-912.044) (-920.051) [-916.319] (-921.087) * (-921.694) [-912.080] (-929.770) (-919.724) -- 0:03:32
      351500 -- (-916.747) [-923.072] (-916.380) (-917.634) * (-913.267) (-915.473) (-908.938) [-909.573] -- 0:03:32
      352000 -- (-917.142) (-929.032) [-912.110] (-907.682) * (-920.756) (-929.931) [-916.735] (-908.861) -- 0:03:31
      352500 -- (-928.291) (-922.772) (-919.694) [-920.768] * (-931.391) (-921.255) (-917.785) [-916.316] -- 0:03:31
      353000 -- (-918.612) (-922.810) [-908.539] (-914.923) * (-917.149) (-919.688) (-910.825) [-912.173] -- 0:03:32
      353500 -- [-909.704] (-918.889) (-922.964) (-914.680) * [-912.283] (-921.894) (-912.641) (-909.547) -- 0:03:32
      354000 -- [-912.112] (-915.627) (-918.666) (-922.910) * [-913.426] (-942.545) (-915.368) (-919.683) -- 0:03:31
      354500 -- (-924.376) [-916.023] (-915.730) (-922.803) * (-919.308) (-931.565) [-903.715] (-929.158) -- 0:03:31
      355000 -- (-924.375) (-917.126) (-925.767) [-914.652] * (-929.258) (-922.707) [-910.521] (-923.448) -- 0:03:30

      Average standard deviation of split frequencies: 0.012436

      355500 -- (-916.917) [-905.380] (-931.919) (-914.308) * (-927.579) (-909.161) [-923.855] (-916.257) -- 0:03:30
      356000 -- (-938.722) (-912.319) [-913.816] (-923.501) * (-921.132) [-909.054] (-931.920) (-919.548) -- 0:03:31
      356500 -- (-914.823) (-914.561) (-917.256) [-913.700] * (-919.554) [-906.264] (-909.845) (-921.999) -- 0:03:31
      357000 -- [-913.731] (-921.916) (-923.459) (-919.237) * (-912.640) [-908.875] (-911.405) (-919.928) -- 0:03:30
      357500 -- (-917.759) (-908.834) [-913.007] (-935.595) * (-913.789) [-912.921] (-923.711) (-919.206) -- 0:03:30
      358000 -- (-937.064) [-907.070] (-929.176) (-929.172) * [-914.912] (-918.955) (-914.247) (-918.078) -- 0:03:29
      358500 -- (-929.596) (-923.565) [-913.845] (-913.247) * (-934.719) (-922.253) (-921.776) [-909.687] -- 0:03:29
      359000 -- (-922.998) (-927.898) (-923.674) [-917.479] * (-928.867) [-917.776] (-917.976) (-921.035) -- 0:03:30
      359500 -- [-917.370] (-925.397) (-907.516) (-914.629) * (-935.828) (-910.541) (-921.123) [-917.827] -- 0:03:30
      360000 -- [-907.046] (-930.453) (-917.595) (-914.099) * (-938.802) [-905.641] (-922.030) (-929.507) -- 0:03:29

      Average standard deviation of split frequencies: 0.011593

      360500 -- [-912.274] (-931.978) (-916.692) (-928.172) * (-920.730) [-922.129] (-916.519) (-921.378) -- 0:03:29
      361000 -- [-918.821] (-951.162) (-913.592) (-921.676) * (-924.290) [-916.777] (-921.648) (-927.546) -- 0:03:28
      361500 -- (-916.965) (-914.367) (-926.914) [-910.358] * (-920.883) [-909.016] (-935.037) (-916.866) -- 0:03:28
      362000 -- (-918.225) (-917.569) (-925.266) [-914.025] * (-934.789) (-911.002) [-900.069] (-922.485) -- 0:03:29
      362500 -- (-922.074) (-916.128) (-915.515) [-914.622] * (-918.326) (-915.040) [-911.842] (-911.397) -- 0:03:29
      363000 -- (-919.521) (-919.406) (-920.978) [-913.914] * (-927.943) [-909.288] (-918.789) (-916.836) -- 0:03:28
      363500 -- (-913.746) (-906.240) (-928.800) [-918.379] * (-927.640) (-915.876) [-912.564] (-915.669) -- 0:03:28
      364000 -- [-905.574] (-916.705) (-922.092) (-916.900) * (-943.761) [-910.673] (-913.527) (-916.757) -- 0:03:27
      364500 -- [-910.212] (-938.181) (-922.968) (-922.962) * (-918.309) (-916.018) [-907.877] (-922.808) -- 0:03:27
      365000 -- [-905.412] (-915.216) (-945.508) (-911.230) * [-913.112] (-917.014) (-917.044) (-933.784) -- 0:03:27

      Average standard deviation of split frequencies: 0.011536

      365500 -- (-910.433) [-914.536] (-916.800) (-910.908) * [-914.847] (-920.591) (-924.346) (-921.412) -- 0:03:28
      366000 -- [-917.406] (-919.645) (-924.364) (-919.514) * (-915.537) (-922.720) (-936.734) [-908.991] -- 0:03:27
      366500 -- [-908.522] (-915.732) (-914.820) (-906.591) * [-916.441] (-924.106) (-921.146) (-913.740) -- 0:03:27
      367000 -- (-921.895) [-911.281] (-923.837) (-921.442) * (-931.098) (-929.281) [-913.206] (-916.603) -- 0:03:26
      367500 -- (-918.930) [-913.339] (-933.417) (-911.029) * [-921.895] (-928.688) (-916.588) (-917.602) -- 0:03:26
      368000 -- (-907.855) (-919.630) [-908.699] (-908.215) * (-923.294) (-923.623) (-926.881) [-923.173] -- 0:03:26
      368500 -- (-911.737) [-909.651] (-924.447) (-919.914) * (-927.978) (-911.782) [-912.045] (-928.990) -- 0:03:27
      369000 -- [-910.916] (-918.354) (-936.984) (-917.712) * [-912.907] (-925.943) (-922.812) (-922.632) -- 0:03:26
      369500 -- (-925.762) (-925.813) [-931.945] (-914.498) * (-918.016) (-948.162) (-925.920) [-918.890] -- 0:03:26
      370000 -- (-923.030) [-912.335] (-915.473) (-914.655) * (-915.105) [-916.599] (-918.518) (-927.706) -- 0:03:26

      Average standard deviation of split frequencies: 0.012165

      370500 -- (-921.114) (-925.854) (-921.274) [-907.876] * [-921.001] (-915.364) (-939.398) (-927.557) -- 0:03:25
      371000 -- (-926.299) [-926.182] (-926.359) (-914.400) * [-928.619] (-912.064) (-929.213) (-931.547) -- 0:03:25
      371500 -- (-919.741) (-914.849) (-932.047) [-923.808] * (-916.770) (-928.079) (-913.364) [-912.619] -- 0:03:26
      372000 -- (-915.139) (-930.364) (-915.272) [-916.145] * (-927.716) (-930.327) [-909.669] (-918.940) -- 0:03:25
      372500 -- (-919.401) (-931.802) [-910.072] (-924.706) * [-916.850] (-924.352) (-918.699) (-928.111) -- 0:03:25
      373000 -- [-909.857] (-916.757) (-915.291) (-937.945) * [-903.842] (-910.489) (-935.808) (-930.391) -- 0:03:25
      373500 -- [-915.839] (-911.667) (-921.232) (-921.893) * (-911.891) (-922.645) [-919.012] (-922.912) -- 0:03:24
      374000 -- [-915.148] (-923.685) (-934.189) (-915.793) * (-914.754) (-923.262) [-920.912] (-933.804) -- 0:03:24
      374500 -- (-916.272) [-911.155] (-928.690) (-940.002) * [-921.091] (-911.662) (-909.802) (-923.153) -- 0:03:23
      375000 -- [-917.890] (-922.503) (-941.893) (-920.666) * [-908.612] (-905.983) (-927.527) (-940.887) -- 0:03:25

      Average standard deviation of split frequencies: 0.011447

      375500 -- [-918.146] (-919.591) (-926.922) (-911.392) * (-915.747) (-912.490) (-923.016) [-934.476] -- 0:03:24
      376000 -- (-912.831) (-919.591) (-926.286) [-919.130] * (-907.478) [-914.274] (-925.406) (-936.446) -- 0:03:24
      376500 -- (-922.867) [-916.449] (-933.794) (-925.698) * (-917.637) [-909.009] (-908.864) (-945.847) -- 0:03:23
      377000 -- (-915.352) [-923.059] (-929.417) (-930.333) * (-916.834) (-912.777) [-907.843] (-937.119) -- 0:03:23
      377500 -- (-913.653) [-906.941] (-925.921) (-911.347) * (-924.001) [-913.132] (-908.766) (-943.843) -- 0:03:22
      378000 -- (-917.824) (-922.908) [-910.215] (-914.643) * (-952.543) [-924.182] (-913.647) (-917.199) -- 0:03:24
      378500 -- (-914.462) (-918.083) (-918.275) [-909.148] * [-923.107] (-911.559) (-923.240) (-927.583) -- 0:03:23
      379000 -- (-918.823) [-917.012] (-922.439) (-929.678) * (-915.016) (-918.866) [-914.688] (-925.019) -- 0:03:23
      379500 -- (-914.422) (-917.806) [-913.865] (-909.921) * (-914.317) (-916.971) (-920.008) [-915.690] -- 0:03:22
      380000 -- (-937.571) [-910.815] (-914.887) (-922.411) * (-931.420) (-925.758) [-912.021] (-930.825) -- 0:03:22

      Average standard deviation of split frequencies: 0.011630

      380500 -- (-928.124) (-916.936) (-905.417) [-910.029] * (-923.918) (-913.586) [-916.119] (-925.609) -- 0:03:21
      381000 -- (-923.766) (-910.457) [-915.598] (-912.015) * (-932.183) [-922.731] (-912.289) (-932.565) -- 0:03:23
      381500 -- [-919.789] (-916.807) (-915.322) (-932.292) * [-915.656] (-926.814) (-913.938) (-937.831) -- 0:03:22
      382000 -- [-911.630] (-919.916) (-907.033) (-930.739) * (-915.380) (-915.133) [-911.931] (-916.023) -- 0:03:22
      382500 -- [-908.143] (-917.829) (-925.736) (-921.053) * [-906.772] (-932.155) (-921.165) (-934.566) -- 0:03:21
      383000 -- [-908.546] (-915.828) (-929.995) (-916.355) * (-911.619) [-923.633] (-922.349) (-929.772) -- 0:03:21
      383500 -- [-913.040] (-910.667) (-932.823) (-918.108) * [-906.544] (-928.965) (-912.518) (-928.002) -- 0:03:20
      384000 -- (-926.050) (-922.629) [-904.307] (-915.471) * (-915.275) (-926.370) [-909.561] (-922.437) -- 0:03:22
      384500 -- (-916.414) (-930.444) [-913.891] (-907.909) * (-917.029) (-927.693) [-917.396] (-918.263) -- 0:03:21
      385000 -- (-911.541) (-929.749) [-918.461] (-917.331) * (-916.176) (-919.095) [-908.242] (-917.913) -- 0:03:21

      Average standard deviation of split frequencies: 0.012671

      385500 -- [-911.647] (-927.076) (-922.202) (-917.037) * (-920.168) [-910.195] (-914.186) (-936.100) -- 0:03:20
      386000 -- [-918.521] (-918.343) (-921.866) (-922.321) * (-928.844) [-910.327] (-916.711) (-926.907) -- 0:03:20
      386500 -- (-910.124) (-910.691) [-909.860] (-919.921) * (-918.085) (-917.866) [-917.265] (-930.149) -- 0:03:20
      387000 -- (-920.190) (-926.746) (-916.226) [-906.686] * (-907.346) (-919.283) (-916.120) [-911.262] -- 0:03:21
      387500 -- (-906.548) (-929.427) [-913.320] (-909.971) * [-907.191] (-926.981) (-920.668) (-909.064) -- 0:03:20
      388000 -- [-910.207] (-929.980) (-912.875) (-923.213) * (-921.938) [-912.468] (-930.870) (-909.452) -- 0:03:20
      388500 -- (-917.046) (-919.586) [-916.700] (-916.070) * [-920.654] (-929.698) (-933.464) (-902.786) -- 0:03:19
      389000 -- (-923.511) (-913.457) (-913.518) [-920.654] * (-915.360) (-926.518) (-937.342) [-909.321] -- 0:03:19
      389500 -- (-917.059) (-924.640) [-912.719] (-908.631) * (-909.722) [-910.048] (-924.814) (-925.442) -- 0:03:19
      390000 -- (-923.180) (-908.251) [-903.331] (-915.329) * [-912.858] (-917.016) (-915.426) (-927.724) -- 0:03:20

      Average standard deviation of split frequencies: 0.013877

      390500 -- (-923.489) [-915.022] (-907.159) (-934.856) * [-914.632] (-907.629) (-924.043) (-926.291) -- 0:03:19
      391000 -- (-922.799) [-914.634] (-909.396) (-920.395) * (-908.678) (-917.956) (-912.763) [-912.136] -- 0:03:19
      391500 -- (-921.842) (-915.768) (-919.268) [-912.934] * [-907.495] (-912.629) (-922.530) (-914.989) -- 0:03:18
      392000 -- [-911.035] (-928.882) (-914.575) (-923.823) * [-911.727] (-918.338) (-911.548) (-919.642) -- 0:03:18
      392500 -- (-923.820) [-904.105] (-917.207) (-922.422) * [-906.497] (-925.333) (-917.540) (-907.426) -- 0:03:18
      393000 -- (-915.253) [-913.887] (-921.561) (-930.967) * (-914.171) [-918.296] (-911.211) (-907.411) -- 0:03:19
      393500 -- (-921.184) (-929.433) [-916.912] (-919.717) * [-910.233] (-917.594) (-929.636) (-913.294) -- 0:03:18
      394000 -- (-923.113) (-916.875) [-912.529] (-923.996) * (-927.115) (-913.458) (-910.773) [-922.117] -- 0:03:18
      394500 -- (-923.479) [-912.671] (-925.099) (-913.652) * [-908.889] (-933.672) (-919.625) (-922.676) -- 0:03:17
      395000 -- (-925.691) (-919.990) [-917.240] (-914.478) * [-914.792] (-919.343) (-921.291) (-923.088) -- 0:03:17

      Average standard deviation of split frequencies: 0.013491

      395500 -- (-911.088) (-923.526) (-926.239) [-917.170] * [-914.472] (-910.911) (-920.264) (-934.278) -- 0:03:17
      396000 -- [-911.586] (-931.401) (-928.052) (-918.509) * (-916.911) [-919.122] (-916.212) (-921.795) -- 0:03:18
      396500 -- (-917.611) (-917.144) [-915.445] (-920.280) * (-922.960) (-920.023) (-922.704) [-914.610] -- 0:03:17
      397000 -- (-905.333) (-911.162) (-919.290) [-915.077] * (-916.433) (-931.501) [-914.264] (-917.273) -- 0:03:17
      397500 -- [-922.698] (-924.834) (-915.784) (-918.429) * (-925.212) (-929.964) [-913.984] (-916.870) -- 0:03:17
      398000 -- [-914.447] (-925.362) (-911.935) (-932.108) * (-921.189) (-925.070) [-919.011] (-913.674) -- 0:03:16
      398500 -- (-910.894) (-914.272) [-920.844] (-917.884) * (-908.105) (-922.319) (-916.896) [-905.245] -- 0:03:16
      399000 -- (-906.011) [-914.297] (-924.860) (-931.030) * (-910.665) (-914.929) (-919.156) [-912.440] -- 0:03:17
      399500 -- [-909.630] (-925.880) (-922.821) (-937.027) * (-921.268) [-912.169] (-910.751) (-929.533) -- 0:03:16
      400000 -- [-911.896] (-925.065) (-937.256) (-929.123) * (-927.886) (-913.278) [-912.194] (-926.728) -- 0:03:16

      Average standard deviation of split frequencies: 0.013628

      400500 -- [-910.873] (-918.101) (-928.905) (-926.171) * (-919.411) (-926.919) [-918.240] (-928.592) -- 0:03:16
      401000 -- (-932.050) [-909.642] (-922.281) (-917.951) * [-923.789] (-924.851) (-911.157) (-911.646) -- 0:03:15
      401500 -- (-922.280) [-920.177] (-930.843) (-931.498) * (-920.076) [-916.254] (-916.762) (-922.824) -- 0:03:15
      402000 -- (-917.814) (-910.863) [-912.073] (-917.914) * [-922.180] (-918.271) (-913.832) (-917.293) -- 0:03:16
      402500 -- (-935.903) (-918.620) [-912.151] (-929.011) * (-936.599) (-921.184) [-919.917] (-937.421) -- 0:03:15
      403000 -- (-931.656) (-913.260) [-911.700] (-916.619) * (-921.433) [-916.686] (-914.774) (-931.189) -- 0:03:15
      403500 -- (-909.609) (-916.327) (-913.498) [-915.104] * [-903.050] (-915.742) (-920.045) (-947.457) -- 0:03:15
      404000 -- (-916.830) [-917.592] (-930.783) (-911.258) * (-911.478) (-914.920) [-915.230] (-927.318) -- 0:03:14
      404500 -- (-907.129) (-923.940) (-915.972) [-910.794] * [-915.400] (-921.410) (-925.952) (-926.446) -- 0:03:14
      405000 -- (-920.434) [-920.802] (-911.967) (-918.052) * (-929.646) (-918.994) [-924.244] (-908.183) -- 0:03:13

      Average standard deviation of split frequencies: 0.013982

      405500 -- (-915.388) (-914.813) (-911.325) [-912.237] * [-916.702] (-923.123) (-920.828) (-923.840) -- 0:03:14
      406000 -- (-918.333) (-913.418) (-922.465) [-913.252] * (-916.603) (-917.934) [-916.174] (-930.554) -- 0:03:14
      406500 -- (-916.197) (-929.339) [-908.134] (-936.177) * (-928.862) (-925.309) (-916.088) [-925.424] -- 0:03:14
      407000 -- (-917.209) (-920.645) [-917.144] (-932.540) * [-910.084] (-916.223) (-920.168) (-917.974) -- 0:03:13
      407500 -- (-922.751) (-936.020) [-920.981] (-910.576) * (-921.341) (-913.212) (-924.073) [-931.893] -- 0:03:13
      408000 -- (-921.308) (-921.675) [-920.803] (-915.527) * (-919.307) (-913.315) [-919.722] (-924.968) -- 0:03:12
      408500 -- (-937.836) [-907.470] (-907.383) (-921.510) * (-925.789) [-917.395] (-913.210) (-923.104) -- 0:03:14
      409000 -- [-912.244] (-917.307) (-927.448) (-917.908) * (-930.308) (-910.814) (-919.822) [-909.778] -- 0:03:13
      409500 -- [-906.446] (-921.376) (-911.747) (-929.103) * (-923.583) [-903.098] (-920.644) (-911.389) -- 0:03:13
      410000 -- (-927.850) (-923.183) [-905.430] (-913.283) * (-929.119) (-920.958) (-934.274) [-906.713] -- 0:03:12

      Average standard deviation of split frequencies: 0.013536

      410500 -- [-911.756] (-931.881) (-918.508) (-917.783) * [-906.113] (-921.769) (-914.123) (-912.159) -- 0:03:12
      411000 -- (-917.065) (-920.506) (-915.391) [-907.562] * (-917.867) (-916.110) (-929.607) [-924.369] -- 0:03:12
      411500 -- (-922.432) [-909.419] (-911.062) (-912.874) * (-917.121) (-923.781) (-924.496) [-912.532] -- 0:03:13
      412000 -- [-920.282] (-925.738) (-908.232) (-918.282) * (-923.779) (-929.957) [-920.227] (-920.376) -- 0:03:12
      412500 -- (-920.097) (-917.059) (-910.690) [-927.508] * [-916.479] (-922.407) (-923.340) (-921.153) -- 0:03:12
      413000 -- [-912.906] (-926.136) (-914.948) (-913.173) * (-915.615) (-917.977) (-913.457) [-913.442] -- 0:03:11
      413500 -- (-927.560) [-920.643] (-913.652) (-915.778) * (-924.104) (-927.345) (-915.174) [-912.164] -- 0:03:11
      414000 -- (-925.698) (-914.582) (-920.027) [-907.110] * (-939.520) (-924.470) (-920.539) [-915.119] -- 0:03:11
      414500 -- [-914.627] (-922.792) (-921.785) (-910.386) * (-916.398) (-922.324) [-916.435] (-930.707) -- 0:03:12
      415000 -- (-916.071) (-928.466) (-916.523) [-920.705] * [-911.118] (-924.728) (-910.053) (-929.923) -- 0:03:11

      Average standard deviation of split frequencies: 0.013409

      415500 -- (-931.503) (-935.931) (-918.490) [-905.240] * (-909.556) (-926.503) [-912.523] (-920.197) -- 0:03:11
      416000 -- [-906.017] (-925.357) (-930.259) (-914.924) * (-919.407) (-923.779) (-916.014) [-918.423] -- 0:03:10
      416500 -- (-916.610) (-924.760) [-914.601] (-919.026) * (-928.606) (-929.767) [-911.926] (-933.570) -- 0:03:10
      417000 -- (-917.877) (-944.223) (-911.299) [-918.182] * (-919.731) (-915.844) [-907.080] (-930.443) -- 0:03:10
      417500 -- (-939.473) (-944.212) (-921.027) [-928.013] * (-928.096) (-927.805) [-914.804] (-907.504) -- 0:03:11
      418000 -- (-924.438) (-929.943) (-920.706) [-912.610] * (-931.080) (-938.050) (-918.729) [-910.294] -- 0:03:10
      418500 -- (-925.036) [-920.955] (-913.524) (-926.468) * (-922.654) (-925.709) (-908.348) [-909.901] -- 0:03:10
      419000 -- [-910.537] (-918.427) (-919.440) (-937.495) * [-914.261] (-925.064) (-918.159) (-910.440) -- 0:03:09
      419500 -- (-912.998) (-935.900) (-906.521) [-906.255] * (-936.094) (-938.668) [-909.704] (-908.520) -- 0:03:09
      420000 -- [-909.699] (-928.214) (-915.280) (-920.722) * (-921.524) [-911.514] (-917.717) (-915.518) -- 0:03:09

      Average standard deviation of split frequencies: 0.014081

      420500 -- [-915.783] (-927.090) (-919.051) (-921.659) * [-925.589] (-931.556) (-910.690) (-915.939) -- 0:03:08
      421000 -- [-912.100] (-924.926) (-918.190) (-928.912) * (-917.485) (-923.197) [-904.752] (-918.568) -- 0:03:09
      421500 -- (-914.546) [-912.172] (-914.955) (-930.752) * (-913.456) (-939.021) (-910.412) [-919.955] -- 0:03:09
      422000 -- [-917.365] (-924.196) (-913.981) (-920.787) * [-913.131] (-926.281) (-914.847) (-920.009) -- 0:03:09
      422500 -- (-914.489) [-909.001] (-915.409) (-935.673) * (-941.405) (-920.226) [-908.362] (-927.367) -- 0:03:08
      423000 -- [-914.040] (-916.041) (-913.058) (-927.315) * [-918.501] (-926.716) (-924.140) (-912.059) -- 0:03:08
      423500 -- (-922.419) [-915.631] (-922.615) (-912.972) * (-918.573) [-928.350] (-914.030) (-919.951) -- 0:03:07
      424000 -- (-919.949) (-933.382) (-913.205) [-912.490] * (-918.062) (-932.954) (-917.455) [-914.546] -- 0:03:08
      424500 -- [-909.621] (-931.110) (-911.569) (-926.659) * (-919.036) (-919.606) (-924.322) [-905.779] -- 0:03:08
      425000 -- [-911.111] (-929.171) (-919.924) (-907.884) * (-927.960) [-913.843] (-919.826) (-914.100) -- 0:03:08

      Average standard deviation of split frequencies: 0.014193

      425500 -- (-922.879) (-931.539) (-910.431) [-903.515] * (-942.188) [-920.344] (-918.398) (-920.075) -- 0:03:07
      426000 -- (-931.754) (-918.494) [-921.159] (-912.357) * (-916.252) (-923.252) (-918.435) [-927.241] -- 0:03:07
      426500 -- (-929.904) [-911.884] (-922.428) (-916.679) * [-912.400] (-925.561) (-918.070) (-919.306) -- 0:03:06
      427000 -- (-914.807) [-905.838] (-916.554) (-941.155) * (-911.787) [-911.353] (-939.314) (-932.177) -- 0:03:07
      427500 -- (-923.328) (-921.834) (-922.328) [-915.630] * (-915.319) [-919.428] (-929.377) (-920.628) -- 0:03:07
      428000 -- (-927.531) [-914.766] (-915.870) (-918.119) * (-913.709) [-904.998] (-929.840) (-937.470) -- 0:03:07
      428500 -- (-929.552) (-935.602) (-924.718) [-908.604] * [-918.824] (-917.016) (-927.839) (-915.981) -- 0:03:06
      429000 -- [-921.703] (-935.373) (-934.394) (-914.391) * (-934.359) (-925.953) [-914.466] (-917.053) -- 0:03:06
      429500 -- (-924.776) (-932.832) (-924.149) [-910.237] * (-916.464) (-913.738) (-922.757) [-912.383] -- 0:03:05
      430000 -- (-912.948) (-918.418) (-917.593) [-908.597] * [-914.393] (-912.668) (-914.263) (-920.566) -- 0:03:06

      Average standard deviation of split frequencies: 0.014182

      430500 -- (-915.405) (-932.906) [-909.199] (-920.474) * (-925.147) (-911.190) (-911.898) [-914.748] -- 0:03:06
      431000 -- (-924.994) (-921.692) [-911.057] (-912.259) * (-928.211) (-913.625) [-914.534] (-922.932) -- 0:03:06
      431500 -- (-928.738) (-928.511) [-916.743] (-911.943) * [-922.513] (-907.389) (-929.495) (-922.769) -- 0:03:05
      432000 -- (-937.341) (-925.453) [-913.528] (-911.016) * [-911.369] (-926.138) (-916.639) (-921.841) -- 0:03:05
      432500 -- (-931.468) (-941.843) [-906.480] (-917.617) * (-921.091) (-910.205) [-913.389] (-922.514) -- 0:03:05
      433000 -- (-921.939) (-934.268) (-915.765) [-908.096] * (-916.984) [-907.576] (-916.556) (-927.144) -- 0:03:04
      433500 -- (-926.355) (-928.072) (-916.875) [-920.644] * (-918.597) [-899.937] (-918.108) (-924.602) -- 0:03:05
      434000 -- (-918.039) (-930.170) (-911.228) [-910.811] * (-928.403) [-909.088] (-915.610) (-922.850) -- 0:03:05
      434500 -- (-914.248) (-924.438) [-906.289] (-912.808) * (-929.466) (-917.766) (-927.149) [-908.123] -- 0:03:04
      435000 -- [-922.107] (-927.113) (-905.021) (-919.826) * (-920.886) (-917.071) [-916.263] (-926.429) -- 0:03:04

      Average standard deviation of split frequencies: 0.013065

      435500 -- [-924.797] (-925.212) (-906.245) (-911.328) * (-917.219) (-923.467) [-913.070] (-918.692) -- 0:03:04
      436000 -- (-916.147) (-922.979) [-912.435] (-919.739) * (-929.827) (-912.784) (-911.191) [-916.085] -- 0:03:03
      436500 -- (-914.987) (-928.525) [-921.222] (-918.827) * (-921.432) (-926.267) [-911.697] (-920.092) -- 0:03:04
      437000 -- (-929.469) (-936.176) [-914.885] (-924.601) * [-911.328] (-924.453) (-917.608) (-915.128) -- 0:03:04
      437500 -- (-916.672) (-927.233) (-923.049) [-914.553] * (-906.302) (-914.725) [-927.703] (-926.531) -- 0:03:03
      438000 -- [-918.492] (-937.939) (-926.625) (-913.309) * [-910.060] (-919.671) (-922.882) (-931.989) -- 0:03:03
      438500 -- [-906.649] (-933.653) (-930.786) (-922.092) * (-915.136) [-907.029] (-919.968) (-923.615) -- 0:03:03
      439000 -- (-916.528) (-944.137) (-916.134) [-913.409] * (-918.384) [-909.347] (-908.616) (-937.581) -- 0:03:02
      439500 -- (-922.694) (-922.238) [-914.453] (-920.375) * (-926.082) [-910.857] (-916.668) (-931.604) -- 0:03:03
      440000 -- (-943.888) (-910.310) [-903.898] (-924.989) * (-933.590) [-910.826] (-910.990) (-921.607) -- 0:03:03

      Average standard deviation of split frequencies: 0.013595

      440500 -- (-935.356) (-920.135) (-921.171) [-906.995] * (-932.768) [-910.905] (-918.450) (-929.137) -- 0:03:02
      441000 -- (-936.736) (-922.026) [-912.141] (-915.477) * (-925.974) (-926.586) [-912.399] (-927.533) -- 0:03:02
      441500 -- (-925.141) [-913.619] (-915.500) (-919.886) * (-917.348) (-913.204) (-918.463) [-913.554] -- 0:03:02
      442000 -- [-909.085] (-919.673) (-918.716) (-919.913) * (-917.881) (-915.455) [-907.342] (-922.872) -- 0:03:01
      442500 -- [-914.808] (-921.413) (-911.328) (-923.412) * (-934.400) (-923.409) [-912.746] (-931.594) -- 0:03:02
      443000 -- (-915.480) (-923.167) [-911.587] (-927.805) * (-919.484) (-915.933) (-911.967) [-903.795] -- 0:03:02
      443500 -- (-920.925) (-921.842) (-918.116) [-907.511] * [-915.875] (-912.941) (-916.820) (-915.286) -- 0:03:01
      444000 -- (-908.677) (-925.152) (-914.270) [-911.017] * (-919.805) (-931.557) (-916.960) [-910.292] -- 0:03:01
      444500 -- (-927.914) (-932.620) (-921.055) [-909.621] * (-921.413) (-929.917) (-926.554) [-910.261] -- 0:03:01
      445000 -- [-914.441] (-920.861) (-913.165) (-917.100) * (-922.134) (-908.121) (-916.961) [-908.871] -- 0:03:00

      Average standard deviation of split frequencies: 0.013961

      445500 -- (-913.738) [-913.120] (-923.858) (-916.496) * (-916.047) [-904.173] (-932.353) (-919.231) -- 0:03:01
      446000 -- (-919.538) [-915.879] (-934.433) (-920.925) * (-910.924) [-917.069] (-922.801) (-929.954) -- 0:03:01
      446500 -- [-921.744] (-908.491) (-926.760) (-920.514) * (-921.527) (-913.996) (-948.109) [-915.764] -- 0:03:00
      447000 -- (-935.842) [-915.006] (-917.110) (-914.740) * (-920.121) (-914.284) [-921.360] (-909.966) -- 0:03:00
      447500 -- (-920.734) [-912.898] (-911.993) (-919.954) * (-919.792) (-911.747) (-921.264) [-910.000] -- 0:03:00
      448000 -- (-922.125) (-906.012) [-916.787] (-924.254) * (-930.556) (-918.846) (-919.237) [-906.961] -- 0:02:59
      448500 -- (-914.544) (-923.869) (-922.658) [-920.125] * (-919.481) [-913.402] (-914.020) (-928.641) -- 0:03:00
      449000 -- [-908.677] (-913.818) (-923.280) (-917.880) * (-934.522) [-918.633] (-922.766) (-910.854) -- 0:03:00
      449500 -- (-924.417) [-905.958] (-921.230) (-927.118) * (-934.186) [-916.087] (-927.068) (-921.419) -- 0:03:00
      450000 -- (-939.410) (-915.964) [-919.113] (-936.471) * (-927.759) (-916.317) [-917.404] (-915.374) -- 0:02:59

      Average standard deviation of split frequencies: 0.013222

      450500 -- (-913.086) (-920.966) (-912.963) [-923.824] * (-937.387) (-911.227) [-918.313] (-934.325) -- 0:02:59
      451000 -- (-915.348) [-901.896] (-925.206) (-920.316) * (-940.525) [-912.425] (-914.882) (-913.170) -- 0:02:58
      451500 -- [-906.458] (-918.323) (-935.184) (-928.573) * (-915.552) [-918.721] (-920.857) (-932.414) -- 0:02:59
      452000 -- (-940.900) [-923.765] (-925.895) (-930.316) * [-910.921] (-933.669) (-908.410) (-925.817) -- 0:02:59
      452500 -- (-920.954) (-909.732) [-926.728] (-923.641) * (-907.858) (-921.303) [-915.301] (-921.149) -- 0:02:59
      453000 -- (-930.339) (-912.457) [-915.416] (-920.059) * [-913.052] (-923.905) (-929.194) (-949.786) -- 0:02:58
      453500 -- (-927.551) [-910.455] (-918.667) (-926.108) * [-913.254] (-920.748) (-931.829) (-935.940) -- 0:02:58
      454000 -- [-909.380] (-906.705) (-928.768) (-915.606) * [-926.516] (-918.212) (-940.761) (-924.986) -- 0:02:57
      454500 -- [-919.222] (-910.169) (-943.493) (-921.823) * (-917.265) (-918.462) (-917.251) [-908.438] -- 0:02:57
      455000 -- (-930.096) (-908.565) (-917.492) [-913.821] * (-929.243) (-919.956) (-914.735) [-923.809] -- 0:02:58

      Average standard deviation of split frequencies: 0.012048

      455500 -- (-932.540) [-907.640] (-921.009) (-912.497) * (-945.604) (-921.251) (-923.731) [-911.469] -- 0:02:58
      456000 -- (-926.062) (-918.634) [-918.413] (-918.965) * (-949.848) (-921.893) (-910.669) [-930.831] -- 0:02:57
      456500 -- (-931.444) [-909.829] (-917.708) (-922.436) * [-920.853] (-933.710) (-919.219) (-940.371) -- 0:02:57
      457000 -- (-929.159) (-925.087) (-923.836) [-905.607] * (-918.837) (-922.772) (-934.877) [-912.041] -- 0:02:57
      457500 -- (-920.066) (-917.927) (-925.704) [-916.549] * [-913.253] (-928.500) (-926.788) (-921.801) -- 0:02:56
      458000 -- (-927.909) [-917.561] (-929.220) (-913.094) * (-922.515) (-941.998) [-908.410] (-916.610) -- 0:02:57
      458500 -- (-922.068) [-921.890] (-916.776) (-936.306) * (-921.346) [-919.140] (-907.433) (-916.750) -- 0:02:57
      459000 -- (-905.163) (-931.551) (-923.930) [-908.441] * (-926.740) [-914.353] (-907.259) (-930.112) -- 0:02:56
      459500 -- (-924.015) (-931.110) (-925.129) [-915.832] * (-917.836) [-919.487] (-918.369) (-918.440) -- 0:02:56
      460000 -- (-904.583) (-913.721) [-916.899] (-922.362) * (-917.237) (-919.581) (-923.680) [-907.308] -- 0:02:56

      Average standard deviation of split frequencies: 0.012075

      460500 -- (-916.286) [-914.523] (-930.654) (-925.805) * (-915.708) (-927.817) (-926.781) [-925.108] -- 0:02:55
      461000 -- (-923.195) [-907.135] (-923.989) (-914.437) * (-921.209) (-918.571) [-921.509] (-914.754) -- 0:02:56
      461500 -- (-916.248) [-909.779] (-906.563) (-921.471) * [-911.727] (-915.417) (-915.096) (-907.392) -- 0:02:56
      462000 -- (-922.068) (-912.600) [-905.827] (-929.179) * (-923.281) [-920.194] (-932.019) (-927.008) -- 0:02:55
      462500 -- [-914.729] (-908.115) (-923.699) (-927.941) * [-917.398] (-918.148) (-910.625) (-911.571) -- 0:02:55
      463000 -- (-915.165) [-914.707] (-921.542) (-930.755) * [-916.527] (-918.050) (-911.114) (-927.679) -- 0:02:55
      463500 -- (-917.279) [-915.915] (-928.185) (-944.939) * (-921.781) (-916.991) [-917.329] (-924.320) -- 0:02:54
      464000 -- (-934.489) (-919.996) (-921.343) [-921.824] * (-918.424) [-910.370] (-914.016) (-927.217) -- 0:02:55
      464500 -- (-917.540) [-910.102] (-918.488) (-921.411) * (-920.049) [-910.030] (-916.078) (-925.416) -- 0:02:55
      465000 -- (-927.446) [-903.706] (-930.597) (-916.244) * (-912.941) [-910.671] (-916.798) (-913.124) -- 0:02:54

      Average standard deviation of split frequencies: 0.012373

      465500 -- (-930.627) [-924.063] (-920.239) (-908.471) * [-916.843] (-918.090) (-927.775) (-932.197) -- 0:02:54
      466000 -- (-917.187) (-914.338) (-920.243) [-906.188] * (-918.656) [-922.539] (-936.342) (-917.442) -- 0:02:54
      466500 -- (-924.609) [-915.046] (-910.687) (-917.453) * (-917.253) (-921.722) [-931.084] (-917.405) -- 0:02:54
      467000 -- (-925.276) (-904.727) [-913.947] (-907.190) * (-909.696) [-918.414] (-935.208) (-911.620) -- 0:02:54
      467500 -- (-934.394) (-919.349) [-911.984] (-909.765) * (-915.084) (-916.619) (-923.996) [-920.046] -- 0:02:54
      468000 -- (-933.611) (-924.777) (-926.667) [-906.311] * (-918.082) (-925.110) [-915.572] (-912.351) -- 0:02:53
      468500 -- (-917.082) (-919.705) (-921.833) [-911.205] * (-917.881) (-932.034) (-933.672) [-912.673] -- 0:02:53
      469000 -- (-928.216) (-915.454) (-921.129) [-922.644] * (-922.599) (-924.987) (-939.063) [-909.458] -- 0:02:53
      469500 -- [-917.141] (-921.801) (-923.203) (-917.117) * [-917.655] (-909.366) (-932.916) (-910.826) -- 0:02:54
      470000 -- (-909.058) (-915.858) [-919.961] (-919.997) * (-934.974) (-913.882) [-920.024] (-918.640) -- 0:02:53

      Average standard deviation of split frequencies: 0.011634

      470500 -- (-910.981) [-913.568] (-912.494) (-919.153) * (-944.036) (-919.194) [-918.696] (-921.459) -- 0:02:53
      471000 -- (-909.825) (-924.306) [-914.880] (-913.745) * (-920.790) [-913.800] (-925.257) (-919.208) -- 0:02:52
      471500 -- [-914.895] (-932.771) (-933.988) (-921.281) * (-917.540) [-909.900] (-923.344) (-914.979) -- 0:02:52
      472000 -- (-916.031) [-928.517] (-912.099) (-917.875) * (-926.064) (-923.897) [-921.083] (-914.108) -- 0:02:52
      472500 -- (-915.960) [-913.442] (-918.086) (-923.463) * (-927.887) (-928.821) [-911.495] (-923.770) -- 0:02:53
      473000 -- [-907.200] (-926.305) (-914.313) (-925.135) * [-920.917] (-934.996) (-917.478) (-920.952) -- 0:02:52
      473500 -- (-932.898) [-911.845] (-917.403) (-921.650) * [-911.672] (-915.641) (-922.892) (-929.802) -- 0:02:52
      474000 -- (-920.046) (-913.909) (-910.725) [-913.712] * [-913.297] (-917.727) (-934.738) (-905.875) -- 0:02:52
      474500 -- (-923.591) (-919.900) (-911.827) [-908.876] * (-915.993) (-925.984) [-913.335] (-926.846) -- 0:02:51
      475000 -- (-930.662) (-922.558) [-915.354] (-911.653) * (-913.727) (-922.079) [-916.162] (-914.000) -- 0:02:51

      Average standard deviation of split frequencies: 0.011131

      475500 -- (-918.528) (-929.732) [-918.614] (-907.143) * (-913.855) (-936.234) (-925.826) [-907.588] -- 0:02:52
      476000 -- (-912.926) (-921.055) (-920.919) [-910.804] * [-905.133] (-920.942) (-910.177) (-916.640) -- 0:02:51
      476500 -- (-918.827) (-917.946) (-921.009) [-913.847] * (-942.506) (-919.294) [-912.246] (-908.439) -- 0:02:51
      477000 -- (-906.481) (-929.792) [-911.804] (-923.777) * (-918.958) (-930.255) [-909.522] (-916.327) -- 0:02:51
      477500 -- (-915.646) (-929.787) (-908.690) [-906.075] * (-929.920) (-923.982) [-919.798] (-912.276) -- 0:02:50
      478000 -- (-913.573) (-941.085) [-920.613] (-906.938) * (-929.465) (-925.496) (-928.830) [-905.050] -- 0:02:50
      478500 -- (-918.390) (-943.291) [-910.957] (-915.391) * [-922.282] (-915.734) (-916.883) (-922.790) -- 0:02:51
      479000 -- [-910.309] (-930.849) (-927.619) (-921.879) * (-918.912) [-915.625] (-919.275) (-922.787) -- 0:02:50
      479500 -- [-910.957] (-931.479) (-908.131) (-910.263) * (-918.335) (-917.863) [-918.404] (-921.250) -- 0:02:50
      480000 -- [-906.912] (-948.994) (-907.668) (-924.131) * (-913.377) (-922.434) (-907.338) [-924.425] -- 0:02:50

      Average standard deviation of split frequencies: 0.011259

      480500 -- [-913.305] (-945.395) (-923.733) (-916.643) * (-911.352) (-919.256) (-921.221) [-917.138] -- 0:02:49
      481000 -- (-917.316) (-950.739) (-910.453) [-910.731] * [-925.535] (-921.372) (-924.684) (-929.904) -- 0:02:49
      481500 -- [-921.903] (-940.121) (-909.603) (-923.622) * (-911.862) (-916.885) [-914.639] (-920.394) -- 0:02:50
      482000 -- [-912.184] (-925.105) (-915.399) (-920.361) * (-929.965) (-926.253) (-924.285) [-910.902] -- 0:02:49
      482500 -- (-923.008) (-924.693) [-910.572] (-923.424) * (-932.696) [-908.487] (-928.412) (-922.979) -- 0:02:49
      483000 -- (-927.397) (-936.107) [-920.695] (-924.849) * (-931.521) (-913.777) [-915.994] (-929.182) -- 0:02:49
      483500 -- (-909.154) [-923.721] (-928.659) (-929.351) * [-912.774] (-928.582) (-919.669) (-931.390) -- 0:02:48
      484000 -- (-906.024) (-917.150) (-923.546) [-915.413] * (-920.055) (-922.984) [-920.130] (-945.185) -- 0:02:48
      484500 -- (-917.164) [-907.162] (-928.943) (-927.740) * (-916.657) [-918.063] (-924.026) (-929.424) -- 0:02:49
      485000 -- (-925.588) [-903.724] (-922.452) (-921.151) * [-918.891] (-913.126) (-921.273) (-949.605) -- 0:02:48

      Average standard deviation of split frequencies: 0.010670

      485500 -- (-915.058) (-930.546) [-917.171] (-919.208) * (-922.938) (-929.008) [-914.439] (-949.152) -- 0:02:48
      486000 -- [-920.942] (-919.038) (-931.063) (-923.311) * (-922.409) (-915.493) [-911.500] (-933.591) -- 0:02:48
      486500 -- [-917.005] (-924.014) (-918.096) (-917.476) * (-926.549) (-908.103) [-916.615] (-941.553) -- 0:02:47
      487000 -- (-909.897) (-925.011) (-913.276) [-914.227] * (-920.356) [-905.203] (-915.556) (-931.355) -- 0:02:47
      487500 -- (-930.626) (-908.483) (-911.141) [-925.986] * (-908.854) [-919.917] (-918.556) (-940.345) -- 0:02:48
      488000 -- [-928.751] (-909.148) (-923.465) (-925.400) * [-911.678] (-917.043) (-932.162) (-939.552) -- 0:02:47
      488500 -- (-918.582) (-912.160) [-913.463] (-935.554) * (-918.191) [-923.543] (-939.421) (-937.257) -- 0:02:47
      489000 -- [-912.641] (-918.497) (-916.731) (-936.912) * (-910.369) (-920.415) [-912.973] (-936.515) -- 0:02:47
      489500 -- (-923.373) (-919.864) (-915.132) [-916.560] * [-905.109] (-913.154) (-945.633) (-935.008) -- 0:02:46
      490000 -- (-918.651) [-921.883] (-934.778) (-913.523) * (-909.264) (-906.633) [-914.945] (-937.281) -- 0:02:46

      Average standard deviation of split frequencies: 0.010299

      490500 -- (-908.451) (-920.846) (-924.529) [-910.796] * (-942.811) (-919.205) (-917.645) [-922.403] -- 0:02:47
      491000 -- (-910.690) [-912.199] (-927.266) (-912.281) * [-917.083] (-915.001) (-910.908) (-923.074) -- 0:02:46
      491500 -- [-905.643] (-926.091) (-917.471) (-909.290) * (-933.809) [-914.362] (-922.031) (-916.509) -- 0:02:46
      492000 -- (-911.627) (-914.434) (-923.682) [-905.068] * (-916.852) [-914.510] (-918.748) (-918.996) -- 0:02:46
      492500 -- [-914.037] (-931.076) (-923.325) (-926.763) * (-933.192) [-921.830] (-938.889) (-916.844) -- 0:02:45
      493000 -- (-930.482) (-924.146) (-919.530) [-913.964] * (-913.461) [-918.611] (-921.826) (-922.002) -- 0:02:45
      493500 -- (-922.852) (-938.087) (-927.621) [-918.273] * (-911.824) [-919.642] (-925.747) (-917.141) -- 0:02:46
      494000 -- (-930.695) [-912.048] (-936.687) (-926.659) * (-920.931) (-923.930) [-922.673] (-917.781) -- 0:02:45
      494500 -- [-911.140] (-930.307) (-924.441) (-930.508) * (-923.305) (-914.996) [-922.773] (-917.293) -- 0:02:45
      495000 -- (-915.796) (-929.238) [-917.646] (-929.204) * [-913.645] (-928.516) (-912.184) (-923.791) -- 0:02:45

      Average standard deviation of split frequencies: 0.009694

      495500 -- [-918.923] (-918.036) (-938.341) (-929.837) * (-920.078) (-918.875) (-926.974) [-905.943] -- 0:02:44
      496000 -- [-925.695] (-920.814) (-945.179) (-933.593) * (-937.531) [-912.253] (-919.141) (-908.402) -- 0:02:44
      496500 -- (-918.599) [-909.699] (-923.089) (-934.817) * (-923.739) [-913.994] (-917.069) (-920.818) -- 0:02:45
      497000 -- (-916.945) (-922.257) [-924.011] (-920.968) * (-917.321) [-911.456] (-924.137) (-924.480) -- 0:02:44
      497500 -- (-915.784) (-923.007) [-919.833] (-927.401) * (-916.031) (-922.410) [-920.460] (-916.437) -- 0:02:44
      498000 -- (-915.872) (-935.193) (-920.551) [-919.195] * (-936.648) (-938.145) (-918.497) [-918.775] -- 0:02:44
      498500 -- [-913.995] (-933.852) (-923.959) (-918.877) * (-934.665) [-920.456] (-920.224) (-933.307) -- 0:02:43
      499000 -- (-921.025) (-917.759) (-915.535) [-917.408] * (-918.583) (-917.374) [-909.638] (-923.683) -- 0:02:43
      499500 -- (-915.139) (-923.428) [-910.174] (-920.732) * (-925.367) [-922.593] (-920.533) (-919.523) -- 0:02:44
      500000 -- (-936.035) (-923.134) (-916.312) [-910.072] * (-925.238) (-918.755) [-919.228] (-920.953) -- 0:02:44

      Average standard deviation of split frequencies: 0.009642

      500500 -- [-925.917] (-925.423) (-917.004) (-912.521) * [-910.825] (-913.462) (-926.926) (-919.019) -- 0:02:43
      501000 -- (-918.933) [-906.875] (-911.582) (-911.571) * (-938.232) [-918.277] (-917.031) (-933.653) -- 0:02:43
      501500 -- (-925.162) (-920.727) (-916.674) [-908.937] * (-925.129) (-917.915) [-915.064] (-927.078) -- 0:02:43
      502000 -- (-924.383) (-930.805) (-915.654) [-908.099] * (-911.626) (-918.055) [-908.863] (-928.068) -- 0:02:42
      502500 -- (-929.774) (-914.393) [-916.788] (-903.640) * (-918.298) [-909.876] (-923.104) (-927.888) -- 0:02:43
      503000 -- (-915.480) [-911.697] (-926.876) (-918.764) * (-920.520) (-923.105) [-917.388] (-922.476) -- 0:02:43
      503500 -- (-921.946) [-922.614] (-922.843) (-920.457) * (-921.274) [-906.472] (-923.274) (-920.042) -- 0:02:42
      504000 -- (-917.271) (-935.312) [-916.876] (-922.266) * (-928.745) [-918.426] (-922.739) (-929.089) -- 0:02:42
      504500 -- (-920.201) (-948.827) (-912.951) [-914.934] * (-923.391) (-937.662) [-908.134] (-923.295) -- 0:02:42
      505000 -- (-923.057) (-924.432) (-914.624) [-921.047] * (-920.445) (-936.934) (-917.704) [-916.832] -- 0:02:41

      Average standard deviation of split frequencies: 0.009465

      505500 -- (-936.170) (-914.619) [-913.748] (-914.945) * (-937.873) [-911.727] (-923.545) (-914.093) -- 0:02:42
      506000 -- (-927.162) (-917.656) [-923.433] (-910.929) * (-931.203) (-928.281) (-915.705) [-918.095] -- 0:02:42
      506500 -- [-910.359] (-916.258) (-924.551) (-909.282) * (-920.835) [-909.638] (-918.773) (-930.864) -- 0:02:41
      507000 -- (-920.678) (-913.717) (-917.519) [-909.761] * (-941.026) (-923.730) [-921.541] (-918.402) -- 0:02:41
      507500 -- (-918.067) (-924.223) [-919.257] (-918.597) * (-915.002) (-925.644) (-932.187) [-906.699] -- 0:02:41
      508000 -- (-920.145) [-919.011] (-921.255) (-914.670) * (-918.587) (-920.017) (-911.068) [-910.344] -- 0:02:40
      508500 -- (-927.085) (-908.173) [-929.929] (-909.540) * (-932.170) (-912.513) [-910.082] (-925.522) -- 0:02:41
      509000 -- [-914.589] (-931.666) (-920.250) (-920.778) * (-918.682) [-908.220] (-927.032) (-926.634) -- 0:02:41
      509500 -- (-911.286) (-920.528) (-916.027) [-908.859] * (-915.516) [-921.314] (-922.173) (-936.424) -- 0:02:40
      510000 -- (-915.782) (-923.377) [-907.336] (-926.911) * [-909.042] (-921.809) (-925.780) (-928.270) -- 0:02:40

      Average standard deviation of split frequencies: 0.009416

      510500 -- (-923.102) [-919.286] (-913.438) (-927.324) * (-909.127) (-920.152) [-914.637] (-915.125) -- 0:02:40
      511000 -- (-917.164) (-923.904) [-909.915] (-935.803) * (-916.118) (-928.638) [-910.047] (-932.050) -- 0:02:39
      511500 -- (-918.043) (-911.015) (-926.377) [-932.558] * [-908.931] (-920.238) (-929.408) (-930.904) -- 0:02:40
      512000 -- (-915.333) [-925.126] (-926.068) (-930.921) * [-913.352] (-919.850) (-932.052) (-922.597) -- 0:02:40
      512500 -- (-923.077) [-919.499] (-925.498) (-913.536) * [-918.255] (-915.003) (-919.796) (-921.657) -- 0:02:39
      513000 -- [-909.459] (-917.499) (-919.199) (-928.160) * (-917.352) [-910.023] (-927.955) (-942.069) -- 0:02:39
      513500 -- (-914.715) [-897.742] (-936.989) (-926.290) * (-922.994) (-915.350) (-921.249) [-929.765] -- 0:02:39
      514000 -- (-916.424) (-913.458) [-911.778] (-935.634) * (-925.382) [-930.721] (-915.910) (-923.801) -- 0:02:38
      514500 -- (-936.967) [-901.582] (-910.397) (-918.215) * (-912.776) [-924.712] (-922.399) (-932.803) -- 0:02:39
      515000 -- (-921.126) [-910.460] (-928.652) (-927.978) * [-913.027] (-934.377) (-908.075) (-917.367) -- 0:02:39

      Average standard deviation of split frequencies: 0.010164

      515500 -- (-936.557) (-913.338) [-919.994] (-928.194) * [-912.779] (-926.689) (-915.020) (-926.651) -- 0:02:38
      516000 -- [-906.354] (-917.672) (-926.812) (-919.488) * (-922.800) [-913.316] (-924.902) (-923.790) -- 0:02:38
      516500 -- [-906.473] (-934.100) (-922.594) (-921.804) * [-915.038] (-917.239) (-911.705) (-930.047) -- 0:02:38
      517000 -- (-926.746) (-929.773) (-942.972) [-915.382] * (-934.245) (-914.148) [-904.829] (-919.692) -- 0:02:37
      517500 -- (-923.259) [-909.418] (-912.560) (-934.874) * (-924.932) [-912.631] (-918.869) (-929.135) -- 0:02:38
      518000 -- (-913.681) (-915.546) [-917.332] (-925.219) * [-910.071] (-925.739) (-913.804) (-935.239) -- 0:02:38
      518500 -- (-920.121) (-916.639) [-919.480] (-925.655) * (-919.888) (-926.121) (-919.393) [-914.243] -- 0:02:37
      519000 -- (-927.249) (-928.996) [-921.507] (-925.754) * (-918.967) (-921.922) [-914.749] (-922.917) -- 0:02:37
      519500 -- (-920.159) (-914.849) [-908.357] (-927.657) * (-916.912) (-922.923) (-915.400) [-916.575] -- 0:02:37
      520000 -- (-928.561) [-911.798] (-914.052) (-926.203) * (-930.201) (-925.280) [-905.738] (-915.500) -- 0:02:36

      Average standard deviation of split frequencies: 0.010432

      520500 -- [-912.677] (-917.735) (-917.136) (-919.217) * (-943.209) (-911.141) [-909.255] (-914.287) -- 0:02:37
      521000 -- (-931.649) (-918.807) [-908.707] (-922.119) * (-931.870) (-940.177) (-917.183) [-908.777] -- 0:02:37
      521500 -- (-922.879) (-913.991) [-915.100] (-931.569) * (-936.995) (-929.995) [-911.108] (-919.287) -- 0:02:36
      522000 -- (-917.896) (-929.000) (-917.526) [-921.327] * (-924.042) (-927.159) [-905.403] (-909.342) -- 0:02:36
      522500 -- [-915.538] (-911.699) (-919.689) (-917.710) * (-948.446) (-915.418) [-909.663] (-909.667) -- 0:02:36
      523000 -- [-924.369] (-926.174) (-918.032) (-918.010) * (-927.719) (-913.563) [-913.571] (-916.811) -- 0:02:36
      523500 -- (-945.063) [-920.106] (-919.119) (-909.106) * (-920.516) [-902.975] (-933.539) (-934.166) -- 0:02:36
      524000 -- (-923.308) (-915.385) (-920.286) [-906.943] * (-928.179) (-918.812) [-912.300] (-918.042) -- 0:02:36
      524500 -- (-919.432) (-921.299) (-924.601) [-918.883] * [-912.405] (-940.761) (-928.664) (-917.097) -- 0:02:35
      525000 -- (-934.565) [-912.076] (-921.888) (-907.190) * [-910.564] (-917.394) (-919.267) (-917.344) -- 0:02:35

      Average standard deviation of split frequencies: 0.010269

      525500 -- (-925.056) (-919.998) (-918.426) [-912.570] * (-916.893) [-919.141] (-932.729) (-913.163) -- 0:02:35
      526000 -- (-924.810) [-914.391] (-923.450) (-910.000) * (-918.299) [-913.797] (-921.611) (-922.933) -- 0:02:34
      526500 -- (-927.741) (-925.076) (-932.690) [-914.846] * (-911.080) [-911.287] (-919.540) (-926.201) -- 0:02:35
      527000 -- (-921.405) (-915.500) [-920.322] (-937.840) * [-908.140] (-917.157) (-912.208) (-927.871) -- 0:02:35
      527500 -- (-921.234) [-910.523] (-915.019) (-924.800) * [-909.533] (-934.311) (-922.392) (-927.577) -- 0:02:34
      528000 -- (-934.243) (-910.261) [-907.144] (-921.482) * (-922.971) [-924.587] (-916.450) (-913.995) -- 0:02:34
      528500 -- (-918.799) (-910.742) (-905.744) [-917.858] * (-915.769) (-920.611) [-910.471] (-921.398) -- 0:02:34
      529000 -- (-926.270) (-919.805) [-909.499] (-918.800) * [-907.794] (-912.102) (-917.241) (-931.289) -- 0:02:34
      529500 -- (-915.201) (-928.298) [-927.286] (-913.837) * (-911.771) (-919.501) (-921.520) [-907.299] -- 0:02:34
      530000 -- (-924.255) (-916.104) (-929.742) [-926.980] * (-918.092) [-919.434] (-934.256) (-913.077) -- 0:02:34

      Average standard deviation of split frequencies: 0.010438

      530500 -- (-910.266) (-914.179) (-918.167) [-927.740] * (-930.616) (-917.072) (-913.461) [-912.231] -- 0:02:33
      531000 -- [-921.609] (-934.329) (-930.018) (-926.871) * [-913.829] (-915.768) (-911.583) (-930.675) -- 0:02:33
      531500 -- (-938.731) (-919.508) [-912.635] (-931.439) * [-914.164] (-925.166) (-921.320) (-929.615) -- 0:02:33
      532000 -- [-914.367] (-915.419) (-911.490) (-918.315) * (-911.210) [-907.753] (-931.374) (-920.372) -- 0:02:33
      532500 -- (-940.471) (-916.994) (-907.993) [-913.698] * (-918.187) (-922.269) (-916.852) [-915.055] -- 0:02:33
      533000 -- (-929.522) (-916.584) [-905.326] (-920.436) * [-922.343] (-922.390) (-903.258) (-921.984) -- 0:02:33
      533500 -- (-923.448) [-909.783] (-927.780) (-923.895) * (-922.793) (-934.090) (-913.558) [-916.961] -- 0:02:33
      534000 -- (-912.267) (-914.375) (-915.257) [-920.595] * (-921.245) (-926.338) [-910.928] (-925.128) -- 0:02:32
      534500 -- [-910.774] (-913.529) (-913.504) (-919.844) * (-916.789) [-917.146] (-923.614) (-933.248) -- 0:02:32
      535000 -- [-924.906] (-922.199) (-929.142) (-922.884) * (-919.949) [-905.646] (-926.720) (-926.352) -- 0:02:32

      Average standard deviation of split frequencies: 0.011280

      535500 -- (-923.904) (-922.047) [-915.609] (-927.989) * (-917.077) [-914.050] (-920.175) (-928.046) -- 0:02:32
      536000 -- (-923.344) (-909.051) (-918.830) [-916.508] * (-910.577) (-934.613) [-917.933] (-919.072) -- 0:02:32
      536500 -- (-919.692) (-928.298) [-910.302] (-915.910) * (-918.146) (-929.828) [-905.460] (-931.562) -- 0:02:32
      537000 -- (-919.836) (-916.223) [-919.391] (-909.778) * (-931.837) (-941.220) [-905.838] (-916.680) -- 0:02:31
      537500 -- (-928.098) [-921.382] (-914.279) (-917.701) * (-921.331) (-926.813) [-913.128] (-914.750) -- 0:02:31
      538000 -- (-921.537) (-913.668) (-919.968) [-912.199] * [-917.989] (-925.432) (-908.661) (-940.220) -- 0:02:31
      538500 -- (-922.154) (-927.477) [-919.194] (-916.442) * (-917.906) (-925.818) [-909.766] (-928.617) -- 0:02:31
      539000 -- (-929.559) (-915.732) (-926.448) [-904.053] * (-917.044) (-922.773) (-916.588) [-917.192] -- 0:02:31
      539500 -- [-907.460] (-920.764) (-909.634) (-926.712) * (-918.168) [-924.743] (-910.931) (-929.434) -- 0:02:31
      540000 -- (-920.896) (-914.413) [-912.995] (-928.765) * [-921.885] (-934.777) (-918.295) (-930.730) -- 0:02:30

      Average standard deviation of split frequencies: 0.011044

      540500 -- [-913.958] (-933.937) (-929.374) (-939.707) * (-918.221) (-924.446) [-920.920] (-917.847) -- 0:02:30
      541000 -- [-902.298] (-923.322) (-908.648) (-924.861) * [-908.238] (-908.085) (-912.991) (-917.875) -- 0:02:30
      541500 -- (-915.622) (-922.762) [-918.156] (-929.076) * [-907.677] (-912.648) (-915.993) (-920.455) -- 0:02:30
      542000 -- [-918.214] (-917.297) (-919.974) (-925.305) * (-912.451) (-931.832) [-917.245] (-931.720) -- 0:02:30
      542500 -- (-925.096) [-914.446] (-904.796) (-930.220) * [-916.990] (-924.883) (-912.047) (-927.960) -- 0:02:30
      543000 -- (-920.735) [-911.681] (-921.039) (-948.650) * (-920.331) (-921.696) (-910.195) [-920.433] -- 0:02:29
      543500 -- (-922.357) [-924.856] (-921.258) (-919.748) * (-925.333) (-926.562) [-918.194] (-925.935) -- 0:02:29
      544000 -- (-915.797) [-911.110] (-920.992) (-921.900) * [-910.690] (-915.919) (-926.095) (-915.966) -- 0:02:30
      544500 -- [-918.660] (-918.614) (-912.886) (-917.255) * [-906.604] (-934.592) (-917.973) (-922.673) -- 0:02:29
      545000 -- (-913.093) [-908.504] (-922.881) (-913.174) * (-916.808) (-921.015) (-916.592) [-915.364] -- 0:02:29

      Average standard deviation of split frequencies: 0.011116

      545500 -- (-916.577) [-908.526] (-931.437) (-915.574) * [-911.105] (-913.862) (-927.192) (-931.327) -- 0:02:29
      546000 -- (-927.345) [-912.460] (-943.039) (-913.171) * [-914.428] (-927.019) (-915.728) (-927.525) -- 0:02:28
      546500 -- (-910.431) (-911.590) (-923.718) [-917.670] * (-920.434) (-931.758) [-904.861] (-932.277) -- 0:02:28
      547000 -- (-927.573) [-914.039] (-923.903) (-923.103) * [-912.791] (-934.113) (-908.416) (-921.668) -- 0:02:28
      547500 -- (-916.108) (-918.156) (-922.860) [-916.425] * (-915.850) (-915.972) [-910.697] (-933.550) -- 0:02:28
      548000 -- [-916.459] (-934.037) (-925.271) (-920.229) * (-924.431) [-918.206] (-914.660) (-921.979) -- 0:02:28
      548500 -- [-915.346] (-928.381) (-925.033) (-907.493) * (-922.955) [-910.639] (-918.360) (-925.386) -- 0:02:28
      549000 -- (-926.929) (-917.351) [-911.826] (-916.689) * (-921.656) [-909.180] (-925.947) (-927.923) -- 0:02:27
      549500 -- (-913.351) (-923.914) [-929.977] (-930.810) * (-921.519) (-916.530) [-914.954] (-930.142) -- 0:02:27
      550000 -- (-912.717) [-912.272] (-914.400) (-922.109) * (-906.957) [-911.697] (-929.570) (-916.993) -- 0:02:27

      Average standard deviation of split frequencies: 0.010915

      550500 -- (-912.193) [-912.248] (-913.383) (-916.716) * [-914.626] (-927.438) (-938.831) (-916.564) -- 0:02:27
      551000 -- [-901.036] (-913.087) (-911.303) (-922.855) * [-910.704] (-917.050) (-920.327) (-911.823) -- 0:02:27
      551500 -- [-919.332] (-919.005) (-925.435) (-923.115) * [-908.959] (-916.049) (-942.289) (-905.882) -- 0:02:27
      552000 -- (-918.583) (-905.448) [-911.594] (-913.191) * (-917.347) [-907.228] (-925.573) (-934.796) -- 0:02:26
      552500 -- (-939.007) (-914.916) (-921.989) [-910.273] * (-927.351) [-906.076] (-908.666) (-915.674) -- 0:02:26
      553000 -- (-923.894) (-941.372) [-919.714] (-915.501) * (-915.405) [-914.394] (-922.021) (-919.687) -- 0:02:26
      553500 -- [-918.373] (-943.401) (-919.891) (-916.069) * (-925.126) (-924.850) (-911.515) [-910.508] -- 0:02:26
      554000 -- (-921.614) (-938.082) (-912.293) [-916.914] * (-912.845) (-911.645) [-906.578] (-916.546) -- 0:02:26
      554500 -- (-931.530) (-922.745) (-927.020) [-911.418] * (-934.683) [-908.855] (-916.174) (-906.336) -- 0:02:26
      555000 -- (-929.687) [-908.390] (-913.622) (-911.860) * (-919.183) (-916.736) (-923.564) [-900.468] -- 0:02:25

      Average standard deviation of split frequencies: 0.011133

      555500 -- (-939.219) [-909.409] (-930.549) (-926.016) * (-923.175) [-920.354] (-917.752) (-918.842) -- 0:02:25
      556000 -- (-928.146) (-910.387) [-910.376] (-920.879) * [-910.702] (-909.592) (-917.611) (-921.245) -- 0:02:25
      556500 -- (-932.005) (-921.477) [-912.144] (-924.542) * [-907.705] (-926.819) (-913.332) (-916.324) -- 0:02:25
      557000 -- [-912.236] (-930.953) (-920.526) (-918.642) * (-916.896) (-928.180) (-923.580) [-927.212] -- 0:02:25
      557500 -- (-917.827) [-911.789] (-913.423) (-920.831) * (-910.927) (-917.350) (-929.352) [-909.487] -- 0:02:25
      558000 -- (-927.533) (-918.100) [-915.808] (-927.042) * (-906.643) (-927.441) (-914.935) [-924.786] -- 0:02:24
      558500 -- (-929.497) (-927.034) [-911.754] (-924.034) * (-917.225) [-916.594] (-924.114) (-907.097) -- 0:02:24
      559000 -- [-924.596] (-929.755) (-916.342) (-935.401) * (-924.289) (-916.508) (-926.027) [-915.588] -- 0:02:24
      559500 -- (-934.718) (-930.667) (-924.559) [-925.350] * (-936.118) (-913.971) (-910.999) [-923.706] -- 0:02:24
      560000 -- [-920.216] (-931.943) (-911.427) (-942.094) * (-931.828) [-911.093] (-917.217) (-913.185) -- 0:02:24

      Average standard deviation of split frequencies: 0.011113

      560500 -- (-915.203) (-931.105) (-945.763) [-917.705] * (-926.246) (-903.714) (-919.456) [-913.117] -- 0:02:24
      561000 -- [-917.095] (-918.018) (-931.722) (-920.697) * (-908.903) (-905.373) (-945.654) [-914.618] -- 0:02:23
      561500 -- [-913.783] (-926.365) (-908.632) (-936.037) * (-924.432) [-905.880] (-939.561) (-940.362) -- 0:02:23
      562000 -- [-920.075] (-921.392) (-927.701) (-916.637) * [-913.017] (-924.235) (-923.641) (-924.613) -- 0:02:23
      562500 -- [-907.736] (-939.599) (-917.810) (-920.485) * (-919.999) (-918.401) [-922.388] (-924.307) -- 0:02:23
      563000 -- [-907.926] (-939.765) (-916.921) (-910.914) * (-929.376) (-914.852) [-907.128] (-915.658) -- 0:02:23
      563500 -- [-919.990] (-932.581) (-919.759) (-919.415) * [-905.775] (-909.418) (-937.479) (-919.765) -- 0:02:23
      564000 -- (-925.436) (-924.868) (-917.267) [-910.850] * (-922.274) (-916.423) (-917.625) [-915.785] -- 0:02:23
      564500 -- (-932.492) (-917.451) (-906.251) [-908.097] * (-931.555) (-913.187) (-924.195) [-907.567] -- 0:02:22
      565000 -- (-927.326) (-926.705) [-910.232] (-922.454) * (-931.411) [-917.734] (-929.961) (-917.797) -- 0:02:22

      Average standard deviation of split frequencies: 0.011070

      565500 -- (-920.284) (-927.050) [-917.403] (-930.574) * [-916.353] (-935.531) (-925.960) (-908.608) -- 0:02:22
      566000 -- [-914.387] (-922.732) (-915.616) (-921.275) * (-926.759) (-917.653) (-916.713) [-920.547] -- 0:02:22
      566500 -- (-922.591) (-923.168) (-908.011) [-921.636] * (-926.744) (-918.429) (-917.251) [-911.366] -- 0:02:22
      567000 -- (-908.257) (-931.532) (-918.081) [-908.182] * (-921.941) (-916.426) [-908.168] (-919.685) -- 0:02:22
      567500 -- (-918.409) (-909.872) (-911.867) [-915.723] * [-920.245] (-912.266) (-926.328) (-921.486) -- 0:02:21
      568000 -- (-911.375) (-929.034) (-927.682) [-914.350] * (-931.680) (-916.163) (-925.748) [-911.482] -- 0:02:21
      568500 -- (-904.771) [-916.293] (-926.879) (-922.435) * [-908.016] (-912.855) (-916.768) (-931.160) -- 0:02:21
      569000 -- (-916.908) (-915.808) [-913.961] (-910.086) * (-911.763) [-921.433] (-947.361) (-916.166) -- 0:02:21
      569500 -- (-928.730) (-945.248) [-930.564] (-911.770) * [-920.250] (-920.527) (-925.246) (-918.724) -- 0:02:21
      570000 -- [-912.741] (-935.236) (-924.063) (-914.824) * (-914.704) (-923.759) [-912.593] (-917.742) -- 0:02:21

      Average standard deviation of split frequencies: 0.010739

      570500 -- (-923.104) (-946.080) [-920.600] (-916.460) * [-902.968] (-915.223) (-926.980) (-941.905) -- 0:02:20
      571000 -- (-915.753) (-912.701) [-911.811] (-921.468) * [-911.028] (-906.170) (-919.731) (-918.733) -- 0:02:20
      571500 -- (-928.178) (-924.832) (-924.906) [-915.375] * (-906.414) [-908.893] (-921.757) (-920.035) -- 0:02:20
      572000 -- (-928.475) [-922.941] (-927.749) (-910.846) * (-932.321) (-927.647) (-918.119) [-910.072] -- 0:02:20
      572500 -- (-927.059) (-913.427) [-916.035] (-939.149) * (-931.545) (-931.532) [-922.203] (-906.835) -- 0:02:20
      573000 -- [-920.892] (-926.733) (-918.129) (-937.046) * (-910.619) (-927.404) [-908.328] (-918.145) -- 0:02:20
      573500 -- (-922.766) (-921.747) (-931.291) [-909.484] * (-926.948) (-929.785) (-914.123) [-919.093] -- 0:02:19
      574000 -- (-923.627) (-912.738) [-917.738] (-922.732) * (-933.084) [-911.526] (-925.140) (-912.360) -- 0:02:19
      574500 -- (-914.787) (-919.639) [-914.880] (-904.069) * (-915.245) [-916.977] (-921.531) (-931.712) -- 0:02:19
      575000 -- (-923.711) (-919.657) [-913.431] (-933.426) * (-916.191) [-910.672] (-925.282) (-929.939) -- 0:02:19

      Average standard deviation of split frequencies: 0.010604

      575500 -- (-922.828) (-911.753) (-922.293) [-914.695] * [-914.451] (-910.341) (-915.947) (-934.197) -- 0:02:19
      576000 -- (-915.223) [-907.071] (-923.166) (-919.838) * [-913.148] (-929.928) (-921.887) (-926.495) -- 0:02:19
      576500 -- (-927.485) [-915.445] (-931.972) (-918.128) * [-908.577] (-913.143) (-920.628) (-911.984) -- 0:02:18
      577000 -- (-919.943) [-910.411] (-934.211) (-909.726) * [-905.024] (-918.949) (-915.420) (-912.926) -- 0:02:18
      577500 -- (-913.253) (-923.285) (-921.469) [-909.164] * (-920.752) [-911.471] (-925.141) (-933.250) -- 0:02:18
      578000 -- [-917.757] (-920.602) (-913.030) (-922.756) * (-920.040) [-913.995] (-934.513) (-921.649) -- 0:02:18
      578500 -- (-912.021) (-915.051) [-911.545] (-926.762) * (-921.695) [-917.727] (-935.715) (-919.333) -- 0:02:18
      579000 -- (-918.951) (-922.563) [-913.880] (-919.416) * (-927.401) (-924.436) [-918.637] (-922.577) -- 0:02:18
      579500 -- [-911.129] (-918.783) (-918.660) (-929.892) * [-909.792] (-923.244) (-938.991) (-915.452) -- 0:02:17
      580000 -- (-924.228) (-921.338) [-906.152] (-914.604) * [-906.834] (-919.793) (-934.535) (-914.936) -- 0:02:17

      Average standard deviation of split frequencies: 0.011083

      580500 -- (-910.751) (-926.020) [-911.441] (-923.906) * [-910.622] (-924.107) (-921.367) (-917.417) -- 0:02:17
      581000 -- (-915.843) [-914.199] (-913.756) (-911.634) * (-932.604) (-923.589) (-925.232) [-918.250] -- 0:02:17
      581500 -- (-922.937) (-915.730) [-908.933] (-915.183) * (-922.243) (-914.177) [-909.972] (-924.602) -- 0:02:17
      582000 -- (-923.749) (-907.539) [-918.222] (-918.292) * (-930.733) (-913.241) [-905.072] (-936.566) -- 0:02:17
      582500 -- (-916.259) [-909.749] (-916.234) (-921.822) * (-913.810) [-915.087] (-914.827) (-924.674) -- 0:02:16
      583000 -- (-923.392) (-933.792) [-908.537] (-924.667) * [-908.574] (-921.807) (-919.404) (-920.145) -- 0:02:16
      583500 -- [-914.581] (-932.757) (-905.555) (-919.513) * (-919.233) (-933.586) (-928.447) [-912.188] -- 0:02:16
      584000 -- (-911.734) (-927.948) [-912.488] (-925.452) * (-923.061) (-912.792) [-917.592] (-914.313) -- 0:02:16
      584500 -- (-920.921) (-946.106) [-916.187] (-915.830) * [-911.967] (-927.107) (-918.078) (-909.607) -- 0:02:16
      585000 -- (-922.122) (-931.441) (-913.409) [-913.200] * [-905.237] (-924.250) (-929.809) (-916.213) -- 0:02:16

      Average standard deviation of split frequencies: 0.010703

      585500 -- (-920.565) (-929.550) (-927.978) [-909.885] * (-916.917) (-923.662) (-918.393) [-913.791] -- 0:02:15
      586000 -- (-917.075) (-922.184) (-919.029) [-908.486] * (-915.575) (-918.532) (-914.790) [-914.098] -- 0:02:15
      586500 -- (-917.373) (-940.248) [-908.629] (-908.240) * (-926.367) (-918.003) (-929.433) [-913.928] -- 0:02:15
      587000 -- (-919.840) (-905.502) [-912.973] (-914.355) * (-917.424) [-905.066] (-924.036) (-913.595) -- 0:02:15
      587500 -- (-915.280) (-906.513) (-915.954) [-904.006] * [-908.059] (-929.056) (-930.406) (-915.385) -- 0:02:15
      588000 -- (-925.021) (-923.891) [-915.588] (-917.389) * (-913.370) [-911.610] (-909.483) (-917.018) -- 0:02:15
      588500 -- (-936.986) (-927.864) (-918.629) [-925.446] * (-917.216) [-925.313] (-927.681) (-913.157) -- 0:02:14
      589000 -- (-931.496) (-925.301) [-907.303] (-904.230) * (-920.653) (-913.988) [-926.852] (-930.561) -- 0:02:14
      589500 -- (-930.419) (-927.167) [-911.830] (-925.310) * (-909.582) [-911.964] (-926.367) (-932.752) -- 0:02:14
      590000 -- (-923.165) (-923.939) (-909.002) [-912.397] * [-916.911] (-910.122) (-919.725) (-931.774) -- 0:02:14

      Average standard deviation of split frequencies: 0.011069

      590500 -- [-924.923] (-924.119) (-917.599) (-909.765) * (-925.951) [-919.212] (-910.679) (-925.129) -- 0:02:14
      591000 -- [-920.799] (-920.873) (-919.452) (-912.712) * (-913.835) [-911.371] (-923.577) (-923.235) -- 0:02:14
      591500 -- (-910.819) [-898.624] (-926.794) (-925.528) * (-925.383) [-906.692] (-916.827) (-933.145) -- 0:02:13
      592000 -- (-931.113) [-910.547] (-918.318) (-936.222) * (-917.400) (-911.641) (-918.485) [-906.029] -- 0:02:13
      592500 -- (-919.633) (-936.077) (-923.849) [-909.478] * (-926.777) (-920.698) (-911.410) [-909.449] -- 0:02:13
      593000 -- (-913.773) (-933.420) (-920.906) [-913.537] * [-916.233] (-915.897) (-924.214) (-908.285) -- 0:02:13
      593500 -- (-938.046) (-919.337) (-921.704) [-905.244] * [-915.492] (-919.440) (-914.182) (-922.717) -- 0:02:13
      594000 -- (-916.614) [-913.519] (-921.767) (-921.930) * (-912.272) (-913.295) [-912.229] (-910.581) -- 0:02:13
      594500 -- (-914.909) (-913.699) [-919.771] (-927.376) * (-915.534) (-922.507) (-911.530) [-911.923] -- 0:02:13
      595000 -- [-910.820] (-913.654) (-905.495) (-922.395) * (-935.089) (-918.565) (-924.767) [-906.997] -- 0:02:12

      Average standard deviation of split frequencies: 0.010744

      595500 -- [-910.662] (-912.306) (-925.674) (-949.518) * (-931.604) (-919.406) [-919.424] (-903.511) -- 0:02:12
      596000 -- [-918.133] (-926.832) (-932.782) (-932.401) * (-912.254) [-916.846] (-922.828) (-925.477) -- 0:02:12
      596500 -- (-913.590) (-917.490) [-903.045] (-929.289) * (-943.603) (-922.204) [-914.111] (-910.404) -- 0:02:12
      597000 -- [-905.206] (-920.909) (-922.571) (-923.848) * (-925.876) (-916.423) [-907.714] (-910.918) -- 0:02:12
      597500 -- [-913.797] (-932.786) (-926.990) (-930.591) * (-917.190) [-904.094] (-906.373) (-926.454) -- 0:02:12
      598000 -- (-927.788) (-914.715) (-922.103) [-915.783] * (-924.939) (-905.661) [-909.304] (-932.110) -- 0:02:11
      598500 -- (-919.567) [-906.743] (-922.378) (-911.461) * [-912.333] (-912.961) (-914.031) (-925.677) -- 0:02:11
      599000 -- [-913.857] (-916.859) (-919.456) (-916.007) * (-921.440) [-916.720] (-912.964) (-925.494) -- 0:02:11
      599500 -- [-907.799] (-919.032) (-918.066) (-922.455) * [-907.121] (-926.199) (-920.102) (-917.624) -- 0:02:11
      600000 -- [-912.849] (-927.692) (-912.428) (-918.798) * (-925.946) (-930.501) [-910.157] (-910.442) -- 0:02:11

      Average standard deviation of split frequencies: 0.010235

      600500 -- (-913.644) (-921.726) [-914.977] (-935.062) * [-922.815] (-917.902) (-920.599) (-912.517) -- 0:02:11
      601000 -- [-899.074] (-934.373) (-916.547) (-922.253) * (-919.034) (-914.473) (-929.556) [-915.904] -- 0:02:10
      601500 -- (-910.297) (-926.077) [-917.818] (-928.375) * (-921.006) (-933.258) (-938.998) [-910.026] -- 0:02:10
      602000 -- (-924.419) (-919.476) [-916.935] (-922.098) * (-919.945) (-931.594) (-923.704) [-910.519] -- 0:02:10
      602500 -- (-910.329) [-911.903] (-935.331) (-929.968) * (-917.258) (-926.086) (-940.135) [-914.080] -- 0:02:10
      603000 -- (-917.282) (-913.379) [-918.976] (-918.568) * [-912.991] (-915.840) (-933.909) (-922.427) -- 0:02:10
      603500 -- (-906.186) (-922.784) (-924.332) [-926.151] * (-915.839) (-918.727) (-936.817) [-917.280] -- 0:02:10
      604000 -- (-914.637) (-927.353) [-919.732] (-916.961) * (-925.129) [-907.218] (-931.521) (-918.888) -- 0:02:09
      604500 -- (-921.969) (-933.723) (-925.119) [-915.147] * (-919.762) [-924.386] (-916.894) (-914.024) -- 0:02:09
      605000 -- (-918.632) [-924.619] (-943.459) (-917.096) * (-919.978) (-941.249) (-929.436) [-914.377] -- 0:02:09

      Average standard deviation of split frequencies: 0.010340

      605500 -- [-924.463] (-926.912) (-932.004) (-914.342) * (-916.276) (-925.127) (-922.831) [-906.061] -- 0:02:09
      606000 -- (-935.086) (-925.881) (-916.553) [-917.757] * [-910.598] (-911.555) (-921.088) (-910.309) -- 0:02:09
      606500 -- (-917.773) [-907.717] (-939.495) (-911.206) * [-911.170] (-919.530) (-919.120) (-921.118) -- 0:02:09
      607000 -- [-914.535] (-915.189) (-919.118) (-919.231) * [-909.597] (-922.000) (-919.359) (-920.649) -- 0:02:08
      607500 -- (-920.314) (-910.871) [-912.674] (-915.631) * (-910.779) (-911.422) (-918.775) [-920.045] -- 0:02:08
      608000 -- (-907.388) [-910.965] (-909.035) (-940.865) * (-921.443) (-928.683) [-910.538] (-913.755) -- 0:02:08
      608500 -- (-924.999) [-911.365] (-928.471) (-909.086) * (-923.876) [-912.987] (-917.598) (-907.461) -- 0:02:08
      609000 -- (-920.622) (-913.791) [-918.102] (-907.366) * [-917.258] (-935.077) (-917.973) (-925.909) -- 0:02:08
      609500 -- [-920.654] (-914.439) (-924.274) (-943.660) * (-923.278) (-918.593) (-915.452) [-915.299] -- 0:02:08
      610000 -- [-922.496] (-915.156) (-919.485) (-937.750) * (-928.780) [-911.543] (-914.232) (-919.460) -- 0:02:07

      Average standard deviation of split frequencies: 0.009907

      610500 -- (-914.038) (-915.632) (-921.357) [-908.293] * [-915.539] (-921.707) (-915.358) (-919.820) -- 0:02:07
      611000 -- (-919.515) (-921.468) (-914.397) [-914.165] * (-922.063) (-918.740) (-931.150) [-912.451] -- 0:02:07
      611500 -- [-925.367] (-932.825) (-912.953) (-911.787) * [-912.222] (-909.290) (-921.580) (-927.884) -- 0:02:07
      612000 -- (-924.480) (-932.330) (-909.835) [-920.014] * [-914.451] (-920.047) (-921.527) (-914.756) -- 0:02:07
      612500 -- (-924.641) (-927.951) (-929.387) [-918.659] * (-929.398) (-930.139) (-919.960) [-913.079] -- 0:02:07
      613000 -- [-913.652] (-909.669) (-933.430) (-920.452) * [-913.607] (-912.764) (-920.503) (-931.718) -- 0:02:06
      613500 -- (-918.944) (-928.162) (-934.015) [-908.529] * (-912.988) (-919.233) (-921.835) [-911.058] -- 0:02:06
      614000 -- (-925.074) (-918.875) (-915.252) [-918.258] * (-916.888) (-914.991) [-916.322] (-950.300) -- 0:02:06
      614500 -- [-920.718] (-924.527) (-912.012) (-919.834) * (-924.914) (-910.729) [-907.389] (-926.343) -- 0:02:06
      615000 -- [-909.531] (-935.878) (-923.072) (-930.093) * (-908.648) [-905.153] (-917.400) (-924.908) -- 0:02:06

      Average standard deviation of split frequencies: 0.009375

      615500 -- [-904.773] (-902.600) (-924.344) (-921.650) * (-920.049) (-914.098) [-914.844] (-928.893) -- 0:02:06
      616000 -- [-918.821] (-923.188) (-911.974) (-916.952) * (-916.543) (-915.901) [-907.235] (-934.900) -- 0:02:05
      616500 -- (-916.374) (-913.441) [-921.059] (-923.461) * (-910.169) [-915.698] (-916.355) (-930.692) -- 0:02:05
      617000 -- (-915.764) (-932.419) (-917.898) [-919.073] * (-917.231) [-915.073] (-923.962) (-920.392) -- 0:02:05
      617500 -- [-919.801] (-927.666) (-918.991) (-931.223) * (-913.744) (-929.685) [-916.410] (-916.895) -- 0:02:05
      618000 -- (-914.027) [-917.964] (-925.125) (-927.987) * (-931.215) [-909.968] (-912.819) (-924.748) -- 0:02:05
      618500 -- [-916.599] (-924.416) (-921.931) (-920.775) * [-919.680] (-909.944) (-917.019) (-926.587) -- 0:02:05
      619000 -- (-918.514) [-906.723] (-920.670) (-914.174) * (-917.398) (-907.736) [-907.978] (-917.770) -- 0:02:04
      619500 -- (-925.448) (-926.570) [-909.566] (-927.807) * (-915.544) [-915.086] (-922.242) (-912.093) -- 0:02:04
      620000 -- [-915.883] (-927.210) (-908.160) (-927.630) * [-911.464] (-921.655) (-922.912) (-921.452) -- 0:02:04

      Average standard deviation of split frequencies: 0.008355

      620500 -- (-923.748) [-915.081] (-922.309) (-920.907) * (-918.132) [-911.790] (-932.613) (-910.015) -- 0:02:04
      621000 -- (-929.130) [-925.421] (-906.286) (-917.306) * (-914.579) [-908.786] (-926.222) (-930.770) -- 0:02:04
      621500 -- (-921.493) (-926.655) (-927.798) [-909.126] * (-924.461) (-912.127) [-919.061] (-942.504) -- 0:02:04
      622000 -- [-924.615] (-922.247) (-911.474) (-928.647) * (-912.582) (-911.098) (-936.879) [-922.138] -- 0:02:03
      622500 -- (-926.368) [-917.187] (-918.344) (-921.191) * (-925.358) (-922.338) [-923.314] (-943.235) -- 0:02:03
      623000 -- (-920.951) (-916.288) [-916.579] (-932.797) * (-923.073) (-929.364) [-917.766] (-937.212) -- 0:02:03
      623500 -- (-924.004) (-921.592) [-908.013] (-924.531) * (-913.568) [-910.872] (-918.581) (-931.969) -- 0:02:03
      624000 -- [-913.811] (-918.981) (-914.974) (-923.469) * (-929.727) (-913.828) [-902.598] (-932.492) -- 0:02:03
      624500 -- (-930.287) (-917.605) [-909.838] (-913.718) * (-920.392) (-909.845) [-914.227] (-927.023) -- 0:02:03
      625000 -- (-921.457) (-918.418) [-913.613] (-914.571) * (-918.402) [-916.861] (-918.451) (-927.122) -- 0:02:03

      Average standard deviation of split frequencies: 0.009850

      625500 -- (-924.562) (-921.505) [-909.395] (-921.132) * (-931.911) (-917.200) [-910.235] (-935.963) -- 0:02:02
      626000 -- (-922.445) (-919.381) [-915.727] (-913.630) * (-925.458) (-919.426) (-928.166) [-923.369] -- 0:02:02
      626500 -- (-920.309) [-914.981] (-928.647) (-918.376) * [-912.119] (-918.747) (-915.489) (-938.674) -- 0:02:02
      627000 -- (-921.478) [-913.064] (-908.099) (-916.071) * (-922.802) (-918.917) [-911.265] (-927.237) -- 0:02:02
      627500 -- (-928.294) (-923.663) [-915.872] (-923.032) * [-910.844] (-918.837) (-917.493) (-916.672) -- 0:02:02
      628000 -- [-913.498] (-916.894) (-931.644) (-924.422) * [-908.470] (-919.810) (-928.345) (-936.842) -- 0:02:02
      628500 -- (-917.836) [-919.241] (-922.627) (-918.707) * (-919.586) [-906.317] (-923.597) (-928.169) -- 0:02:01
      629000 -- (-919.023) (-916.791) (-939.405) [-910.370] * (-929.569) (-921.694) [-910.113] (-917.807) -- 0:02:01
      629500 -- (-920.505) (-928.961) (-924.586) [-911.223] * [-919.388] (-910.443) (-919.847) (-926.964) -- 0:02:01
      630000 -- (-918.778) (-919.519) (-916.946) [-921.420] * (-913.641) [-903.020] (-932.090) (-943.974) -- 0:02:01

      Average standard deviation of split frequencies: 0.010225

      630500 -- (-922.930) (-922.793) (-933.859) [-919.827] * [-918.416] (-915.330) (-934.053) (-927.574) -- 0:02:01
      631000 -- (-921.509) [-915.161] (-925.746) (-916.911) * [-914.212] (-920.866) (-914.975) (-945.197) -- 0:02:01
      631500 -- (-932.392) (-927.298) [-917.697] (-910.068) * (-911.838) [-915.297] (-935.453) (-928.580) -- 0:02:00
      632000 -- (-931.086) (-938.029) (-919.899) [-910.407] * [-912.592] (-914.038) (-924.266) (-931.752) -- 0:02:00
      632500 -- (-919.505) [-927.158] (-925.139) (-926.546) * (-921.224) (-922.091) [-909.160] (-941.094) -- 0:02:00
      633000 -- (-928.057) [-914.794] (-919.397) (-918.094) * [-915.403] (-918.370) (-914.950) (-931.805) -- 0:02:00
      633500 -- (-918.855) (-912.578) [-914.256] (-929.542) * (-911.957) [-921.158] (-920.810) (-914.357) -- 0:02:00
      634000 -- [-927.108] (-915.581) (-932.625) (-927.736) * [-911.867] (-924.287) (-913.907) (-923.209) -- 0:02:00
      634500 -- (-930.005) [-917.178] (-911.787) (-929.177) * (-918.440) (-914.267) (-913.075) [-927.103] -- 0:01:59
      635000 -- (-918.996) [-918.116] (-907.431) (-917.290) * [-906.913] (-917.407) (-923.497) (-916.157) -- 0:01:59

      Average standard deviation of split frequencies: 0.010495

      635500 -- [-913.089] (-933.820) (-915.917) (-923.798) * (-927.173) [-904.177] (-912.658) (-934.225) -- 0:01:59
      636000 -- (-920.299) (-917.729) (-911.181) [-906.467] * [-919.096] (-928.075) (-916.873) (-917.457) -- 0:01:59
      636500 -- (-934.684) [-916.540] (-923.071) (-916.747) * [-921.285] (-914.065) (-929.377) (-943.269) -- 0:01:59
      637000 -- [-915.337] (-935.544) (-918.666) (-917.568) * [-914.887] (-903.414) (-924.372) (-945.081) -- 0:01:59
      637500 -- (-918.498) (-924.747) [-913.905] (-930.114) * [-909.234] (-915.743) (-928.907) (-948.549) -- 0:01:58
      638000 -- (-920.165) (-919.502) [-906.943] (-930.187) * (-923.575) (-919.988) [-920.562] (-934.847) -- 0:01:58
      638500 -- [-917.006] (-929.370) (-909.266) (-932.023) * (-946.172) (-909.638) [-911.842] (-944.648) -- 0:01:58
      639000 -- (-910.510) (-925.467) [-909.087] (-927.667) * (-912.380) (-931.620) (-914.668) [-912.437] -- 0:01:58
      639500 -- [-917.983] (-936.498) (-916.673) (-943.611) * [-911.058] (-930.404) (-910.015) (-922.857) -- 0:01:58
      640000 -- (-911.925) [-912.418] (-933.348) (-920.058) * (-924.602) (-930.224) (-927.865) [-910.512] -- 0:01:58

      Average standard deviation of split frequencies: 0.010625

      640500 -- [-912.931] (-920.258) (-916.633) (-925.216) * (-922.099) [-927.248] (-921.582) (-932.354) -- 0:01:57
      641000 -- (-928.169) [-915.186] (-912.551) (-944.185) * (-912.255) (-920.543) [-920.439] (-928.552) -- 0:01:57
      641500 -- (-920.841) (-909.192) [-912.662] (-934.119) * [-909.825] (-913.615) (-919.070) (-923.279) -- 0:01:57
      642000 -- (-928.642) [-913.966] (-921.745) (-937.149) * (-931.105) (-917.531) [-918.946] (-922.542) -- 0:01:57
      642500 -- (-927.660) (-922.188) [-916.993] (-915.272) * [-912.083] (-911.315) (-932.789) (-925.709) -- 0:01:57
      643000 -- (-918.228) (-932.220) (-907.749) [-911.675] * [-912.081] (-917.548) (-926.885) (-930.930) -- 0:01:57
      643500 -- (-918.625) (-920.798) (-911.781) [-908.939] * (-926.986) (-927.994) [-929.508] (-916.122) -- 0:01:56
      644000 -- (-923.707) (-909.025) [-910.909] (-919.599) * [-923.388] (-920.154) (-915.926) (-923.978) -- 0:01:56
      644500 -- [-913.647] (-920.660) (-912.961) (-907.423) * [-918.412] (-916.816) (-933.697) (-916.969) -- 0:01:56
      645000 -- (-920.459) (-917.830) (-915.337) [-911.491] * [-908.378] (-909.495) (-933.716) (-924.421) -- 0:01:56

      Average standard deviation of split frequencies: 0.010479

      645500 -- (-912.296) (-917.279) [-920.901] (-933.191) * [-910.998] (-947.070) (-917.601) (-931.750) -- 0:01:56
      646000 -- (-924.627) (-920.163) [-918.476] (-923.382) * (-909.613) (-920.838) (-936.707) [-911.892] -- 0:01:56
      646500 -- (-942.544) (-928.864) [-916.852] (-918.894) * (-927.285) (-911.739) (-914.471) [-911.843] -- 0:01:55
      647000 -- (-923.817) (-938.067) [-908.911] (-922.941) * [-917.138] (-923.006) (-936.816) (-928.844) -- 0:01:55
      647500 -- (-927.848) (-920.014) (-920.420) [-907.987] * (-934.445) [-917.509] (-919.595) (-927.223) -- 0:01:55
      648000 -- (-909.598) (-909.182) [-911.948] (-933.345) * (-921.776) [-909.234] (-930.155) (-916.753) -- 0:01:55
      648500 -- (-922.611) (-922.066) [-915.834] (-919.695) * (-926.639) (-911.905) [-920.494] (-910.339) -- 0:01:55
      649000 -- (-917.608) [-931.988] (-926.927) (-916.737) * (-917.689) [-914.604] (-915.155) (-936.712) -- 0:01:55
      649500 -- [-906.608] (-919.778) (-940.539) (-932.075) * [-910.357] (-917.139) (-925.629) (-911.954) -- 0:01:54
      650000 -- (-913.419) (-916.354) (-929.311) [-911.027] * (-914.753) (-929.799) [-915.140] (-911.184) -- 0:01:54

      Average standard deviation of split frequencies: 0.010867

      650500 -- (-924.711) [-913.117] (-920.754) (-910.256) * (-927.267) [-905.220] (-916.290) (-919.121) -- 0:01:54
      651000 -- (-928.823) (-918.336) (-918.139) [-905.418] * (-934.078) [-919.599] (-923.257) (-915.284) -- 0:01:54
      651500 -- (-932.868) (-945.482) (-913.270) [-915.349] * (-914.706) [-926.754] (-919.372) (-912.159) -- 0:01:54
      652000 -- (-929.487) (-926.062) (-929.408) [-917.016] * (-911.426) (-924.105) (-926.305) [-905.420] -- 0:01:54
      652500 -- (-927.334) (-925.758) (-911.700) [-915.898] * (-924.418) (-916.164) (-939.092) [-910.178] -- 0:01:53
      653000 -- (-918.359) (-935.731) (-924.001) [-910.119] * [-918.072] (-936.463) (-926.986) (-916.832) -- 0:01:53
      653500 -- (-915.416) (-917.944) [-917.656] (-920.628) * [-916.483] (-920.988) (-919.414) (-906.856) -- 0:01:53
      654000 -- (-926.321) (-907.373) (-913.193) [-916.421] * (-911.662) [-914.512] (-926.762) (-914.271) -- 0:01:53
      654500 -- (-929.710) [-927.091] (-920.934) (-924.225) * (-908.689) [-913.128] (-920.077) (-927.471) -- 0:01:53
      655000 -- (-922.134) (-918.107) [-915.176] (-922.715) * (-922.632) (-910.498) (-940.448) [-920.020] -- 0:01:53

      Average standard deviation of split frequencies: 0.010722

      655500 -- [-913.543] (-915.601) (-916.417) (-914.262) * (-938.054) [-916.294] (-916.001) (-927.857) -- 0:01:52
      656000 -- [-909.309] (-923.926) (-917.612) (-924.559) * (-930.654) (-913.427) (-917.043) [-905.013] -- 0:01:52
      656500 -- (-913.460) (-929.471) [-909.110] (-935.847) * [-912.871] (-914.398) (-916.809) (-915.001) -- 0:01:52
      657000 -- (-915.354) [-910.167] (-919.208) (-929.620) * [-920.712] (-921.202) (-912.826) (-923.875) -- 0:01:52
      657500 -- (-924.040) (-907.145) [-923.998] (-938.072) * (-929.018) (-911.970) [-909.566] (-912.148) -- 0:01:52
      658000 -- (-928.785) (-909.824) [-907.251] (-923.062) * (-918.548) (-925.267) (-936.349) [-912.794] -- 0:01:52
      658500 -- [-913.580] (-915.645) (-924.303) (-937.287) * (-920.396) (-917.402) [-917.939] (-906.749) -- 0:01:52
      659000 -- (-916.938) (-911.738) (-925.416) [-910.867] * [-913.388] (-923.648) (-917.727) (-908.304) -- 0:01:51
      659500 -- (-911.414) [-922.980] (-927.020) (-922.035) * (-914.231) [-905.635] (-922.741) (-924.852) -- 0:01:51
      660000 -- (-909.849) [-909.039] (-914.846) (-931.023) * (-914.707) (-917.310) [-913.115] (-931.480) -- 0:01:51

      Average standard deviation of split frequencies: 0.010560

      660500 -- (-918.368) (-914.326) [-916.167] (-917.249) * [-915.105] (-918.143) (-924.430) (-923.053) -- 0:01:51
      661000 -- (-920.644) (-930.311) [-907.139] (-925.475) * [-926.961] (-919.778) (-922.383) (-915.657) -- 0:01:51
      661500 -- (-914.712) (-913.442) (-932.378) [-917.925] * [-922.978] (-913.324) (-929.630) (-929.346) -- 0:01:51
      662000 -- [-925.124] (-931.701) (-917.051) (-915.416) * (-921.155) (-922.818) (-914.166) [-914.685] -- 0:01:50
      662500 -- [-920.564] (-921.180) (-923.298) (-932.120) * (-926.579) (-915.398) (-926.448) [-910.005] -- 0:01:50
      663000 -- [-913.903] (-937.424) (-922.088) (-924.877) * (-916.995) [-917.462] (-916.510) (-918.879) -- 0:01:50
      663500 -- (-923.253) (-942.319) [-909.596] (-918.008) * (-911.897) (-922.650) (-927.433) [-911.934] -- 0:01:50
      664000 -- (-928.611) [-925.185] (-917.494) (-927.722) * (-914.584) (-933.808) (-927.536) [-908.414] -- 0:01:49
      664500 -- (-918.038) (-917.779) [-921.682] (-926.896) * (-936.801) [-913.397] (-916.900) (-928.759) -- 0:01:50
      665000 -- (-920.957) [-909.254] (-921.008) (-920.790) * [-912.714] (-923.419) (-908.017) (-927.265) -- 0:01:49

      Average standard deviation of split frequencies: 0.010646

      665500 -- (-918.343) (-907.966) (-926.177) [-916.370] * (-917.030) (-924.346) [-905.462] (-919.956) -- 0:01:49
      666000 -- [-912.323] (-916.393) (-914.065) (-920.041) * (-908.776) (-942.259) (-915.259) [-922.822] -- 0:01:49
      666500 -- (-929.364) (-910.031) [-912.590] (-922.397) * (-919.492) [-908.241] (-938.429) (-928.802) -- 0:01:49
      667000 -- [-913.239] (-916.247) (-943.750) (-917.616) * (-920.594) (-912.021) (-922.716) [-919.010] -- 0:01:48
      667500 -- (-912.929) (-921.538) (-917.040) [-934.747] * (-926.830) [-907.176] (-915.866) (-913.282) -- 0:01:49
      668000 -- (-915.475) (-924.309) [-912.228] (-914.281) * (-918.909) [-907.715] (-925.510) (-922.639) -- 0:01:48
      668500 -- (-917.077) (-928.580) (-922.036) [-910.052] * (-930.611) (-912.091) [-915.590] (-913.330) -- 0:01:48
      669000 -- [-909.458] (-930.257) (-919.974) (-915.172) * (-926.775) (-922.154) [-908.080] (-919.629) -- 0:01:48
      669500 -- [-907.729] (-915.841) (-926.213) (-936.642) * [-915.218] (-920.241) (-925.931) (-910.063) -- 0:01:48
      670000 -- [-905.041] (-928.048) (-922.921) (-920.265) * [-907.228] (-935.827) (-939.589) (-921.985) -- 0:01:47

      Average standard deviation of split frequencies: 0.010690

      670500 -- (-929.275) (-934.686) [-911.875] (-929.600) * [-907.138] (-916.194) (-931.656) (-937.666) -- 0:01:47
      671000 -- (-934.400) (-915.646) [-904.437] (-924.248) * (-915.896) (-913.412) (-936.802) [-911.369] -- 0:01:47
      671500 -- [-912.314] (-919.388) (-907.597) (-923.072) * (-914.532) [-921.773] (-932.470) (-916.363) -- 0:01:47
      672000 -- (-930.262) (-918.981) (-923.736) [-908.707] * [-915.793] (-924.767) (-944.022) (-916.148) -- 0:01:47
      672500 -- [-914.994] (-918.300) (-932.171) (-923.593) * [-930.719] (-919.795) (-929.098) (-914.599) -- 0:01:47
      673000 -- (-933.521) (-924.929) (-930.904) [-917.001] * (-917.912) [-905.033] (-909.229) (-916.988) -- 0:01:46
      673500 -- (-912.314) (-928.557) (-941.849) [-912.971] * (-915.294) (-913.114) [-918.686] (-932.619) -- 0:01:46
      674000 -- [-919.864] (-940.176) (-916.284) (-923.642) * (-924.280) [-916.333] (-920.093) (-920.989) -- 0:01:46
      674500 -- (-927.070) (-932.193) [-905.306] (-930.121) * [-909.977] (-918.191) (-928.708) (-911.745) -- 0:01:46
      675000 -- (-931.048) [-914.476] (-915.911) (-926.081) * [-905.619] (-911.543) (-930.827) (-915.728) -- 0:01:46

      Average standard deviation of split frequencies: 0.010763

      675500 -- (-931.638) [-914.335] (-917.520) (-927.226) * (-929.272) [-912.450] (-920.608) (-924.181) -- 0:01:46
      676000 -- (-935.239) (-927.804) [-909.824] (-918.187) * [-910.268] (-916.883) (-920.449) (-907.070) -- 0:01:45
      676500 -- (-934.154) (-928.435) [-909.681] (-914.398) * [-912.069] (-914.630) (-927.068) (-918.005) -- 0:01:45
      677000 -- (-929.829) (-936.730) [-907.172] (-909.574) * (-925.863) (-915.797) (-914.714) [-905.833] -- 0:01:45
      677500 -- (-934.495) (-925.473) [-909.312] (-912.963) * (-947.637) (-914.387) (-908.924) [-916.184] -- 0:01:45
      678000 -- (-922.909) (-920.468) (-917.925) [-917.107] * (-923.019) (-912.485) [-905.487] (-920.056) -- 0:01:45
      678500 -- [-912.362] (-916.871) (-926.394) (-914.531) * [-911.104] (-918.699) (-919.778) (-915.367) -- 0:01:45
      679000 -- (-910.891) [-914.025] (-921.425) (-913.599) * (-911.977) (-912.418) (-926.770) [-907.896] -- 0:01:44
      679500 -- (-909.357) (-919.308) (-936.927) [-915.973] * [-920.899] (-915.224) (-915.596) (-916.214) -- 0:01:44
      680000 -- (-906.260) (-921.991) (-934.691) [-922.004] * (-920.212) (-923.351) [-920.435] (-936.864) -- 0:01:44

      Average standard deviation of split frequencies: 0.010158

      680500 -- (-917.744) (-927.366) (-946.494) [-912.248] * (-919.941) (-943.186) (-921.856) [-917.393] -- 0:01:44
      681000 -- [-915.861] (-923.498) (-935.245) (-936.506) * (-923.187) (-917.511) [-920.395] (-917.156) -- 0:01:44
      681500 -- (-938.299) [-919.614] (-934.717) (-921.629) * (-915.368) (-923.780) (-913.170) [-913.227] -- 0:01:44
      682000 -- (-909.538) (-905.696) (-928.247) [-909.139] * (-909.484) (-929.183) (-913.033) [-918.127] -- 0:01:43
      682500 -- (-922.865) (-917.719) (-933.130) [-916.818] * [-918.444] (-914.126) (-917.751) (-909.725) -- 0:01:43
      683000 -- [-910.571] (-922.741) (-951.015) (-906.621) * (-926.032) (-928.404) [-915.832] (-927.649) -- 0:01:43
      683500 -- (-906.750) (-930.868) (-923.100) [-907.929] * [-908.481] (-920.456) (-922.931) (-927.468) -- 0:01:43
      684000 -- (-919.618) (-925.837) (-926.617) [-917.218] * (-905.678) [-913.645] (-916.069) (-920.773) -- 0:01:43
      684500 -- [-913.142] (-918.203) (-927.914) (-909.996) * [-913.119] (-923.618) (-929.253) (-920.410) -- 0:01:43
      685000 -- (-907.033) [-908.127] (-930.632) (-917.804) * [-904.288] (-928.313) (-912.686) (-940.915) -- 0:01:43

      Average standard deviation of split frequencies: 0.008558

      685500 -- [-914.201] (-909.414) (-914.549) (-928.142) * (-927.302) (-912.344) [-913.143] (-929.758) -- 0:01:42
      686000 -- (-903.093) (-933.599) (-921.537) [-911.248] * (-921.310) (-913.570) [-907.358] (-909.782) -- 0:01:42
      686500 -- (-913.176) (-918.930) (-926.166) [-905.276] * (-919.877) (-912.250) (-916.110) [-919.096] -- 0:01:42
      687000 -- (-922.997) (-914.118) (-927.239) [-912.201] * (-914.693) (-920.421) (-932.411) [-911.556] -- 0:01:42
      687500 -- (-922.798) (-915.697) [-916.527] (-905.424) * (-912.937) (-924.080) (-908.436) [-919.568] -- 0:01:42
      688000 -- [-915.662] (-920.728) (-923.640) (-925.099) * (-911.900) (-932.285) (-919.622) [-915.933] -- 0:01:42
      688500 -- (-915.000) (-916.189) [-917.010] (-937.721) * (-926.411) (-919.080) (-910.342) [-917.415] -- 0:01:41
      689000 -- (-939.481) [-919.011] (-912.562) (-920.690) * (-913.469) (-931.893) (-938.282) [-920.603] -- 0:01:42
      689500 -- (-920.800) [-916.657] (-917.938) (-907.496) * [-906.496] (-917.279) (-936.732) (-927.295) -- 0:01:41
      690000 -- (-916.364) (-914.507) (-926.659) [-921.560] * [-905.167] (-909.839) (-911.076) (-920.024) -- 0:01:41

      Average standard deviation of split frequencies: 0.008159

      690500 -- (-927.043) (-921.384) (-913.924) [-913.579] * (-924.928) (-910.140) (-922.943) [-920.864] -- 0:01:41
      691000 -- (-927.401) (-933.967) (-924.249) [-908.424] * (-923.436) (-919.126) [-917.319] (-914.142) -- 0:01:41
      691500 -- (-935.860) (-919.365) [-913.032] (-924.591) * (-926.593) [-921.353] (-909.960) (-917.624) -- 0:01:40
      692000 -- (-928.760) (-924.270) (-906.988) [-922.323] * (-928.838) [-926.932] (-917.762) (-923.082) -- 0:01:41
      692500 -- (-945.340) [-904.944] (-915.540) (-922.349) * (-927.577) [-918.913] (-925.244) (-923.491) -- 0:01:40
      693000 -- [-917.996] (-917.716) (-926.181) (-908.524) * (-930.788) (-917.161) (-919.816) [-919.083] -- 0:01:40
      693500 -- (-920.017) (-915.187) (-919.154) [-919.163] * (-928.629) (-929.585) [-913.110] (-916.551) -- 0:01:40
      694000 -- (-920.393) [-915.332] (-925.766) (-920.844) * (-934.015) (-915.875) (-915.598) [-910.901] -- 0:01:40
      694500 -- (-940.254) (-922.011) (-921.767) [-923.441] * (-924.825) (-914.316) [-906.313] (-924.126) -- 0:01:39
      695000 -- (-930.323) (-917.380) [-905.242] (-921.549) * (-925.795) [-911.222] (-914.394) (-912.862) -- 0:01:40

      Average standard deviation of split frequencies: 0.007128

      695500 -- (-930.579) (-916.215) (-922.634) [-909.777] * [-906.116] (-923.122) (-915.790) (-924.138) -- 0:01:39
      696000 -- (-915.758) (-922.939) (-938.347) [-903.810] * (-914.876) (-926.095) [-917.239] (-929.953) -- 0:01:39
      696500 -- (-934.269) (-915.961) (-904.496) [-915.345] * [-912.736] (-920.680) (-930.305) (-925.081) -- 0:01:39
      697000 -- (-926.016) (-921.153) (-903.431) [-910.169] * (-910.218) (-923.721) [-913.035] (-926.348) -- 0:01:39
      697500 -- (-923.111) (-913.990) [-916.960] (-915.993) * (-923.817) (-927.339) [-912.265] (-928.648) -- 0:01:38
      698000 -- (-915.001) (-903.428) (-930.982) [-909.157] * (-915.760) [-914.410] (-929.732) (-946.606) -- 0:01:39
      698500 -- [-918.556] (-913.438) (-917.192) (-921.666) * (-912.242) (-915.430) [-911.870] (-931.135) -- 0:01:38
      699000 -- (-914.751) [-913.456] (-910.639) (-925.730) * (-919.967) (-907.841) [-926.084] (-921.591) -- 0:01:38
      699500 -- [-915.156] (-910.730) (-921.843) (-920.467) * (-918.319) (-907.936) [-910.644] (-937.564) -- 0:01:38
      700000 -- (-910.109) [-911.723] (-934.886) (-908.867) * (-928.696) [-911.536] (-917.050) (-916.528) -- 0:01:38

      Average standard deviation of split frequencies: 0.007840

      700500 -- (-929.082) [-909.410] (-929.153) (-916.856) * (-928.302) (-928.092) [-916.354] (-919.982) -- 0:01:37
      701000 -- (-921.381) [-909.593] (-921.851) (-909.154) * (-922.570) (-919.263) (-915.833) [-915.378] -- 0:01:38
      701500 -- [-913.803] (-912.921) (-940.809) (-933.581) * (-928.214) (-925.668) (-929.828) [-919.759] -- 0:01:37
      702000 -- (-904.869) [-911.726] (-951.121) (-911.639) * (-933.214) (-919.799) (-909.751) [-918.447] -- 0:01:37
      702500 -- (-911.114) (-928.684) [-915.279] (-918.432) * (-934.101) (-913.114) [-918.398] (-922.741) -- 0:01:37
      703000 -- (-913.047) (-911.052) [-909.009] (-916.793) * (-924.860) (-921.913) (-933.590) [-911.553] -- 0:01:37
      703500 -- (-913.101) (-920.059) (-918.369) [-913.064] * (-932.612) [-903.284] (-934.594) (-914.624) -- 0:01:36
      704000 -- (-920.576) (-912.579) (-913.718) [-906.634] * (-938.848) [-913.501] (-916.665) (-910.635) -- 0:01:37
      704500 -- (-927.374) (-917.382) (-930.411) [-914.162] * (-917.739) [-906.831] (-917.510) (-903.166) -- 0:01:36
      705000 -- (-922.317) (-926.178) (-923.212) [-912.445] * (-926.696) (-914.561) [-920.097] (-920.415) -- 0:01:36

      Average standard deviation of split frequencies: 0.006967

      705500 -- (-913.158) (-914.389) [-912.806] (-916.493) * [-917.299] (-920.758) (-915.871) (-910.002) -- 0:01:36
      706000 -- (-918.742) [-910.836] (-906.957) (-922.703) * [-918.419] (-922.841) (-939.086) (-913.068) -- 0:01:36
      706500 -- (-930.421) (-903.714) [-908.596] (-921.946) * (-929.145) [-924.020] (-923.461) (-933.932) -- 0:01:35
      707000 -- (-921.577) (-927.395) [-908.394] (-924.458) * (-920.077) [-913.396] (-916.789) (-917.890) -- 0:01:36
      707500 -- (-915.228) [-918.522] (-906.990) (-919.010) * (-937.840) (-936.157) (-914.553) [-913.340] -- 0:01:35
      708000 -- (-915.544) (-919.752) (-912.100) [-911.340] * (-920.951) (-921.163) (-912.753) [-911.701] -- 0:01:35
      708500 -- (-914.371) (-923.685) (-914.633) [-911.284] * (-923.045) (-917.915) [-916.465] (-909.289) -- 0:01:35
      709000 -- (-924.308) [-924.889] (-913.757) (-931.840) * (-915.578) (-920.672) (-926.005) [-911.657] -- 0:01:35
      709500 -- (-930.543) (-918.924) (-926.516) [-906.934] * (-911.190) [-905.993] (-937.416) (-921.457) -- 0:01:34
      710000 -- (-910.941) (-912.989) [-913.130] (-919.577) * [-910.711] (-915.240) (-924.489) (-919.852) -- 0:01:35

      Average standard deviation of split frequencies: 0.006835

      710500 -- (-928.609) [-926.893] (-926.944) (-913.104) * (-918.682) [-907.274] (-942.622) (-923.669) -- 0:01:34
      711000 -- (-916.040) (-924.610) (-912.054) [-912.658] * (-912.658) (-918.382) [-917.908] (-917.328) -- 0:01:34
      711500 -- (-914.115) (-916.656) [-916.719] (-924.095) * [-906.536] (-918.396) (-925.887) (-915.018) -- 0:01:34
      712000 -- (-914.215) (-915.536) [-915.526] (-924.002) * (-912.966) (-915.009) (-938.723) [-923.920] -- 0:01:34
      712500 -- [-918.683] (-928.707) (-939.578) (-915.980) * (-919.480) (-914.026) (-916.993) [-918.945] -- 0:01:34
      713000 -- (-910.234) (-918.783) (-934.210) [-924.384] * [-909.907] (-912.115) (-932.127) (-907.231) -- 0:01:34
      713500 -- (-909.427) [-907.740] (-922.905) (-913.973) * (-923.486) (-918.864) [-918.751] (-920.446) -- 0:01:33
      714000 -- (-907.385) [-911.736] (-924.191) (-925.747) * (-919.792) (-917.829) (-907.974) [-916.439] -- 0:01:33
      714500 -- (-919.675) [-911.232] (-925.641) (-915.177) * (-924.962) (-936.363) (-918.953) [-909.251] -- 0:01:33
      715000 -- [-915.808] (-917.688) (-920.758) (-919.026) * [-918.366] (-933.348) (-931.293) (-910.395) -- 0:01:33

      Average standard deviation of split frequencies: 0.006841

      715500 -- (-922.236) [-918.587] (-917.363) (-914.096) * (-914.083) (-910.313) (-916.284) [-918.809] -- 0:01:33
      716000 -- [-907.985] (-920.464) (-926.841) (-926.837) * (-921.391) [-924.542] (-918.523) (-916.734) -- 0:01:33
      716500 -- [-909.048] (-904.140) (-914.650) (-933.033) * [-913.267] (-911.332) (-919.401) (-922.892) -- 0:01:32
      717000 -- (-929.323) [-910.822] (-912.207) (-916.799) * (-922.944) (-910.034) [-917.667] (-919.904) -- 0:01:32
      717500 -- (-915.720) [-918.484] (-919.927) (-919.990) * (-924.231) [-915.285] (-934.555) (-917.890) -- 0:01:32
      718000 -- (-928.770) (-917.087) (-923.244) [-911.961] * [-913.566] (-915.826) (-915.089) (-926.894) -- 0:01:32
      718500 -- (-934.451) (-918.049) (-916.680) [-915.718] * (-923.465) [-907.983] (-917.267) (-918.450) -- 0:01:32
      719000 -- (-911.323) (-911.545) [-909.827] (-930.389) * [-919.291] (-912.238) (-927.037) (-918.498) -- 0:01:32
      719500 -- (-919.977) (-911.104) (-925.850) [-914.361] * [-910.142] (-909.337) (-923.173) (-911.237) -- 0:01:32
      720000 -- (-910.391) (-917.016) (-927.495) [-910.071] * (-940.426) (-911.101) (-940.922) [-916.844] -- 0:01:31

      Average standard deviation of split frequencies: 0.006779

      720500 -- [-913.062] (-925.080) (-946.597) (-922.618) * [-916.290] (-919.789) (-924.667) (-914.653) -- 0:01:31
      721000 -- (-940.367) (-917.485) (-909.458) [-908.321] * (-927.294) (-917.810) (-920.561) [-908.347] -- 0:01:31
      721500 -- (-942.271) (-917.898) [-908.601] (-922.962) * (-914.179) [-906.938] (-935.866) (-919.460) -- 0:01:31
      722000 -- (-926.791) (-921.535) (-920.234) [-910.685] * [-918.894] (-912.315) (-922.237) (-910.813) -- 0:01:31
      722500 -- (-921.902) [-912.709] (-924.939) (-928.597) * (-915.925) [-913.735] (-928.730) (-915.228) -- 0:01:31
      723000 -- (-923.525) [-909.690] (-930.481) (-919.530) * (-919.782) [-910.677] (-901.843) (-917.861) -- 0:01:30
      723500 -- (-927.006) (-918.384) [-910.972] (-912.975) * (-918.325) [-918.345] (-910.719) (-946.898) -- 0:01:30
      724000 -- [-907.926] (-927.567) (-909.867) (-922.700) * [-914.333] (-916.197) (-923.989) (-937.000) -- 0:01:30
      724500 -- (-910.873) (-924.666) (-929.624) [-908.908] * (-927.452) [-912.940] (-921.876) (-918.592) -- 0:01:30
      725000 -- (-909.517) (-921.186) (-920.611) [-908.894] * (-918.905) (-917.552) [-913.579] (-914.606) -- 0:01:30

      Average standard deviation of split frequencies: 0.007481

      725500 -- (-916.123) [-904.866] (-924.434) (-914.237) * (-928.457) (-909.239) (-921.208) [-912.876] -- 0:01:30
      726000 -- (-922.839) (-918.533) [-926.163] (-914.401) * (-926.263) [-909.279] (-921.576) (-924.519) -- 0:01:29
      726500 -- [-906.175] (-919.177) (-932.173) (-915.438) * [-916.070] (-932.847) (-913.874) (-920.274) -- 0:01:29
      727000 -- (-912.624) (-923.871) (-931.851) [-916.170] * (-919.472) (-918.766) [-913.895] (-919.007) -- 0:01:29
      727500 -- (-913.480) (-930.854) [-916.393] (-914.035) * (-927.294) [-914.361] (-925.995) (-909.178) -- 0:01:29
      728000 -- [-915.244] (-918.867) (-927.968) (-919.234) * [-912.930] (-913.838) (-913.123) (-918.593) -- 0:01:29
      728500 -- (-925.277) (-922.851) (-914.713) [-917.737] * (-913.902) (-912.336) (-904.492) [-909.871] -- 0:01:29
      729000 -- (-917.968) (-928.023) (-916.753) [-921.615] * (-920.955) [-898.375] (-917.231) (-912.191) -- 0:01:28
      729500 -- [-911.971] (-930.097) (-923.301) (-922.875) * (-932.654) [-905.065] (-909.922) (-910.105) -- 0:01:28
      730000 -- [-918.103] (-926.303) (-911.875) (-957.400) * [-925.150] (-912.543) (-927.013) (-925.504) -- 0:01:28

      Average standard deviation of split frequencies: 0.008035

      730500 -- (-909.860) [-911.801] (-933.135) (-917.492) * (-924.803) (-911.324) [-913.968] (-915.806) -- 0:01:28
      731000 -- (-917.369) [-918.158] (-921.759) (-920.222) * (-920.277) [-923.687] (-925.394) (-921.920) -- 0:01:28
      731500 -- (-931.975) (-923.659) (-928.014) [-912.633] * (-931.699) [-909.901] (-924.620) (-917.402) -- 0:01:28
      732000 -- [-916.053] (-924.583) (-949.800) (-922.151) * (-921.457) [-918.851] (-920.760) (-923.521) -- 0:01:27
      732500 -- (-918.078) (-911.090) [-906.382] (-912.484) * [-912.199] (-918.969) (-922.160) (-921.127) -- 0:01:27
      733000 -- (-918.546) [-908.782] (-930.730) (-916.509) * (-916.246) [-910.708] (-909.719) (-943.004) -- 0:01:27
      733500 -- (-908.134) (-912.357) (-936.134) [-913.621] * (-932.376) [-910.998] (-924.894) (-926.377) -- 0:01:27
      734000 -- [-913.979] (-920.147) (-913.215) (-921.927) * (-940.186) (-922.140) (-907.967) [-910.797] -- 0:01:26
      734500 -- (-915.906) [-921.907] (-934.657) (-936.585) * (-953.772) (-922.933) [-906.828] (-921.679) -- 0:01:27
      735000 -- (-919.969) [-907.154] (-940.346) (-926.552) * (-925.418) (-935.458) (-918.005) [-911.384] -- 0:01:26

      Average standard deviation of split frequencies: 0.008385

      735500 -- [-915.378] (-915.269) (-922.726) (-931.842) * (-930.424) (-923.743) (-918.226) [-914.340] -- 0:01:26
      736000 -- (-909.373) [-906.846] (-937.716) (-917.765) * (-930.925) (-922.503) (-916.908) [-909.972] -- 0:01:26
      736500 -- [-912.616] (-920.057) (-932.580) (-922.425) * (-931.102) [-908.727] (-917.897) (-917.319) -- 0:01:26
      737000 -- [-911.681] (-922.283) (-923.813) (-925.788) * [-925.475] (-923.617) (-941.548) (-937.439) -- 0:01:26
      737500 -- (-904.371) [-906.543] (-919.200) (-935.033) * (-908.953) (-917.996) (-930.326) [-915.213] -- 0:01:26
      738000 -- (-919.246) (-926.009) [-912.501] (-922.820) * [-915.421] (-907.331) (-935.303) (-921.061) -- 0:01:25
      738500 -- (-924.352) (-916.720) [-911.971] (-931.285) * (-939.879) [-916.693] (-915.121) (-910.591) -- 0:01:25
      739000 -- (-925.926) (-911.424) [-914.731] (-921.114) * (-914.296) (-912.328) (-920.576) [-917.416] -- 0:01:25
      739500 -- (-916.961) (-921.654) [-905.143] (-910.373) * (-929.597) (-924.297) [-918.703] (-916.375) -- 0:01:25
      740000 -- (-923.368) [-911.303] (-914.930) (-925.155) * (-921.207) [-910.763] (-927.934) (-918.601) -- 0:01:25

      Average standard deviation of split frequencies: 0.008304

      740500 -- (-910.831) [-915.106] (-909.863) (-930.490) * [-923.276] (-921.099) (-928.365) (-910.593) -- 0:01:25
      741000 -- (-913.170) [-910.950] (-914.071) (-936.225) * (-929.548) [-919.509] (-921.949) (-924.346) -- 0:01:24
      741500 -- (-923.780) (-924.424) (-923.568) [-920.459] * (-927.024) [-923.387] (-910.107) (-912.983) -- 0:01:24
      742000 -- (-919.280) (-925.187) [-909.799] (-916.114) * (-928.447) (-928.594) (-923.784) [-914.486] -- 0:01:24
      742500 -- (-919.906) (-926.171) [-911.164] (-924.226) * (-914.656) (-922.949) (-936.343) [-911.699] -- 0:01:24
      743000 -- [-932.905] (-922.569) (-907.631) (-922.620) * [-911.573] (-912.216) (-933.022) (-934.910) -- 0:01:24
      743500 -- [-918.405] (-919.757) (-941.370) (-919.991) * [-906.970] (-921.409) (-920.007) (-931.158) -- 0:01:24
      744000 -- (-925.633) (-912.765) (-919.060) [-919.938] * [-910.778] (-914.112) (-935.087) (-909.512) -- 0:01:23
      744500 -- (-913.870) (-926.771) [-913.833] (-929.022) * (-912.149) [-910.252] (-922.861) (-914.439) -- 0:01:23
      745000 -- (-923.356) (-937.613) [-918.222] (-914.032) * [-906.678] (-913.151) (-931.844) (-915.193) -- 0:01:23

      Average standard deviation of split frequencies: 0.008275

      745500 -- [-913.836] (-941.407) (-913.830) (-914.162) * (-936.893) [-912.630] (-923.282) (-912.245) -- 0:01:23
      746000 -- (-918.865) (-926.225) (-913.628) [-916.403] * [-913.060] (-907.142) (-935.586) (-920.298) -- 0:01:23
      746500 -- (-924.110) (-925.425) [-923.651] (-921.219) * [-911.470] (-916.856) (-920.223) (-913.043) -- 0:01:23
      747000 -- (-913.036) (-922.376) (-920.791) [-908.010] * [-917.230] (-927.941) (-917.426) (-923.212) -- 0:01:22
      747500 -- [-923.558] (-919.174) (-921.874) (-912.989) * (-921.899) [-907.063] (-919.671) (-917.367) -- 0:01:22
      748000 -- (-930.819) (-927.517) (-915.652) [-909.964] * [-911.141] (-916.783) (-916.888) (-921.770) -- 0:01:22
      748500 -- (-920.363) (-924.259) [-906.834] (-925.843) * (-916.900) [-914.095] (-939.016) (-915.564) -- 0:01:22
      749000 -- (-915.179) (-919.140) [-913.871] (-918.050) * [-924.609] (-918.848) (-924.920) (-920.725) -- 0:01:22
      749500 -- (-913.858) (-916.494) (-915.648) [-921.914] * (-907.513) [-906.115] (-909.822) (-911.648) -- 0:01:22
      750000 -- (-909.996) [-915.943] (-918.271) (-913.693) * (-917.737) [-922.881] (-916.309) (-911.243) -- 0:01:22

      Average standard deviation of split frequencies: 0.008732

      750500 -- [-917.723] (-909.515) (-931.696) (-930.956) * (-916.311) (-924.174) (-917.843) [-908.246] -- 0:01:21
      751000 -- (-936.628) [-912.629] (-937.866) (-923.667) * (-921.378) [-913.854] (-924.304) (-915.646) -- 0:01:21
      751500 -- (-918.241) (-934.314) [-920.676] (-918.939) * [-912.802] (-908.054) (-912.090) (-914.225) -- 0:01:21
      752000 -- (-914.939) [-923.548] (-930.494) (-922.970) * (-909.205) (-917.387) (-918.594) [-918.272] -- 0:01:21
      752500 -- [-921.031] (-929.499) (-925.607) (-912.421) * (-913.168) [-910.560] (-913.795) (-925.579) -- 0:01:21
      753000 -- (-929.825) (-918.224) [-924.845] (-909.358) * (-911.195) (-928.346) [-914.703] (-919.538) -- 0:01:21
      753500 -- (-931.699) (-923.701) [-911.516] (-910.093) * (-923.013) (-910.680) [-922.730] (-910.581) -- 0:01:20
      754000 -- (-906.779) [-914.974] (-910.757) (-912.215) * (-912.412) (-911.223) [-917.942] (-919.956) -- 0:01:20
      754500 -- (-921.690) (-911.272) (-909.193) [-917.751] * (-916.477) [-910.264] (-930.096) (-914.849) -- 0:01:20
      755000 -- [-916.382] (-913.599) (-906.261) (-921.729) * (-908.181) [-927.650] (-932.649) (-917.153) -- 0:01:20

      Average standard deviation of split frequencies: 0.008166

      755500 -- (-919.788) (-922.562) (-929.488) [-913.156] * [-922.351] (-917.731) (-909.529) (-921.037) -- 0:01:20
      756000 -- (-916.616) (-942.503) [-917.772] (-917.266) * (-911.981) [-909.302] (-928.981) (-919.693) -- 0:01:20
      756500 -- [-915.841] (-913.147) (-922.188) (-911.683) * (-911.826) [-904.399] (-921.745) (-916.031) -- 0:01:19
      757000 -- [-915.157] (-915.777) (-927.035) (-917.632) * (-919.812) [-907.726] (-922.205) (-903.771) -- 0:01:19
      757500 -- (-907.115) (-923.595) [-910.940] (-917.622) * (-911.560) (-921.874) (-918.074) [-914.939] -- 0:01:19
      758000 -- [-910.473] (-930.993) (-919.148) (-924.015) * (-924.392) [-912.673] (-935.094) (-915.254) -- 0:01:19
      758500 -- [-909.289] (-931.727) (-919.100) (-932.535) * [-913.898] (-908.293) (-927.783) (-912.048) -- 0:01:19
      759000 -- (-920.511) (-920.909) (-918.408) [-910.617] * (-922.538) [-911.533] (-917.118) (-929.985) -- 0:01:19
      759500 -- [-914.546] (-924.195) (-924.881) (-915.934) * (-922.884) (-925.444) [-918.726] (-904.655) -- 0:01:18
      760000 -- (-920.744) (-923.170) [-908.723] (-928.308) * (-908.150) (-912.394) (-913.573) [-918.117] -- 0:01:18

      Average standard deviation of split frequencies: 0.008027

      760500 -- (-908.424) [-920.969] (-915.384) (-920.328) * (-916.271) [-910.086] (-928.375) (-913.869) -- 0:01:18
      761000 -- (-918.874) (-919.646) [-916.239] (-920.643) * [-911.931] (-925.037) (-912.728) (-931.265) -- 0:01:18
      761500 -- [-915.916] (-911.926) (-931.785) (-927.725) * [-909.440] (-918.318) (-918.058) (-916.543) -- 0:01:18
      762000 -- [-916.174] (-918.075) (-927.726) (-928.486) * (-910.363) (-917.567) (-913.563) [-919.123] -- 0:01:18
      762500 -- (-912.239) (-911.439) (-942.090) [-920.113] * [-918.647] (-913.696) (-914.644) (-917.235) -- 0:01:17
      763000 -- (-921.804) [-920.135] (-937.539) (-933.100) * (-922.263) (-918.962) (-914.716) [-912.057] -- 0:01:17
      763500 -- (-925.644) (-909.275) (-933.404) [-917.032] * (-930.326) (-916.700) (-919.840) [-913.625] -- 0:01:17
      764000 -- (-917.752) (-926.303) (-915.678) [-911.496] * (-927.029) (-916.594) [-925.084] (-927.071) -- 0:01:17
      764500 -- (-921.471) (-913.398) (-920.519) [-909.987] * (-913.910) (-934.281) [-920.748] (-917.207) -- 0:01:17
      765000 -- (-919.243) [-915.370] (-918.293) (-917.608) * (-917.333) [-909.819] (-911.543) (-919.977) -- 0:01:17

      Average standard deviation of split frequencies: 0.008059

      765500 -- (-907.035) (-923.066) [-923.868] (-924.068) * (-917.423) (-927.443) [-911.478] (-932.413) -- 0:01:16
      766000 -- (-921.447) [-919.489] (-913.785) (-929.955) * [-909.579] (-922.016) (-914.953) (-920.120) -- 0:01:16
      766500 -- (-932.668) (-914.817) [-917.918] (-922.718) * (-937.981) [-910.388] (-934.491) (-920.863) -- 0:01:16
      767000 -- (-910.666) [-923.544] (-920.908) (-926.363) * [-916.583] (-911.325) (-920.022) (-911.395) -- 0:01:16
      767500 -- (-922.279) [-916.949] (-934.374) (-926.221) * (-914.063) (-927.194) (-936.692) [-911.799] -- 0:01:16
      768000 -- (-922.777) [-911.690] (-916.243) (-922.122) * (-920.720) [-917.783] (-923.673) (-911.061) -- 0:01:15
      768500 -- [-905.250] (-933.174) (-932.717) (-918.987) * (-923.893) (-923.897) (-925.407) [-922.288] -- 0:01:15
      769000 -- (-923.482) (-916.503) (-914.569) [-924.313] * (-931.631) [-910.555] (-935.259) (-925.819) -- 0:01:15
      769500 -- (-924.074) (-932.889) [-915.687] (-925.525) * (-922.784) [-919.919] (-926.563) (-919.507) -- 0:01:15
      770000 -- (-923.580) (-921.640) [-909.844] (-925.704) * (-912.777) [-918.904] (-919.650) (-933.819) -- 0:01:15

      Average standard deviation of split frequencies: 0.008961

      770500 -- (-926.394) (-927.170) [-914.173] (-923.087) * (-944.400) (-910.834) [-918.433] (-927.878) -- 0:01:15
      771000 -- (-938.264) (-923.210) (-916.446) [-914.090] * (-938.604) (-921.511) [-909.629] (-933.375) -- 0:01:14
      771500 -- (-926.598) (-926.378) (-911.915) [-905.207] * (-927.905) [-914.318] (-911.796) (-931.335) -- 0:01:14
      772000 -- (-918.143) (-937.238) (-917.295) [-920.396] * (-928.011) (-927.429) [-907.603] (-912.096) -- 0:01:14
      772500 -- (-917.095) (-914.263) [-908.754] (-918.566) * (-936.200) [-917.184] (-916.774) (-914.412) -- 0:01:14
      773000 -- (-916.315) (-926.939) [-920.565] (-918.722) * (-942.282) (-910.645) (-918.795) [-913.618] -- 0:01:14
      773500 -- (-927.326) (-934.236) (-919.564) [-910.127] * (-909.579) (-927.339) (-916.207) [-911.419] -- 0:01:14
      774000 -- (-926.260) (-920.883) (-927.100) [-906.627] * (-911.664) [-918.758] (-918.073) (-919.632) -- 0:01:13
      774500 -- (-911.200) (-930.888) (-915.805) [-913.169] * (-917.819) (-944.408) [-914.462] (-925.765) -- 0:01:13
      775000 -- (-918.387) (-911.827) [-908.031] (-923.282) * (-929.094) [-904.098] (-912.023) (-917.096) -- 0:01:13

      Average standard deviation of split frequencies: 0.009234

      775500 -- (-936.229) (-917.404) (-923.733) [-920.821] * (-933.437) [-912.401] (-912.082) (-923.936) -- 0:01:13
      776000 -- [-915.770] (-916.742) (-925.024) (-923.806) * (-925.723) (-919.296) [-907.014] (-919.075) -- 0:01:13
      776500 -- (-910.208) (-919.482) (-922.604) [-925.509] * (-916.117) (-929.137) (-919.949) [-913.992] -- 0:01:13
      777000 -- [-916.013] (-929.538) (-919.242) (-914.422) * (-915.425) [-910.866] (-913.705) (-921.405) -- 0:01:12
      777500 -- [-916.695] (-922.363) (-924.511) (-922.309) * [-912.763] (-931.489) (-905.193) (-923.776) -- 0:01:12
      778000 -- [-913.366] (-933.116) (-922.495) (-913.576) * (-927.296) (-919.574) (-918.041) [-918.450] -- 0:01:12
      778500 -- [-912.312] (-935.449) (-924.474) (-917.065) * [-913.774] (-906.848) (-922.507) (-915.421) -- 0:01:12
      779000 -- (-925.015) (-935.765) (-917.422) [-903.895] * [-912.728] (-917.154) (-920.850) (-915.595) -- 0:01:12
      779500 -- (-934.979) (-922.163) (-922.867) [-910.550] * [-912.626] (-922.890) (-918.904) (-919.566) -- 0:01:12
      780000 -- (-922.127) (-937.441) (-915.325) [-924.278] * [-909.650] (-932.517) (-917.940) (-949.633) -- 0:01:11

      Average standard deviation of split frequencies: 0.009269

      780500 -- [-919.411] (-919.629) (-924.923) (-927.576) * (-912.458) [-914.338] (-926.734) (-928.519) -- 0:01:11
      781000 -- [-906.961] (-911.295) (-923.449) (-931.561) * (-927.351) [-926.578] (-913.318) (-932.605) -- 0:01:11
      781500 -- [-922.527] (-914.530) (-938.404) (-930.194) * (-919.428) (-931.142) [-909.064] (-922.344) -- 0:01:11
      782000 -- (-912.974) (-917.777) [-907.948] (-927.301) * [-917.882] (-942.053) (-905.638) (-922.205) -- 0:01:11
      782500 -- (-921.980) (-916.001) (-910.291) [-923.134] * (-928.997) (-940.543) [-918.952] (-935.892) -- 0:01:11
      783000 -- (-950.127) (-940.953) (-913.696) [-906.192] * [-909.659] (-921.355) (-917.739) (-928.020) -- 0:01:10
      783500 -- (-945.229) (-921.246) [-912.471] (-916.827) * (-915.447) [-924.840] (-919.357) (-927.322) -- 0:01:10
      784000 -- (-921.252) [-916.703] (-924.581) (-924.561) * [-919.773] (-917.245) (-923.590) (-926.055) -- 0:01:10
      784500 -- (-938.137) [-917.653] (-911.770) (-919.458) * [-908.329] (-923.749) (-918.330) (-921.518) -- 0:01:10
      785000 -- (-914.799) (-925.926) [-908.316] (-924.975) * [-909.188] (-931.881) (-939.079) (-917.122) -- 0:01:10

      Average standard deviation of split frequencies: 0.008621

      785500 -- (-914.033) (-928.933) [-912.205] (-925.316) * [-910.043] (-917.849) (-937.352) (-939.288) -- 0:01:10
      786000 -- (-916.624) (-918.715) [-915.234] (-936.862) * (-914.086) (-918.614) (-924.862) [-916.536] -- 0:01:09
      786500 -- (-916.595) (-925.588) (-918.435) [-917.168] * (-914.430) [-919.405] (-924.287) (-927.928) -- 0:01:09
      787000 -- [-912.785] (-941.286) (-911.372) (-914.496) * (-919.638) [-906.802] (-927.342) (-917.153) -- 0:01:09
      787500 -- [-910.277] (-930.259) (-912.492) (-913.677) * [-916.893] (-912.375) (-920.224) (-922.688) -- 0:01:09
      788000 -- [-913.976] (-932.315) (-931.753) (-916.915) * (-925.160) (-911.589) (-929.797) [-916.067] -- 0:01:09
      788500 -- (-918.794) (-922.910) (-926.198) [-907.846] * (-932.473) (-911.314) (-923.614) [-918.101] -- 0:01:08
      789000 -- (-942.154) (-919.835) (-915.219) [-909.479] * (-930.453) (-914.209) (-938.077) [-917.855] -- 0:01:08
      789500 -- (-919.226) (-919.195) [-907.937] (-912.914) * [-909.113] (-918.931) (-928.429) (-928.996) -- 0:01:08
      790000 -- (-929.162) (-914.039) (-915.685) [-928.500] * [-908.141] (-929.390) (-915.583) (-922.007) -- 0:01:08

      Average standard deviation of split frequencies: 0.007414

      790500 -- (-926.888) [-908.822] (-910.711) (-911.234) * (-924.710) (-922.471) (-926.934) [-916.776] -- 0:01:08
      791000 -- (-908.494) [-910.679] (-917.025) (-920.611) * (-934.496) (-910.044) [-909.856] (-924.026) -- 0:01:08
      791500 -- [-916.601] (-921.630) (-922.306) (-914.482) * (-929.781) [-914.085] (-909.351) (-925.485) -- 0:01:07
      792000 -- (-919.427) (-927.879) (-925.604) [-913.879] * (-912.576) [-916.717] (-915.108) (-915.276) -- 0:01:08
      792500 -- [-922.664] (-922.339) (-915.064) (-918.148) * (-915.727) (-927.548) [-926.582] (-935.298) -- 0:01:07
      793000 -- [-919.438] (-915.888) (-915.471) (-920.424) * (-916.860) (-916.254) [-916.163] (-934.222) -- 0:01:07
      793500 -- (-931.135) (-924.359) (-911.594) [-915.046] * [-922.440] (-921.846) (-918.051) (-922.397) -- 0:01:07
      794000 -- (-921.458) (-919.730) (-926.600) [-908.196] * (-927.181) [-924.173] (-910.451) (-915.894) -- 0:01:07
      794500 -- (-938.828) [-909.382] (-911.085) (-911.219) * (-938.373) (-922.746) [-923.726] (-931.985) -- 0:01:06
      795000 -- (-941.278) (-920.718) (-919.162) [-916.216] * (-910.714) (-912.869) (-925.415) [-915.488] -- 0:01:06

      Average standard deviation of split frequencies: 0.007931

      795500 -- (-932.924) (-933.132) (-923.122) [-921.249] * [-921.838] (-909.767) (-921.131) (-952.865) -- 0:01:06
      796000 -- (-927.222) [-912.865] (-918.689) (-913.896) * (-916.899) (-920.032) [-913.719] (-933.029) -- 0:01:06
      796500 -- (-918.025) (-915.433) (-926.734) [-919.001] * (-913.991) [-915.001] (-916.353) (-937.990) -- 0:01:06
      797000 -- (-913.478) (-918.196) (-930.307) [-920.200] * (-914.215) (-913.074) [-907.809] (-936.284) -- 0:01:06
      797500 -- (-923.042) [-906.880] (-914.533) (-918.024) * (-915.204) (-926.491) [-911.548] (-926.931) -- 0:01:06
      798000 -- (-916.706) (-925.733) [-923.756] (-919.917) * [-910.329] (-912.711) (-918.714) (-928.231) -- 0:01:05
      798500 -- (-929.117) (-938.449) (-920.062) [-903.711] * (-914.659) (-934.051) (-907.964) [-907.276] -- 0:01:05
      799000 -- (-913.309) [-916.063] (-924.605) (-935.770) * (-927.021) [-918.008] (-928.512) (-911.027) -- 0:01:05
      799500 -- [-911.205] (-914.987) (-908.358) (-918.570) * [-906.921] (-920.226) (-912.783) (-924.991) -- 0:01:05
      800000 -- (-923.394) (-910.707) [-915.817] (-916.742) * (-933.738) [-913.094] (-927.293) (-927.918) -- 0:01:05

      Average standard deviation of split frequencies: 0.007681

      800500 -- [-919.277] (-915.268) (-931.805) (-942.196) * [-910.921] (-915.181) (-913.070) (-915.591) -- 0:01:05
      801000 -- [-922.986] (-924.615) (-919.193) (-931.006) * [-912.052] (-933.093) (-912.135) (-912.541) -- 0:01:04
      801500 -- [-915.313] (-923.114) (-915.417) (-928.091) * (-906.351) [-915.449] (-929.413) (-923.780) -- 0:01:04
      802000 -- [-919.706] (-910.031) (-917.834) (-921.323) * [-907.372] (-918.162) (-923.401) (-924.542) -- 0:01:04
      802500 -- (-924.136) (-911.087) (-918.501) [-907.875] * [-910.856] (-922.275) (-919.779) (-919.962) -- 0:01:04
      803000 -- (-921.130) (-909.472) [-912.059] (-914.722) * (-912.172) (-936.183) [-916.359] (-938.902) -- 0:01:04
      803500 -- [-912.522] (-919.971) (-914.605) (-921.249) * (-923.893) (-927.125) (-908.190) [-915.206] -- 0:01:04
      804000 -- [-912.947] (-922.714) (-912.697) (-927.256) * [-914.304] (-938.687) (-917.437) (-914.326) -- 0:01:03
      804500 -- (-912.759) [-909.780] (-919.293) (-924.501) * [-907.694] (-931.876) (-919.153) (-916.575) -- 0:01:03
      805000 -- (-908.029) (-927.729) [-909.711] (-919.362) * [-922.189] (-918.190) (-914.920) (-921.497) -- 0:01:03

      Average standard deviation of split frequencies: 0.007993

      805500 -- (-911.312) (-916.712) [-909.432] (-917.476) * (-929.347) (-919.651) [-906.039] (-925.097) -- 0:01:03
      806000 -- [-917.059] (-915.164) (-909.028) (-933.602) * [-912.332] (-920.280) (-913.652) (-928.864) -- 0:01:03
      806500 -- (-912.973) (-925.234) (-930.175) [-911.523] * (-915.456) [-916.376] (-911.444) (-917.618) -- 0:01:03
      807000 -- (-914.306) [-916.669] (-924.864) (-917.010) * (-914.342) [-913.434] (-930.123) (-916.167) -- 0:01:02
      807500 -- [-906.403] (-915.619) (-922.841) (-923.821) * (-912.993) (-917.058) [-903.294] (-909.877) -- 0:01:02
      808000 -- (-916.863) (-913.717) [-910.369] (-915.233) * (-915.262) (-924.802) (-927.751) [-913.448] -- 0:01:02
      808500 -- (-907.259) (-924.271) (-933.136) [-910.022] * (-919.645) [-928.618] (-912.915) (-926.641) -- 0:01:02
      809000 -- (-931.414) (-912.539) [-915.302] (-919.727) * [-917.620] (-939.159) (-920.025) (-925.392) -- 0:01:02
      809500 -- (-931.471) (-922.798) [-905.019] (-916.138) * [-915.169] (-924.896) (-916.142) (-927.561) -- 0:01:02
      810000 -- [-921.120] (-922.151) (-907.685) (-933.271) * (-921.906) (-914.470) [-922.846] (-915.351) -- 0:01:01

      Average standard deviation of split frequencies: 0.008383

      810500 -- [-917.673] (-935.946) (-925.428) (-922.538) * [-912.034] (-923.385) (-931.429) (-914.721) -- 0:01:01
      811000 -- [-913.264] (-920.362) (-922.606) (-917.133) * (-915.681) (-912.243) (-947.000) [-912.872] -- 0:01:01
      811500 -- [-918.252] (-918.715) (-916.306) (-931.919) * (-927.806) (-917.487) (-918.487) [-915.842] -- 0:01:01
      812000 -- (-927.896) (-917.912) [-913.891] (-921.013) * (-928.030) [-928.589] (-929.908) (-916.113) -- 0:01:01
      812500 -- (-921.731) (-918.100) [-914.004] (-926.169) * (-927.808) (-909.782) (-923.529) [-917.560] -- 0:01:01
      813000 -- (-912.997) (-904.841) (-914.153) [-908.149] * (-932.364) (-918.756) [-919.015] (-912.996) -- 0:01:00
      813500 -- (-909.570) (-916.312) [-908.418] (-915.081) * (-936.618) (-921.198) (-929.654) [-910.298] -- 0:01:00
      814000 -- [-910.163] (-940.910) (-908.445) (-914.411) * (-929.603) (-909.483) [-910.539] (-909.826) -- 0:01:00
      814500 -- (-922.250) (-923.550) (-915.985) [-906.897] * (-916.931) (-912.928) (-917.057) [-911.085] -- 0:01:00
      815000 -- (-918.334) (-928.299) (-912.083) [-914.845] * (-915.234) (-919.202) (-918.688) [-904.651] -- 0:01:00

      Average standard deviation of split frequencies: 0.008064

      815500 -- (-924.316) (-914.388) [-927.126] (-920.910) * (-913.873) (-906.364) (-924.097) [-908.287] -- 0:01:00
      816000 -- (-919.989) (-923.487) [-921.369] (-930.574) * [-922.324] (-934.275) (-919.614) (-910.438) -- 0:00:59
      816500 -- [-906.128] (-920.086) (-925.140) (-920.472) * (-918.386) [-918.347] (-921.489) (-912.660) -- 0:00:59
      817000 -- [-914.942] (-915.692) (-928.339) (-933.826) * [-908.803] (-930.534) (-911.321) (-923.984) -- 0:00:59
      817500 -- [-918.538] (-929.739) (-924.153) (-913.967) * (-917.573) (-920.699) [-917.917] (-914.223) -- 0:00:59
      818000 -- (-926.397) (-926.833) (-918.683) [-925.068] * (-911.346) (-918.270) [-911.280] (-918.596) -- 0:00:59
      818500 -- (-919.596) (-919.576) (-914.187) [-916.949] * (-928.842) (-930.599) (-914.460) [-926.119] -- 0:00:59
      819000 -- [-913.422] (-911.979) (-928.790) (-915.708) * (-911.699) (-920.838) [-914.183] (-921.700) -- 0:00:59
      819500 -- (-912.029) [-912.185] (-933.870) (-934.404) * (-910.855) [-907.988] (-922.430) (-920.031) -- 0:00:58
      820000 -- (-913.575) (-921.457) [-910.165] (-918.797) * (-918.286) (-917.181) [-914.866] (-919.178) -- 0:00:58

      Average standard deviation of split frequencies: 0.008042

      820500 -- (-917.189) [-911.205] (-913.797) (-926.871) * (-923.832) (-908.389) [-903.933] (-924.280) -- 0:00:58
      821000 -- (-918.098) (-913.565) [-919.145] (-933.503) * (-919.487) (-913.307) (-919.121) [-907.438] -- 0:00:58
      821500 -- (-933.822) [-922.456] (-921.980) (-948.335) * (-915.844) [-905.658] (-921.337) (-916.907) -- 0:00:58
      822000 -- [-927.071] (-912.061) (-916.941) (-924.638) * (-919.129) (-910.666) (-929.777) [-903.319] -- 0:00:58
      822500 -- [-915.926] (-913.573) (-907.661) (-931.499) * (-918.721) (-928.643) (-916.353) [-905.523] -- 0:00:57
      823000 -- (-910.834) [-919.324] (-917.425) (-925.286) * (-916.429) (-917.554) (-919.958) [-917.938] -- 0:00:57
      823500 -- (-924.970) (-919.489) [-922.928] (-923.561) * (-923.649) [-920.055] (-922.009) (-917.352) -- 0:00:57
      824000 -- [-906.361] (-922.201) (-919.411) (-935.001) * (-924.265) (-912.639) [-915.226] (-915.532) -- 0:00:57
      824500 -- [-904.644] (-909.082) (-918.718) (-923.734) * (-917.293) (-912.996) [-921.435] (-921.783) -- 0:00:57
      825000 -- [-913.877] (-908.253) (-928.555) (-919.962) * (-915.347) (-907.283) [-916.216] (-945.277) -- 0:00:57

      Average standard deviation of split frequencies: 0.008486

      825500 -- (-911.917) (-926.216) [-909.179] (-915.157) * (-919.037) (-912.752) (-929.695) [-918.531] -- 0:00:56
      826000 -- [-922.159] (-926.610) (-913.179) (-912.383) * (-919.873) [-906.540] (-928.092) (-922.155) -- 0:00:56
      826500 -- [-917.255] (-916.341) (-908.903) (-927.243) * (-930.676) (-922.260) [-918.059] (-932.349) -- 0:00:56
      827000 -- (-909.270) (-926.686) (-911.255) [-909.680] * (-913.004) (-928.946) (-921.988) [-910.263] -- 0:00:56
      827500 -- (-918.189) (-917.569) [-912.603] (-911.881) * (-932.349) [-915.365] (-934.295) (-921.463) -- 0:00:56
      828000 -- (-928.374) (-924.832) (-919.777) [-907.653] * [-914.479] (-924.721) (-919.994) (-916.308) -- 0:00:56
      828500 -- (-919.236) (-922.238) [-914.649] (-920.529) * (-924.502) (-927.745) [-922.126] (-921.420) -- 0:00:55
      829000 -- (-923.147) (-919.060) (-909.981) [-914.961] * [-912.552] (-909.436) (-934.373) (-949.403) -- 0:00:55
      829500 -- (-922.189) [-914.770] (-926.654) (-920.806) * [-919.003] (-924.087) (-929.117) (-919.202) -- 0:00:55
      830000 -- (-918.192) (-925.616) (-932.344) [-910.296] * (-923.005) [-917.504] (-919.267) (-921.296) -- 0:00:55

      Average standard deviation of split frequencies: 0.007992

      830500 -- (-928.850) (-928.775) [-923.653] (-909.291) * (-920.157) [-919.893] (-933.973) (-912.780) -- 0:00:55
      831000 -- (-924.086) (-923.314) [-918.418] (-911.653) * (-920.346) (-917.068) (-924.706) [-925.233] -- 0:00:55
      831500 -- (-939.737) (-913.614) [-920.186] (-920.419) * (-939.171) (-920.118) (-920.713) [-912.164] -- 0:00:54
      832000 -- (-926.200) (-914.020) [-924.066] (-914.565) * (-923.502) (-926.041) (-913.604) [-916.295] -- 0:00:54
      832500 -- (-926.115) [-908.859] (-921.147) (-924.829) * (-922.525) (-918.285) [-913.362] (-920.641) -- 0:00:54
      833000 -- (-927.718) [-928.307] (-919.992) (-911.363) * [-911.352] (-920.991) (-912.139) (-942.194) -- 0:00:54
      833500 -- (-910.808) [-905.162] (-914.680) (-933.831) * (-908.608) (-914.726) [-904.895] (-908.116) -- 0:00:54
      834000 -- (-926.096) (-914.646) (-913.039) [-918.122] * (-918.881) [-918.350] (-923.642) (-921.524) -- 0:00:54
      834500 -- (-919.381) (-916.769) (-913.051) [-917.384] * (-920.759) (-912.159) [-905.362] (-912.360) -- 0:00:53
      835000 -- (-911.490) (-917.617) [-919.945] (-916.932) * [-921.835] (-916.407) (-920.032) (-916.427) -- 0:00:53

      Average standard deviation of split frequencies: 0.008200

      835500 -- (-918.879) (-922.683) [-910.392] (-918.335) * [-911.986] (-917.844) (-931.476) (-916.707) -- 0:00:53
      836000 -- [-904.329] (-921.327) (-909.391) (-938.468) * [-914.461] (-919.427) (-942.812) (-925.606) -- 0:00:53
      836500 -- (-909.959) [-913.153] (-911.458) (-919.738) * (-918.383) [-916.481] (-934.511) (-918.777) -- 0:00:53
      837000 -- (-920.988) (-916.567) [-914.786] (-936.183) * (-912.597) (-912.230) [-918.232] (-919.014) -- 0:00:53
      837500 -- (-921.929) (-919.096) [-914.050] (-924.743) * (-917.530) [-911.718] (-926.110) (-930.580) -- 0:00:52
      838000 -- [-920.941] (-921.286) (-920.928) (-922.234) * (-918.208) [-909.203] (-919.864) (-936.668) -- 0:00:52
      838500 -- (-929.264) [-906.973] (-919.612) (-915.986) * (-917.788) (-930.394) [-924.344] (-921.675) -- 0:00:52
      839000 -- (-916.647) [-918.887] (-937.303) (-925.658) * [-913.206] (-935.100) (-921.953) (-916.710) -- 0:00:52
      839500 -- (-911.560) (-916.249) [-919.400] (-926.590) * (-917.605) (-936.788) (-915.326) [-918.258] -- 0:00:52
      840000 -- (-918.492) [-916.228] (-924.677) (-925.140) * (-924.465) (-926.586) [-910.944] (-915.267) -- 0:00:52

      Average standard deviation of split frequencies: 0.007710

      840500 -- (-931.027) [-916.031] (-919.040) (-924.285) * (-914.487) (-924.591) (-933.825) [-914.652] -- 0:00:51
      841000 -- [-914.357] (-914.565) (-926.381) (-918.287) * [-909.411] (-909.219) (-933.894) (-924.720) -- 0:00:51
      841500 -- (-931.647) (-925.966) (-917.131) [-909.510] * (-911.519) (-921.166) (-919.065) [-913.284] -- 0:00:51
      842000 -- (-907.030) [-911.366] (-910.362) (-923.432) * (-918.217) (-912.164) (-922.710) [-911.315] -- 0:00:51
      842500 -- (-924.579) [-909.993] (-926.782) (-908.385) * (-916.615) (-910.650) (-905.763) [-915.804] -- 0:00:51
      843000 -- (-943.307) [-911.912] (-925.019) (-928.501) * (-924.138) [-912.828] (-915.323) (-914.809) -- 0:00:51
      843500 -- (-919.605) (-930.396) (-919.684) [-908.521] * [-910.495] (-923.896) (-922.482) (-937.929) -- 0:00:51
      844000 -- (-929.963) (-924.836) (-914.684) [-916.149] * (-920.928) (-920.630) [-927.447] (-923.990) -- 0:00:50
      844500 -- (-917.786) (-930.929) [-909.451] (-922.966) * (-932.002) (-914.146) [-920.587] (-936.411) -- 0:00:50
      845000 -- [-911.849] (-932.398) (-919.233) (-933.578) * (-912.461) [-915.804] (-921.515) (-920.242) -- 0:00:50

      Average standard deviation of split frequencies: 0.007221

      845500 -- (-930.235) (-923.068) (-913.943) [-920.550] * (-917.409) (-919.809) [-911.091] (-924.691) -- 0:00:50
      846000 -- [-922.425] (-944.135) (-927.782) (-925.168) * (-923.165) (-924.299) [-910.159] (-931.833) -- 0:00:50
      846500 -- (-932.195) (-922.149) (-924.312) [-919.705] * (-918.177) (-923.375) [-913.925] (-923.585) -- 0:00:50
      847000 -- (-921.584) [-904.344] (-930.938) (-927.055) * [-908.932] (-919.413) (-919.254) (-928.196) -- 0:00:49
      847500 -- (-925.237) (-919.606) (-919.430) [-918.409] * [-908.620] (-935.644) (-913.236) (-916.414) -- 0:00:49
      848000 -- (-923.821) [-913.081] (-919.775) (-924.349) * (-917.058) (-942.064) (-925.988) [-916.315] -- 0:00:49
      848500 -- (-926.758) (-912.748) [-910.680] (-916.697) * (-925.503) (-923.381) (-938.739) [-918.373] -- 0:00:49
      849000 -- (-909.384) [-916.525] (-917.039) (-940.171) * (-932.308) [-914.040] (-928.028) (-916.736) -- 0:00:49
      849500 -- (-920.411) (-919.236) (-925.742) [-912.684] * (-926.635) (-938.995) (-930.408) [-914.620] -- 0:00:49
      850000 -- (-911.532) (-925.072) [-913.795] (-929.528) * (-920.550) (-921.958) (-917.886) [-912.534] -- 0:00:48

      Average standard deviation of split frequencies: 0.007389

      850500 -- [-921.213] (-929.824) (-917.195) (-916.968) * (-931.027) (-927.122) (-924.287) [-906.871] -- 0:00:48
      851000 -- (-935.757) (-919.173) [-905.528] (-923.362) * (-920.742) (-926.980) [-923.203] (-928.620) -- 0:00:48
      851500 -- (-926.522) (-916.580) [-909.901] (-921.550) * (-931.680) (-922.337) [-912.757] (-928.304) -- 0:00:48
      852000 -- (-913.005) (-925.459) [-913.514] (-913.909) * (-919.647) (-915.823) [-906.064] (-914.176) -- 0:00:48
      852500 -- (-935.160) [-929.648] (-915.834) (-917.543) * [-917.125] (-925.291) (-909.327) (-921.434) -- 0:00:48
      853000 -- (-934.808) [-912.913] (-914.872) (-908.489) * (-928.763) [-909.088] (-918.631) (-915.105) -- 0:00:47
      853500 -- (-912.236) [-914.604] (-920.554) (-921.166) * [-908.342] (-925.358) (-923.056) (-921.416) -- 0:00:47
      854000 -- [-912.988] (-921.440) (-918.755) (-916.981) * (-924.763) (-914.956) (-908.391) [-911.591] -- 0:00:47
      854500 -- (-924.931) [-910.311] (-929.819) (-932.935) * [-920.608] (-914.358) (-915.833) (-905.874) -- 0:00:47
      855000 -- (-927.228) [-903.075] (-920.752) (-919.855) * (-929.566) (-914.011) (-921.431) [-916.206] -- 0:00:47

      Average standard deviation of split frequencies: 0.007183

      855500 -- (-921.800) [-912.206] (-933.156) (-915.806) * [-918.099] (-914.292) (-925.384) (-915.804) -- 0:00:47
      856000 -- (-915.123) [-912.561] (-933.113) (-916.337) * [-924.627] (-915.841) (-928.195) (-925.560) -- 0:00:46
      856500 -- (-921.565) (-929.149) [-924.184] (-927.553) * (-911.809) [-910.402] (-926.065) (-929.051) -- 0:00:46
      857000 -- (-927.415) (-913.393) (-916.626) [-920.172] * (-912.396) [-913.619] (-918.733) (-917.221) -- 0:00:46
      857500 -- (-928.928) (-917.878) (-915.489) [-913.981] * [-913.354] (-915.958) (-910.538) (-930.087) -- 0:00:46
      858000 -- (-938.779) [-908.399] (-926.080) (-910.707) * (-920.802) [-917.803] (-918.259) (-917.927) -- 0:00:46
      858500 -- (-936.613) [-912.833] (-921.979) (-910.479) * (-920.624) (-910.570) (-916.121) [-913.490] -- 0:00:46
      859000 -- (-931.603) (-920.532) [-912.017] (-917.316) * (-926.301) (-920.072) (-922.869) [-904.681] -- 0:00:45
      859500 -- (-937.689) [-908.989] (-921.475) (-909.811) * (-925.604) [-912.615] (-913.764) (-929.972) -- 0:00:45
      860000 -- (-928.406) [-900.741] (-916.817) (-920.172) * (-927.119) [-915.851] (-918.980) (-954.290) -- 0:00:45

      Average standard deviation of split frequencies: 0.008033

      860500 -- (-928.804) [-915.044] (-920.597) (-928.404) * [-911.122] (-923.263) (-919.255) (-953.521) -- 0:00:45
      861000 -- (-938.763) (-927.415) (-922.424) [-908.493] * (-933.193) (-920.544) [-916.613] (-928.726) -- 0:00:45
      861500 -- (-911.474) (-917.503) (-951.445) [-906.317] * (-931.466) (-902.357) (-921.455) [-912.460] -- 0:00:45
      862000 -- (-919.667) (-921.372) (-951.462) [-913.815] * (-926.578) [-909.239] (-935.627) (-923.136) -- 0:00:44
      862500 -- (-940.290) (-919.654) [-922.603] (-915.332) * (-923.315) (-925.126) (-913.599) [-924.753] -- 0:00:44
      863000 -- (-921.855) (-920.290) (-930.686) [-920.789] * (-917.018) (-940.634) (-916.964) [-912.245] -- 0:00:44
      863500 -- [-912.691] (-917.967) (-928.544) (-923.108) * [-904.599] (-903.953) (-918.542) (-913.523) -- 0:00:44
      864000 -- (-918.108) [-922.072] (-926.004) (-920.837) * [-907.641] (-923.803) (-931.023) (-918.011) -- 0:00:44
      864500 -- (-924.862) (-933.729) (-932.722) [-905.633] * (-907.830) (-922.054) [-909.350] (-938.712) -- 0:00:44
      865000 -- (-925.048) (-916.181) (-920.194) [-914.779] * (-913.770) [-928.211] (-937.653) (-926.925) -- 0:00:44

      Average standard deviation of split frequencies: 0.008233

      865500 -- (-916.314) (-928.243) (-919.484) [-914.841] * [-919.526] (-921.403) (-920.454) (-923.638) -- 0:00:43
      866000 -- (-921.100) (-924.932) (-911.530) [-901.962] * (-927.914) [-908.343] (-925.901) (-924.717) -- 0:00:43
      866500 -- (-925.033) (-918.825) (-915.056) [-916.373] * (-935.673) (-922.828) [-912.630] (-915.792) -- 0:00:43
      867000 -- [-908.520] (-918.390) (-925.349) (-917.691) * (-918.707) [-904.928] (-920.566) (-927.858) -- 0:00:43
      867500 -- [-916.694] (-909.483) (-940.356) (-924.503) * (-917.482) [-908.395] (-910.845) (-920.876) -- 0:00:43
      868000 -- [-920.092] (-919.960) (-933.760) (-926.467) * (-922.187) (-923.719) [-920.697] (-920.882) -- 0:00:43
      868500 -- (-922.666) (-924.356) [-925.779] (-932.378) * (-910.255) (-926.424) (-920.844) [-927.767] -- 0:00:42
      869000 -- (-918.395) (-914.339) (-925.260) [-911.128] * (-908.175) (-947.099) [-908.848] (-922.056) -- 0:00:42
      869500 -- [-912.405] (-917.634) (-915.663) (-908.519) * [-910.753] (-925.268) (-912.452) (-922.347) -- 0:00:42
      870000 -- (-946.290) (-916.581) [-919.944] (-916.468) * (-925.454) (-937.610) [-909.745] (-921.007) -- 0:00:42

      Average standard deviation of split frequencies: 0.007557

      870500 -- (-932.153) (-920.237) (-923.851) [-911.851] * (-909.465) [-909.930] (-922.762) (-922.653) -- 0:00:42
      871000 -- (-916.163) [-918.840] (-925.621) (-916.227) * (-910.041) [-912.190] (-926.475) (-921.313) -- 0:00:42
      871500 -- (-923.285) (-923.433) (-913.647) [-908.151] * (-941.045) [-905.604] (-916.854) (-926.527) -- 0:00:41
      872000 -- (-927.437) (-909.662) (-931.080) [-914.964] * [-913.373] (-920.203) (-916.076) (-916.885) -- 0:00:41
      872500 -- (-920.889) (-924.414) (-920.325) [-919.083] * [-914.964] (-913.112) (-912.348) (-934.243) -- 0:00:41
      873000 -- [-918.377] (-920.598) (-918.871) (-918.261) * [-913.455] (-913.692) (-923.037) (-933.811) -- 0:00:41
      873500 -- (-922.983) [-908.080] (-920.866) (-914.378) * (-919.756) [-916.767] (-911.986) (-926.583) -- 0:00:41
      874000 -- (-921.378) (-915.662) (-912.161) [-911.248] * (-914.684) (-917.099) [-911.321] (-914.000) -- 0:00:41
      874500 -- (-920.570) [-909.512] (-909.576) (-912.846) * (-926.498) (-923.369) (-927.246) [-917.322] -- 0:00:40
      875000 -- [-910.964] (-929.020) (-917.295) (-925.309) * [-915.742] (-926.974) (-928.277) (-907.442) -- 0:00:40

      Average standard deviation of split frequencies: 0.007736

      875500 -- (-925.173) [-917.648] (-923.272) (-924.919) * (-923.346) [-911.626] (-923.073) (-932.480) -- 0:00:40
      876000 -- [-915.937] (-932.534) (-917.348) (-917.035) * [-915.529] (-929.426) (-925.462) (-915.663) -- 0:00:40
      876500 -- (-917.944) (-920.482) [-909.005] (-931.147) * (-918.820) [-922.023] (-952.625) (-912.994) -- 0:00:40
      877000 -- (-916.495) (-921.298) [-910.493] (-942.550) * [-908.365] (-916.794) (-929.208) (-920.307) -- 0:00:40
      877500 -- (-927.650) [-916.351] (-913.369) (-915.620) * (-923.409) (-921.479) (-921.249) [-905.181] -- 0:00:39
      878000 -- (-914.556) [-909.582] (-918.008) (-921.641) * (-923.060) [-909.843] (-926.264) (-916.798) -- 0:00:39
      878500 -- (-918.197) (-914.437) [-918.273] (-916.346) * [-913.545] (-933.625) (-917.742) (-917.260) -- 0:00:39
      879000 -- (-907.782) (-921.554) [-925.371] (-929.859) * (-931.297) [-918.691] (-923.025) (-916.349) -- 0:00:39
      879500 -- (-912.377) (-910.351) (-929.641) [-916.498] * [-914.360] (-919.365) (-921.784) (-922.747) -- 0:00:39
      880000 -- (-921.195) [-911.998] (-918.529) (-912.889) * (-921.812) [-912.980] (-918.778) (-915.939) -- 0:00:39

      Average standard deviation of split frequencies: 0.006869

      880500 -- (-927.809) [-915.925] (-921.182) (-914.832) * (-920.855) (-915.271) (-940.710) [-914.063] -- 0:00:38
      881000 -- (-918.143) [-912.758] (-915.601) (-914.284) * [-914.518] (-912.413) (-927.383) (-922.857) -- 0:00:38
      881500 -- (-925.068) (-926.448) (-936.625) [-907.941] * (-916.323) (-919.468) (-933.378) [-914.243] -- 0:00:38
      882000 -- [-908.797] (-916.320) (-930.990) (-926.070) * (-921.798) [-916.192] (-927.692) (-912.480) -- 0:00:38
      882500 -- (-916.943) (-917.500) [-907.704] (-930.867) * [-905.892] (-933.072) (-921.305) (-915.432) -- 0:00:38
      883000 -- (-934.146) (-919.886) (-904.107) [-907.089] * (-918.649) [-914.749] (-918.155) (-917.426) -- 0:00:38
      883500 -- (-919.424) [-911.148] (-928.267) (-919.242) * (-931.296) [-920.783] (-912.838) (-918.110) -- 0:00:37
      884000 -- (-908.623) [-914.121] (-907.831) (-926.732) * (-932.779) (-917.184) (-937.316) [-914.772] -- 0:00:37
      884500 -- (-929.262) (-922.599) (-917.067) [-922.125] * (-934.304) (-916.145) [-920.590] (-924.443) -- 0:00:37
      885000 -- [-910.319] (-924.957) (-921.022) (-920.302) * (-925.325) (-916.786) [-934.800] (-911.304) -- 0:00:37

      Average standard deviation of split frequencies: 0.007130

      885500 -- (-908.277) (-936.302) (-908.916) [-913.505] * (-930.400) (-921.600) (-929.551) [-932.523] -- 0:00:37
      886000 -- [-915.216] (-933.838) (-906.170) (-919.057) * (-928.881) [-913.645] (-931.152) (-928.435) -- 0:00:37
      886500 -- (-925.430) (-916.459) [-913.107] (-931.444) * (-929.230) (-909.154) (-938.611) [-911.753] -- 0:00:37
      887000 -- [-914.197] (-937.892) (-917.532) (-933.288) * (-926.071) (-918.729) (-926.073) [-919.162] -- 0:00:36
      887500 -- [-908.579] (-934.508) (-918.197) (-920.560) * (-922.112) (-908.412) [-915.069] (-917.166) -- 0:00:36
      888000 -- (-919.364) (-922.760) (-925.935) [-914.278] * (-910.331) (-919.231) (-928.501) [-908.016] -- 0:00:36
      888500 -- (-917.315) (-930.951) [-915.394] (-916.636) * (-921.488) (-928.260) (-932.805) [-908.069] -- 0:00:36
      889000 -- (-926.738) [-912.252] (-917.525) (-935.963) * (-932.022) (-914.242) (-940.199) [-912.365] -- 0:00:36
      889500 -- (-926.918) (-923.746) [-913.602] (-933.644) * (-930.261) (-923.787) (-928.164) [-908.012] -- 0:00:36
      890000 -- [-912.912] (-917.789) (-908.887) (-920.176) * (-930.147) (-921.115) (-930.089) [-919.998] -- 0:00:35

      Average standard deviation of split frequencies: 0.007029

      890500 -- (-919.562) [-922.986] (-917.657) (-920.509) * (-915.912) (-918.884) (-921.252) [-917.536] -- 0:00:35
      891000 -- (-919.430) (-925.372) (-911.827) [-909.734] * (-924.259) (-922.689) (-946.054) [-909.669] -- 0:00:35
      891500 -- [-928.078] (-934.760) (-917.984) (-917.313) * (-911.079) (-923.628) (-934.267) [-904.186] -- 0:00:35
      892000 -- (-921.581) (-935.271) (-911.466) [-914.176] * (-920.042) (-913.417) [-922.090] (-910.490) -- 0:00:35
      892500 -- [-917.576] (-928.545) (-918.385) (-912.494) * (-911.249) (-922.920) (-920.577) [-903.144] -- 0:00:35
      893000 -- [-914.587] (-929.424) (-910.097) (-931.114) * (-912.682) (-926.605) [-908.585] (-931.506) -- 0:00:34
      893500 -- (-922.462) (-923.374) [-904.863] (-929.213) * (-913.238) (-915.559) [-922.593] (-927.884) -- 0:00:34
      894000 -- (-918.083) (-934.079) [-913.856] (-920.968) * (-909.423) (-928.005) [-908.902] (-920.679) -- 0:00:34
      894500 -- [-908.857] (-941.054) (-915.700) (-930.850) * (-923.650) (-926.984) (-917.627) [-905.494] -- 0:00:34
      895000 -- (-928.496) (-927.296) (-920.585) [-916.653] * (-916.829) (-921.147) [-913.389] (-929.512) -- 0:00:34

      Average standard deviation of split frequencies: 0.006840

      895500 -- (-912.890) (-948.606) [-922.512] (-910.184) * [-915.243] (-940.678) (-909.403) (-943.786) -- 0:00:34
      896000 -- (-921.299) (-933.423) (-916.083) [-912.060] * [-905.976] (-915.070) (-917.131) (-919.806) -- 0:00:33
      896500 -- (-930.332) (-916.696) (-922.159) [-920.777] * (-914.677) (-916.410) (-915.486) [-913.517] -- 0:00:33
      897000 -- (-916.026) (-911.934) [-910.884] (-923.635) * (-933.835) (-927.899) [-911.581] (-912.827) -- 0:00:33
      897500 -- (-913.871) (-925.757) [-917.040] (-927.369) * (-913.667) (-931.423) (-908.430) [-919.717] -- 0:00:33
      898000 -- (-922.611) (-921.429) [-912.765] (-919.777) * (-915.223) [-926.757] (-916.387) (-931.798) -- 0:00:33
      898500 -- (-926.229) (-927.590) [-913.258] (-910.105) * (-923.717) (-915.224) [-915.380] (-917.223) -- 0:00:33
      899000 -- (-920.964) (-937.359) [-910.746] (-920.373) * (-918.538) [-923.272] (-922.038) (-926.337) -- 0:00:32
      899500 -- [-906.673] (-919.892) (-916.154) (-918.155) * (-917.661) (-908.310) (-938.946) [-913.904] -- 0:00:32
      900000 -- (-908.665) [-907.521] (-917.761) (-921.639) * (-933.962) [-918.403] (-919.795) (-913.541) -- 0:00:32

      Average standard deviation of split frequencies: 0.006574

      900500 -- [-908.839] (-923.060) (-910.279) (-920.872) * (-920.925) (-919.216) (-924.578) [-916.919] -- 0:00:32
      901000 -- [-916.701] (-906.616) (-923.889) (-919.591) * (-908.825) [-909.886] (-920.674) (-912.101) -- 0:00:32
      901500 -- (-914.337) [-911.283] (-925.803) (-930.325) * [-914.088] (-918.724) (-924.035) (-921.060) -- 0:00:32
      902000 -- [-911.139] (-931.846) (-930.139) (-917.893) * (-922.041) (-928.258) (-918.362) [-920.812] -- 0:00:31
      902500 -- (-911.948) (-917.397) [-913.445] (-925.848) * [-910.106] (-919.458) (-915.985) (-912.898) -- 0:00:31
      903000 -- (-910.625) [-910.360] (-923.755) (-916.915) * (-915.042) (-921.152) (-923.216) [-912.578] -- 0:00:31
      903500 -- (-910.997) (-919.890) [-913.792] (-913.563) * (-909.829) (-926.368) (-918.021) [-905.853] -- 0:00:31
      904000 -- [-914.551] (-924.276) (-940.150) (-926.715) * (-916.397) (-950.145) (-931.768) [-906.578] -- 0:00:31
      904500 -- (-921.184) [-912.021] (-923.372) (-929.192) * (-921.714) [-925.089] (-921.987) (-918.005) -- 0:00:31
      905000 -- (-919.566) (-920.256) [-910.050] (-923.701) * (-925.670) [-920.297] (-934.345) (-928.875) -- 0:00:30

      Average standard deviation of split frequencies: 0.006872

      905500 -- [-916.458] (-922.647) (-928.541) (-924.138) * (-923.851) (-925.821) [-908.329] (-916.930) -- 0:00:30
      906000 -- (-927.229) [-906.797] (-930.154) (-924.471) * (-925.102) (-931.599) [-909.556] (-928.420) -- 0:00:30
      906500 -- (-915.020) [-912.074] (-925.587) (-928.809) * [-910.394] (-933.251) (-904.829) (-923.386) -- 0:00:30
      907000 -- [-911.796] (-918.045) (-921.018) (-916.045) * [-927.194] (-925.247) (-916.322) (-911.278) -- 0:00:30
      907500 -- [-906.660] (-922.656) (-933.828) (-917.735) * (-912.018) (-922.089) (-925.487) [-912.625] -- 0:00:30
      908000 -- (-920.011) [-905.730] (-928.346) (-912.947) * [-915.376] (-931.404) (-925.411) (-913.872) -- 0:00:29
      908500 -- [-914.500] (-930.094) (-927.634) (-922.061) * [-919.097] (-924.752) (-924.474) (-923.741) -- 0:00:29
      909000 -- (-918.180) [-922.565] (-919.046) (-923.100) * (-907.166) (-921.228) (-929.000) [-930.726] -- 0:00:29
      909500 -- (-926.702) (-914.843) (-918.472) [-907.259] * [-912.169] (-931.568) (-923.819) (-916.943) -- 0:00:29
      910000 -- (-936.650) (-917.452) (-914.176) [-908.653] * (-929.318) (-914.081) [-918.144] (-936.234) -- 0:00:29

      Average standard deviation of split frequencies: 0.006449

      910500 -- (-913.121) (-913.440) [-918.677] (-913.970) * (-945.596) (-927.969) (-911.867) [-911.049] -- 0:00:29
      911000 -- (-920.907) [-912.802] (-911.602) (-931.104) * (-913.446) [-909.339] (-925.511) (-922.497) -- 0:00:29
      911500 -- (-919.268) [-918.418] (-925.054) (-924.800) * (-924.826) (-913.624) (-912.986) [-909.915] -- 0:00:28
      912000 -- (-920.637) (-918.693) [-914.911] (-924.984) * (-922.058) [-911.607] (-925.848) (-912.649) -- 0:00:28
      912500 -- (-922.584) (-921.883) (-920.086) [-919.995] * (-919.607) (-913.302) (-916.160) [-907.686] -- 0:00:28
      913000 -- (-922.185) [-905.007] (-920.787) (-927.232) * (-923.222) (-930.576) [-925.603] (-915.975) -- 0:00:28
      913500 -- (-924.854) [-906.708] (-928.197) (-926.055) * (-935.189) [-916.004] (-928.628) (-911.787) -- 0:00:28
      914000 -- (-930.872) (-909.746) [-915.773] (-912.839) * (-918.572) [-913.699] (-933.248) (-919.410) -- 0:00:28
      914500 -- (-928.996) [-907.849] (-914.811) (-924.946) * (-924.751) (-913.836) (-926.189) [-909.060] -- 0:00:27
      915000 -- (-933.917) (-929.316) (-917.135) [-908.461] * (-927.148) [-924.008] (-913.553) (-925.970) -- 0:00:27

      Average standard deviation of split frequencies: 0.006583

      915500 -- (-927.607) (-936.922) (-932.713) [-912.964] * [-914.713] (-919.479) (-924.038) (-913.291) -- 0:00:27
      916000 -- (-917.246) (-914.768) [-915.728] (-930.649) * [-917.765] (-913.155) (-924.674) (-922.614) -- 0:00:27
      916500 -- (-914.497) (-912.187) (-925.938) [-931.784] * (-911.693) (-921.497) (-939.250) [-908.784] -- 0:00:27
      917000 -- [-909.417] (-948.066) (-913.054) (-927.267) * [-920.177] (-926.641) (-925.787) (-910.508) -- 0:00:27
      917500 -- [-912.547] (-922.604) (-915.014) (-922.567) * (-932.301) (-909.067) [-924.572] (-915.390) -- 0:00:26
      918000 -- (-908.164) (-918.550) (-915.615) [-917.230] * (-941.057) (-917.549) (-925.944) [-916.871] -- 0:00:26
      918500 -- (-917.203) [-905.872] (-924.019) (-922.158) * (-940.890) [-907.611] (-904.182) (-913.953) -- 0:00:26
      919000 -- (-919.601) [-910.445] (-924.465) (-916.661) * [-918.976] (-914.687) (-917.759) (-928.744) -- 0:00:26
      919500 -- [-917.637] (-929.624) (-928.873) (-920.413) * (-919.003) (-927.038) [-909.279] (-911.940) -- 0:00:26
      920000 -- (-927.428) [-912.583] (-924.051) (-926.437) * (-917.265) [-914.405] (-917.624) (-921.169) -- 0:00:26

      Average standard deviation of split frequencies: 0.006571

      920500 -- (-932.174) (-914.303) (-913.890) [-915.312] * (-918.730) (-916.801) (-944.557) [-917.397] -- 0:00:25
      921000 -- [-911.776] (-912.007) (-917.423) (-919.906) * (-930.035) (-926.545) (-917.433) [-920.394] -- 0:00:25
      921500 -- (-926.990) [-904.626] (-918.465) (-919.635) * (-916.387) (-918.199) [-915.881] (-938.434) -- 0:00:25
      922000 -- (-919.044) (-916.719) (-909.199) [-917.211] * (-905.762) (-924.184) [-913.568] (-915.865) -- 0:00:25
      922500 -- [-912.777] (-916.224) (-906.693) (-921.489) * (-916.664) (-920.555) (-910.379) [-911.906] -- 0:00:25
      923000 -- (-928.096) (-921.413) [-901.569] (-923.618) * (-931.110) [-914.834] (-922.505) (-914.727) -- 0:00:25
      923500 -- (-917.517) (-922.001) [-911.602] (-930.778) * [-921.224] (-918.735) (-927.329) (-915.168) -- 0:00:24
      924000 -- (-918.879) [-912.594] (-929.552) (-912.643) * (-920.649) [-911.037] (-931.760) (-920.252) -- 0:00:24
      924500 -- (-929.816) [-909.717] (-932.201) (-911.708) * (-928.340) (-918.853) (-933.704) [-904.191] -- 0:00:24
      925000 -- [-924.225] (-916.423) (-948.617) (-918.813) * [-912.532] (-924.411) (-933.201) (-907.205) -- 0:00:24

      Average standard deviation of split frequencies: 0.006385

      925500 -- (-924.409) (-920.430) (-923.940) [-905.534] * (-926.606) (-919.122) [-922.168] (-909.416) -- 0:00:24
      926000 -- (-928.202) (-915.392) (-929.307) [-909.122] * [-909.732] (-927.162) (-912.758) (-918.547) -- 0:00:24
      926500 -- [-915.425] (-906.364) (-920.808) (-914.191) * [-912.607] (-920.943) (-928.619) (-914.467) -- 0:00:23
      927000 -- (-906.099) [-906.349] (-921.167) (-929.410) * (-907.705) (-918.717) [-912.672] (-913.827) -- 0:00:23
      927500 -- (-912.426) (-916.557) [-920.895] (-910.638) * [-914.545] (-933.627) (-920.724) (-918.897) -- 0:00:23
      928000 -- (-928.327) (-914.633) [-914.331] (-939.376) * (-927.849) (-935.608) (-919.051) [-910.677] -- 0:00:23
      928500 -- (-932.730) (-918.989) [-904.170] (-931.959) * (-910.339) (-931.879) [-914.182] (-926.309) -- 0:00:23
      929000 -- (-918.730) (-916.220) [-905.682] (-913.958) * (-922.860) (-938.260) (-914.399) [-914.585] -- 0:00:23
      929500 -- (-927.072) [-902.202] (-911.840) (-931.499) * (-927.067) [-920.307] (-913.845) (-919.617) -- 0:00:22
      930000 -- [-925.187] (-915.304) (-936.284) (-925.865) * [-913.421] (-927.884) (-920.090) (-922.998) -- 0:00:22

      Average standard deviation of split frequencies: 0.006142

      930500 -- (-932.859) (-910.709) (-923.881) [-902.238] * (-919.287) (-921.215) [-914.900] (-910.003) -- 0:00:22
      931000 -- (-922.121) (-926.257) (-927.560) [-915.042] * (-907.857) (-932.369) [-909.920] (-916.411) -- 0:00:22
      931500 -- (-920.641) [-913.493] (-923.746) (-920.806) * (-930.379) (-911.661) (-926.297) [-915.012] -- 0:00:22
      932000 -- (-910.400) (-916.912) [-919.409] (-926.055) * (-930.460) [-920.193] (-924.254) (-911.265) -- 0:00:22
      932500 -- (-924.975) (-918.500) (-924.192) [-910.861] * (-913.969) (-922.486) [-925.474] (-925.669) -- 0:00:22
      933000 -- (-926.583) (-917.594) (-912.364) [-909.470] * (-928.846) [-909.451] (-928.769) (-916.352) -- 0:00:21
      933500 -- (-916.499) (-930.070) (-926.448) [-904.841] * (-925.874) [-925.876] (-911.327) (-927.629) -- 0:00:21
      934000 -- (-916.215) (-928.889) [-921.938] (-919.613) * (-921.839) (-917.348) [-923.685] (-922.502) -- 0:00:21
      934500 -- [-914.781] (-917.180) (-913.860) (-918.247) * (-919.857) (-907.612) [-924.952] (-918.115) -- 0:00:21
      935000 -- (-932.166) (-930.267) [-908.419] (-919.404) * [-921.503] (-923.892) (-918.834) (-922.646) -- 0:00:21

      Average standard deviation of split frequencies: 0.005080

      935500 -- [-913.458] (-930.723) (-912.309) (-926.798) * [-914.055] (-919.614) (-920.606) (-933.733) -- 0:00:21
      936000 -- (-916.379) (-916.476) [-905.901] (-919.662) * (-911.887) [-920.987] (-923.105) (-917.389) -- 0:00:20
      936500 -- (-921.611) (-920.383) [-919.698] (-918.397) * (-942.529) (-937.158) (-907.668) [-916.879] -- 0:00:20
      937000 -- (-908.523) (-939.762) [-917.396] (-911.601) * (-916.220) (-938.052) (-922.306) [-924.282] -- 0:00:20
      937500 -- (-920.766) (-919.059) (-917.202) [-922.052] * (-935.119) (-928.219) [-926.484] (-919.177) -- 0:00:20
      938000 -- (-922.372) (-929.862) [-919.281] (-922.943) * (-926.210) (-934.936) [-916.878] (-920.564) -- 0:00:20
      938500 -- (-920.466) [-907.867] (-921.233) (-918.762) * (-911.349) (-931.608) [-914.600] (-931.384) -- 0:00:20
      939000 -- (-920.419) [-917.510] (-936.742) (-915.589) * (-949.378) (-924.026) [-911.905] (-931.737) -- 0:00:19
      939500 -- (-923.295) (-933.647) [-915.885] (-914.892) * [-915.052] (-934.339) (-919.215) (-927.946) -- 0:00:19
      940000 -- [-910.768] (-922.423) (-917.097) (-923.010) * [-913.052] (-920.292) (-913.517) (-929.952) -- 0:00:19

      Average standard deviation of split frequencies: 0.004803

      940500 -- (-917.102) (-924.731) (-939.939) [-912.653] * [-917.002] (-923.231) (-925.905) (-945.907) -- 0:00:19
      941000 -- (-924.481) (-935.331) (-917.957) [-915.970] * (-920.649) (-924.577) [-916.083] (-940.269) -- 0:00:19
      941500 -- [-914.394] (-934.124) (-908.909) (-916.708) * [-912.855] (-943.904) (-910.579) (-947.157) -- 0:00:19
      942000 -- [-917.182] (-930.074) (-917.130) (-918.026) * [-909.639] (-920.529) (-910.663) (-930.393) -- 0:00:18
      942500 -- (-920.157) (-917.286) (-919.043) [-925.250] * (-908.503) [-909.840] (-911.945) (-936.798) -- 0:00:18
      943000 -- (-918.469) (-922.333) [-905.872] (-923.136) * (-919.214) (-923.289) [-920.269] (-934.983) -- 0:00:18
      943500 -- (-912.940) (-913.513) [-913.686] (-920.303) * (-920.999) [-915.089] (-929.825) (-923.963) -- 0:00:18
      944000 -- [-912.896] (-917.542) (-908.893) (-931.949) * (-916.708) (-920.319) [-914.546] (-930.379) -- 0:00:18
      944500 -- [-917.030] (-941.091) (-921.537) (-926.589) * (-923.882) (-922.180) [-909.087] (-919.769) -- 0:00:18
      945000 -- (-905.597) [-914.240] (-915.326) (-920.273) * (-926.410) (-934.199) [-912.625] (-921.326) -- 0:00:17

      Average standard deviation of split frequencies: 0.005362

      945500 -- (-925.612) (-922.630) [-904.696] (-914.736) * (-909.387) (-912.092) [-905.955] (-938.424) -- 0:00:17
      946000 -- (-925.114) (-919.550) [-907.621] (-922.853) * (-938.336) (-932.937) (-912.783) [-927.853] -- 0:00:17
      946500 -- (-932.477) (-917.548) [-914.408] (-902.232) * [-911.470] (-911.464) (-910.554) (-912.573) -- 0:00:17
      947000 -- (-928.621) (-904.634) (-915.506) [-913.746] * (-927.259) [-925.409] (-927.171) (-902.211) -- 0:00:17
      947500 -- (-950.141) [-913.611] (-929.539) (-916.431) * [-917.074] (-919.988) (-918.939) (-913.424) -- 0:00:17
      948000 -- (-925.293) (-925.211) [-905.842] (-924.490) * [-919.301] (-920.244) (-916.425) (-920.476) -- 0:00:16
      948500 -- (-930.029) (-910.193) [-921.591] (-920.582) * [-909.244] (-924.249) (-916.412) (-918.405) -- 0:00:16
      949000 -- (-949.311) [-908.120] (-926.285) (-915.277) * (-916.037) (-921.725) [-908.570] (-919.519) -- 0:00:16
      949500 -- (-931.336) (-911.561) [-912.900] (-924.649) * (-925.540) (-925.057) [-910.174] (-919.824) -- 0:00:16
      950000 -- (-936.637) [-912.157] (-922.504) (-919.866) * (-924.802) (-927.893) (-928.735) [-913.027] -- 0:00:16

      Average standard deviation of split frequencies: 0.004959

      950500 -- (-926.223) (-916.473) [-913.077] (-914.168) * [-912.121] (-922.256) (-926.022) (-911.256) -- 0:00:16
      951000 -- (-927.051) (-915.209) (-916.909) [-915.354] * [-917.743] (-924.152) (-916.471) (-918.031) -- 0:00:15
      951500 -- (-921.521) (-932.111) (-914.457) [-914.280] * (-954.702) [-912.153] (-911.456) (-918.605) -- 0:00:15
      952000 -- (-914.705) [-908.486] (-913.805) (-921.356) * (-925.690) (-924.940) (-907.719) [-911.920] -- 0:00:15
      952500 -- (-923.106) (-915.276) (-916.423) [-914.007] * [-905.941] (-916.192) (-922.068) (-923.263) -- 0:00:15
      953000 -- (-923.223) [-909.019] (-924.200) (-920.139) * [-905.323] (-925.023) (-912.239) (-933.335) -- 0:00:15
      953500 -- (-914.474) (-924.537) (-921.666) [-903.597] * (-930.732) [-919.395] (-910.193) (-922.608) -- 0:00:15
      954000 -- [-908.476] (-924.168) (-920.267) (-926.400) * (-926.207) [-915.034] (-915.825) (-928.023) -- 0:00:14
      954500 -- [-913.651] (-923.182) (-918.821) (-927.516) * [-910.882] (-913.026) (-913.485) (-927.536) -- 0:00:14
      955000 -- (-920.029) [-929.230] (-907.892) (-922.111) * [-916.796] (-931.372) (-921.636) (-933.961) -- 0:00:14

      Average standard deviation of split frequencies: 0.004664

      955500 -- [-911.270] (-920.721) (-906.921) (-926.884) * (-909.981) [-910.966] (-930.617) (-915.733) -- 0:00:14
      956000 -- (-925.224) (-922.051) [-924.895] (-921.603) * (-937.581) (-906.175) [-914.225] (-923.953) -- 0:00:14
      956500 -- (-919.925) [-906.791] (-934.819) (-923.537) * (-914.857) [-918.564] (-926.579) (-922.625) -- 0:00:14
      957000 -- (-929.737) [-915.230] (-911.851) (-913.009) * (-917.985) (-920.017) (-927.499) [-921.316] -- 0:00:14
      957500 -- (-932.464) [-914.853] (-919.901) (-922.532) * (-916.932) [-907.501] (-919.656) (-927.247) -- 0:00:13
      958000 -- (-926.814) [-903.954] (-915.250) (-922.822) * (-916.644) (-913.689) (-925.025) [-906.406] -- 0:00:13
      958500 -- (-917.319) (-927.310) [-911.912] (-943.086) * (-936.761) (-914.843) (-927.872) [-910.978] -- 0:00:13
      959000 -- (-933.353) (-927.202) [-913.133] (-927.319) * [-913.990] (-936.542) (-927.101) (-915.498) -- 0:00:13
      959500 -- (-931.679) [-911.721] (-912.867) (-943.459) * (-926.298) [-912.505] (-934.387) (-920.980) -- 0:00:13
      960000 -- (-921.122) [-910.273] (-911.408) (-934.961) * [-913.611] (-923.022) (-928.035) (-918.213) -- 0:00:13

      Average standard deviation of split frequencies: 0.004437

      960500 -- (-913.352) (-919.319) [-909.324] (-923.259) * (-914.574) (-922.559) [-919.877] (-917.868) -- 0:00:12
      961000 -- (-914.993) (-911.675) [-910.388] (-926.483) * (-924.141) (-924.466) (-915.111) [-908.862] -- 0:00:12
      961500 -- (-938.515) (-910.824) [-915.221] (-926.562) * [-916.643] (-931.852) (-923.839) (-918.658) -- 0:00:12
      962000 -- (-916.662) [-913.887] (-918.770) (-925.119) * (-918.541) (-931.854) (-926.867) [-925.107] -- 0:00:12
      962500 -- (-924.234) (-916.822) [-917.300] (-908.231) * (-927.807) (-919.251) [-906.033] (-915.815) -- 0:00:12
      963000 -- (-924.742) [-912.383] (-908.313) (-912.991) * [-916.658] (-930.731) (-910.402) (-920.253) -- 0:00:12
      963500 -- (-928.664) (-908.380) [-905.532] (-926.955) * (-922.776) (-913.176) [-917.931] (-910.489) -- 0:00:11
      964000 -- (-914.493) [-917.913] (-925.143) (-917.994) * (-912.963) [-911.122] (-917.093) (-915.402) -- 0:00:11
      964500 -- (-918.209) [-915.909] (-910.780) (-925.964) * [-916.457] (-924.067) (-921.285) (-926.836) -- 0:00:11
      965000 -- (-915.890) (-934.835) [-915.128] (-921.543) * (-917.234) (-950.898) (-917.933) [-915.488] -- 0:00:11

      Average standard deviation of split frequencies: 0.005036

      965500 -- (-926.778) (-937.689) (-920.140) [-917.816] * (-921.355) [-911.752] (-923.630) (-914.137) -- 0:00:11
      966000 -- (-931.274) (-918.507) [-908.798] (-922.271) * [-912.801] (-925.947) (-905.311) (-911.748) -- 0:00:11
      966500 -- [-911.776] (-913.498) (-911.029) (-913.586) * (-928.756) (-917.732) [-901.147] (-925.100) -- 0:00:10
      967000 -- (-921.781) (-928.072) [-908.752] (-922.447) * (-926.537) (-919.573) [-907.410] (-921.095) -- 0:00:10
      967500 -- [-920.902] (-908.126) (-904.549) (-920.210) * (-910.979) (-915.130) [-915.147] (-923.830) -- 0:00:10
      968000 -- (-922.934) (-929.224) (-922.487) [-923.507] * [-907.532] (-921.387) (-914.184) (-924.971) -- 0:00:10
      968500 -- (-922.032) (-926.722) (-917.443) [-916.602] * [-914.511] (-923.145) (-916.918) (-919.437) -- 0:00:10
      969000 -- (-914.169) (-920.908) [-913.500] (-923.231) * (-921.111) [-917.658] (-927.013) (-925.163) -- 0:00:10
      969500 -- (-918.393) (-909.628) [-912.783] (-913.429) * [-922.893] (-923.071) (-944.475) (-929.367) -- 0:00:09
      970000 -- (-926.892) (-917.702) [-910.422] (-910.664) * (-913.641) (-926.971) (-937.496) [-916.548] -- 0:00:09

      Average standard deviation of split frequencies: 0.005167

      970500 -- (-918.369) [-900.578] (-920.187) (-923.679) * [-913.600] (-917.715) (-940.280) (-922.994) -- 0:00:09
      971000 -- (-930.116) [-915.811] (-914.987) (-913.274) * [-920.712] (-920.461) (-931.872) (-918.846) -- 0:00:09
      971500 -- (-916.591) (-917.824) [-906.077] (-914.775) * (-919.547) (-920.720) (-933.589) [-919.417] -- 0:00:09
      972000 -- [-920.475] (-922.783) (-913.794) (-924.544) * (-914.833) [-915.810] (-919.592) (-914.570) -- 0:00:09
      972500 -- (-914.924) (-919.280) [-912.668] (-932.762) * (-913.449) [-905.135] (-915.700) (-914.968) -- 0:00:08
      973000 -- (-921.171) (-913.645) [-909.714] (-929.312) * (-933.841) [-911.004] (-919.693) (-913.105) -- 0:00:08
      973500 -- (-926.585) (-925.850) (-920.835) [-921.508] * (-928.330) [-912.785] (-933.772) (-911.743) -- 0:00:08
      974000 -- (-917.474) [-909.526] (-918.734) (-925.018) * [-913.531] (-926.333) (-921.596) (-924.054) -- 0:00:08
      974500 -- (-921.815) (-916.267) (-919.068) [-911.154] * [-905.242] (-918.669) (-929.575) (-920.172) -- 0:00:08
      975000 -- (-911.536) (-904.892) (-918.710) [-912.602] * [-909.157] (-915.361) (-927.139) (-922.999) -- 0:00:08

      Average standard deviation of split frequencies: 0.005294

      975500 -- (-916.752) (-914.209) (-912.000) [-912.590] * (-917.357) (-918.198) (-930.852) [-914.136] -- 0:00:07
      976000 -- (-915.457) [-915.771] (-919.735) (-912.925) * [-911.173] (-927.922) (-929.204) (-922.178) -- 0:00:07
      976500 -- [-919.281] (-919.329) (-932.052) (-922.215) * [-908.019] (-938.746) (-918.801) (-922.276) -- 0:00:07
      977000 -- [-918.713] (-910.602) (-924.464) (-927.495) * (-915.270) (-933.098) [-923.791] (-918.694) -- 0:00:07
      977500 -- [-909.783] (-915.914) (-924.742) (-926.356) * (-915.848) (-921.800) (-923.258) [-921.765] -- 0:00:07
      978000 -- [-922.235] (-929.014) (-931.763) (-923.020) * (-905.234) (-925.559) [-916.682] (-922.666) -- 0:00:07
      978500 -- (-927.566) (-932.671) (-918.573) [-908.531] * (-919.973) (-923.762) (-912.405) [-908.231] -- 0:00:07
      979000 -- (-905.068) (-920.359) (-919.772) [-907.614] * (-920.435) [-918.125] (-934.850) (-910.954) -- 0:00:06
      979500 -- (-919.396) (-931.487) (-914.258) [-919.835] * (-917.962) (-926.295) (-921.448) [-911.708] -- 0:00:06
      980000 -- (-922.706) (-932.947) (-928.160) [-918.103] * (-915.281) (-930.414) [-913.951] (-928.267) -- 0:00:06

      Average standard deviation of split frequencies: 0.005228

      980500 -- [-920.101] (-914.296) (-908.639) (-917.343) * (-915.950) (-931.401) (-926.281) [-918.296] -- 0:00:06
      981000 -- [-911.154] (-926.989) (-915.220) (-919.946) * (-907.007) (-921.310) (-918.878) [-911.512] -- 0:00:06
      981500 -- (-920.220) (-919.483) [-912.581] (-919.698) * [-923.885] (-927.314) (-906.466) (-917.132) -- 0:00:06
      982000 -- (-920.027) (-918.423) (-916.248) [-913.673] * [-911.473] (-918.734) (-927.784) (-912.124) -- 0:00:05
      982500 -- (-922.478) (-929.331) (-912.592) [-908.330] * [-910.022] (-915.326) (-914.685) (-914.400) -- 0:00:05
      983000 -- (-923.882) (-938.970) (-906.357) [-918.658] * [-924.242] (-918.336) (-918.291) (-926.860) -- 0:00:05
      983500 -- (-923.628) (-938.874) [-916.706] (-933.112) * (-933.359) (-910.649) (-910.611) [-911.774] -- 0:00:05
      984000 -- [-909.290] (-940.816) (-918.802) (-924.390) * (-938.382) [-915.998] (-922.925) (-918.620) -- 0:00:05
      984500 -- (-917.043) [-911.294] (-943.094) (-916.975) * (-914.959) (-923.483) [-915.663] (-913.745) -- 0:00:05
      985000 -- (-939.751) [-927.038] (-925.667) (-919.810) * (-919.200) (-921.669) [-909.444] (-926.223) -- 0:00:04

      Average standard deviation of split frequencies: 0.005558

      985500 -- (-922.448) [-908.096] (-920.020) (-916.829) * (-912.583) (-930.382) [-920.728] (-917.089) -- 0:00:04
      986000 -- (-929.986) [-914.459] (-934.180) (-915.656) * [-905.688] (-940.941) (-928.349) (-918.955) -- 0:00:04
      986500 -- (-935.542) (-918.856) (-924.940) [-919.667] * (-918.603) (-917.068) [-912.736] (-925.982) -- 0:00:04
      987000 -- (-938.986) (-928.399) [-923.040] (-927.496) * [-912.340] (-924.070) (-936.955) (-910.637) -- 0:00:04
      987500 -- (-907.517) (-920.481) [-919.451] (-923.600) * (-922.530) (-916.413) [-912.524] (-923.071) -- 0:00:04
      988000 -- [-918.763] (-918.356) (-928.547) (-927.283) * (-937.487) (-917.443) (-925.659) [-906.383] -- 0:00:03
      988500 -- (-905.920) [-919.583] (-914.976) (-913.254) * (-918.633) (-936.182) [-910.650] (-914.805) -- 0:00:03
      989000 -- (-916.195) (-916.175) (-915.840) [-917.445] * (-928.099) (-938.085) [-915.772] (-925.901) -- 0:00:03
      989500 -- (-915.806) (-927.040) (-929.249) [-907.916] * (-915.163) (-932.208) (-915.746) [-918.121] -- 0:00:03
      990000 -- (-919.690) (-920.879) (-908.070) [-908.968] * [-924.851] (-919.691) (-948.452) (-926.685) -- 0:00:03

      Average standard deviation of split frequencies: 0.005175

      990500 -- (-902.172) (-917.910) [-908.722] (-939.556) * [-916.038] (-918.340) (-922.671) (-925.675) -- 0:00:03
      991000 -- (-911.371) (-923.282) (-916.637) [-917.246] * (-933.284) [-918.430] (-915.829) (-927.517) -- 0:00:02
      991500 -- (-919.345) (-918.540) (-929.830) [-911.218] * (-928.128) [-909.342] (-918.639) (-922.657) -- 0:00:02
      992000 -- [-911.308] (-913.359) (-918.094) (-941.756) * [-915.491] (-909.785) (-920.769) (-927.580) -- 0:00:02
      992500 -- (-923.228) [-906.447] (-914.489) (-922.140) * [-907.595] (-921.280) (-933.522) (-935.952) -- 0:00:02
      993000 -- (-936.455) [-916.560] (-916.783) (-928.676) * (-930.577) (-914.604) (-912.588) [-914.755] -- 0:00:02
      993500 -- (-926.238) [-916.078] (-920.089) (-916.269) * (-907.984) (-914.428) [-912.187] (-922.976) -- 0:00:02
      994000 -- (-913.572) [-918.417] (-923.945) (-911.501) * (-919.557) (-916.610) (-922.917) [-908.201] -- 0:00:01
      994500 -- (-921.737) (-917.424) [-915.702] (-914.284) * [-911.724] (-908.773) (-911.682) (-928.540) -- 0:00:01
      995000 -- (-933.390) [-915.874] (-918.863) (-929.601) * (-901.136) [-908.196] (-925.496) (-922.757) -- 0:00:01

      Average standard deviation of split frequencies: 0.005384

      995500 -- (-920.548) (-918.351) (-924.727) [-905.794] * [-926.247] (-915.894) (-914.485) (-927.870) -- 0:00:01
      996000 -- (-923.542) (-913.639) (-939.012) [-925.991] * (-911.662) [-907.026] (-927.045) (-922.045) -- 0:00:01
      996500 -- [-911.559] (-911.494) (-928.576) (-914.135) * (-923.212) (-922.254) [-910.197] (-916.378) -- 0:00:01
      997000 -- (-912.770) [-911.792] (-927.306) (-923.146) * (-935.256) (-927.299) (-928.404) [-908.989] -- 0:00:00
      997500 -- [-912.869] (-929.920) (-930.227) (-918.922) * [-915.726] (-934.001) (-922.073) (-906.275) -- 0:00:00
      998000 -- (-924.543) [-917.328] (-937.725) (-912.287) * [-920.390] (-910.435) (-928.726) (-905.523) -- 0:00:00
      998500 -- (-936.509) (-917.392) [-911.062] (-919.867) * (-928.282) (-914.679) [-915.668] (-911.508) -- 0:00:00
      999000 -- [-925.009] (-917.139) (-917.047) (-921.105) * (-947.428) [-914.760] (-931.516) (-923.777) -- 0:00:00
      999500 -- [-917.544] (-911.488) (-924.455) (-921.157) * [-912.205] (-919.259) (-920.313) (-917.255) -- 0:00:00
      1000000 -- [-915.558] (-926.961) (-919.124) (-913.411) * (-915.813) (-918.226) [-913.887] (-924.605) -- 0:00:00

      Average standard deviation of split frequencies: 0.005751
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -915.557685 -- 32.575673
         Chain 1 -- -915.557691 -- 32.575673
         Chain 2 -- -926.961290 -- 30.864707
         Chain 2 -- -926.961290 -- 30.864707
         Chain 3 -- -919.124016 -- 27.716792
         Chain 3 -- -919.124008 -- 27.716792
         Chain 4 -- -913.411030 -- 30.596001
         Chain 4 -- -913.411024 -- 30.596001
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -915.812995 -- 30.218551
         Chain 1 -- -915.812998 -- 30.218551
         Chain 2 -- -918.226259 -- 29.954475
         Chain 2 -- -918.226259 -- 29.954475
         Chain 3 -- -913.887332 -- 34.499918
         Chain 3 -- -913.887328 -- 34.499918
         Chain 4 -- -924.604896 -- 32.089585
         Chain 4 -- -924.604897 -- 32.089585

      Analysis completed in 5 mins 26 seconds
      Analysis used 325.87 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -895.50
      Likelihood of best state for "cold" chain of run 2 was -895.86

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            55.6 %     ( 49 %)     Dirichlet(Revmat{all})
            72.9 %     ( 63 %)     Slider(Revmat{all})
            33.4 %     ( 20 %)     Dirichlet(Pi{all})
            34.7 %     ( 17 %)     Slider(Pi{all})
            58.0 %     ( 24 %)     Multiplier(Alpha{1,2})
            50.7 %     ( 22 %)     Multiplier(Alpha{3})
            73.2 %     ( 45 %)     Slider(Pinvar{all})
            43.6 %     ( 39 %)     ExtSPR(Tau{all},V{all})
            16.5 %     ( 16 %)     ExtTBR(Tau{all},V{all})
            46.9 %     ( 43 %)     NNI(Tau{all},V{all})
            40.2 %     ( 43 %)     ParsSPR(Tau{all},V{all})
            27.2 %     ( 28 %)     Multiplier(V{all})
            55.0 %     ( 53 %)     Nodeslider(V{all})
            25.7 %     ( 22 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            55.7 %     ( 47 %)     Dirichlet(Revmat{all})
            74.6 %     ( 67 %)     Slider(Revmat{all})
            34.1 %     ( 25 %)     Dirichlet(Pi{all})
            35.6 %     ( 29 %)     Slider(Pi{all})
            57.6 %     ( 25 %)     Multiplier(Alpha{1,2})
            50.2 %     ( 28 %)     Multiplier(Alpha{3})
            73.4 %     ( 46 %)     Slider(Pinvar{all})
            43.7 %     ( 44 %)     ExtSPR(Tau{all},V{all})
            16.8 %     ( 20 %)     ExtTBR(Tau{all},V{all})
            47.0 %     ( 44 %)     NNI(Tau{all},V{all})
            40.3 %     ( 29 %)     ParsSPR(Tau{all},V{all})
            27.2 %     ( 27 %)     Multiplier(V{all})
            54.7 %     ( 54 %)     Nodeslider(V{all})
            26.0 %     ( 24 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.67    0.40    0.22 
         2 |  166302            0.68    0.41 
         3 |  166739  166736            0.69 
         4 |  166552  166677  166994         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.67    0.40    0.21 
         2 |  166105            0.68    0.41 
         3 |  166519  166914            0.68 
         4 |  166527  166988  166947         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -911.67
      |2     2                   *1                                |
      |               2                     1              11      |
      |        2      1        2                       1     1 1   |
      |           21       2 2    2      * 1 2      2              |
      |   1      1   1      *       2   2               2 2     2  |
      |      1  1   22          2  2 2  1    1   2 1   2 1     21 2|
      |1 1  1 *1  1    1 1            1       2               1    |
      |   21        1   1     *        1  12      1   *   1      2 |
      |          2       2     1            2 12 1 2    1  2  2   1|
      |  2 2    2               1   1 22  2     *   11      2    1 |
      | *                                         2  2             |
      |     2                1       1         1         2         |
      |                 2 1        1                               |
      |            2   2  21                                       |
      |                                                      2     |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -916.98
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -904.32          -928.62
        2       -905.06          -929.06
      --------------------------------------
      TOTAL     -904.62          -928.86
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.596162    0.008314    0.430291    0.775473    0.587543   1202.83   1351.91    1.000
      r(A<->C){all}   0.031876    0.000437    0.000029    0.072190    0.028215    837.49    921.55    1.000
      r(A<->G){all}   0.300426    0.004537    0.183088    0.445040    0.297105    513.89    573.29    1.000
      r(A<->T){all}   0.122645    0.001542    0.047636    0.196706    0.117938    614.31    653.59    1.000
      r(C<->G){all}   0.025682    0.000412    0.000077    0.064511    0.021067    543.71    659.97    1.001
      r(C<->T){all}   0.473610    0.007317    0.306951    0.639662    0.471423    500.12    502.99    1.001
      r(G<->T){all}   0.045762    0.000644    0.002256    0.093212    0.042011    684.73    809.80    1.000
      pi(A){all}      0.313542    0.000554    0.266559    0.356358    0.313504   1208.42   1302.18    1.000
      pi(C){all}      0.192577    0.000413    0.153156    0.232237    0.192017   1192.06   1235.91    1.001
      pi(G){all}      0.280818    0.000543    0.235507    0.325112    0.280091    989.47   1139.25    1.001
      pi(T){all}      0.213063    0.000429    0.172701    0.253739    0.212570   1041.84   1170.64    1.000
      alpha{1,2}      0.095377    0.004184    0.000229    0.210169    0.088981    809.61    905.28    1.000
      alpha{3}        1.473509    0.422139    0.507450    2.776763    1.345862   1243.14   1350.30    1.001
      pinvar{all}     0.185639    0.013253    0.000304    0.401313    0.170090    838.63   1001.54    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8
      9 -- C9
     10 -- C10
     11 -- C11
     12 -- C12
     13 -- C13
     14 -- C14
     15 -- C15

   Key to taxon bipartitions (saved to file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ---------------------
    1 -- .**************
    2 -- .*.............
    3 -- ..*............
    4 -- ...*...........
    5 -- ....*..........
    6 -- .....*.........
    7 -- ......*........
    8 -- .......*.......
    9 -- ........*......
   10 -- .........*.....
   11 -- ..........*....
   12 -- ...........*...
   13 -- ............*..
   14 -- .............*.
   15 -- ..............*
   16 -- ..*******......
   17 -- ....**.........
   18 -- ..*.....*......
   19 -- ..*...*.*......
   20 -- ..*******.....*
   21 -- .********.....*
   22 -- ..*...***......
   23 -- ..****.**......
   24 -- ..*.*****......
   25 -- ...***.*.......
   26 -- ...***.........
   27 -- ....**.*.......
   28 -- ..*************
   29 -- .*............*
   30 -- .********......
   31 -- ............**.
   32 -- ...........*.*.
   33 -- ..........*..*.
   34 -- .........**....
   35 -- ..........**...
   36 -- ...........**..
   37 -- .........*.*...
   38 -- ..........*.*..
   39 -- .*********.****
   ---------------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
   16  3002    1.000000    0.000000    1.000000    1.000000    2
   17  3002    1.000000    0.000000    1.000000    1.000000    2
   18  2940    0.979347    0.004711    0.976016    0.982678    2
   19  1634    0.544304    0.001884    0.542971    0.545636    2
   20  1582    0.526982    0.001884    0.525650    0.528314    2
   21  1462    0.487009    0.013191    0.477682    0.496336    2
   22  1436    0.478348    0.001884    0.477015    0.479680    2
   23  1262    0.420386    0.000000    0.420386    0.420386    2
   24  1222    0.407062    0.002827    0.405063    0.409061    2
   25   875    0.291472    0.017430    0.279147    0.303797    2
   26   760    0.253165    0.005653    0.249167    0.257162    2
   27   610    0.203198    0.004711    0.199867    0.206529    2
   28   561    0.186875    0.001413    0.185876    0.187875    2
   29   543    0.180879    0.004240    0.177881    0.183877    2
   30   446    0.148568    0.002827    0.146569    0.150566    2
   31   317    0.105596    0.006124    0.101266    0.109927    2
   32   309    0.102931    0.004240    0.099933    0.105929    2
   33   309    0.102931    0.010835    0.095270    0.110593    2
   34   309    0.102931    0.003298    0.100600    0.105263    2
   35   305    0.101599    0.007066    0.096602    0.106596    2
   36   304    0.101266    0.003769    0.098601    0.103931    2
   37   299    0.099600    0.006124    0.095270    0.103931    2
   38   277    0.092272    0.014604    0.081945    0.102598    2
   39   265    0.088274    0.019315    0.074617    0.101932    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.013367    0.000072    0.000702    0.029668    0.011663    1.000    2
   length{all}[2]     0.070114    0.000569    0.029469    0.115466    0.066447    1.000    2
   length{all}[3]     0.067512    0.000523    0.028728    0.113302    0.065014    1.000    2
   length{all}[4]     0.035197    0.000288    0.006104    0.067537    0.032693    1.000    2
   length{all}[5]     0.019882    0.000122    0.002913    0.041864    0.017764    1.000    2
   length{all}[6]     0.014194    0.000081    0.000259    0.031543    0.012394    1.000    2
   length{all}[7]     0.024026    0.000234    0.000015    0.051843    0.021942    1.000    2
   length{all}[8]     0.028475    0.000187    0.005962    0.055191    0.026332    1.000    2
   length{all}[9]     0.005769    0.000038    0.000004    0.018021    0.003899    1.000    2
   length{all}[10]    0.023880    0.000136    0.005584    0.046616    0.021957    1.000    2
   length{all}[11]    0.009126    0.000047    0.000112    0.022573    0.007478    1.000    2
   length{all}[12]    0.009459    0.000047    0.000207    0.022944    0.007952    1.000    2
   length{all}[13]    0.009433    0.000048    0.000386    0.022979    0.007861    1.000    2
   length{all}[14]    0.014199    0.000075    0.001391    0.031710    0.012437    1.000    2
   length{all}[15]    0.022511    0.000150    0.001541    0.046082    0.020693    1.000    2
   length{all}[16]    0.092596    0.000893    0.038082    0.149810    0.088872    1.000    2
   length{all}[17]    0.032742    0.000257    0.006884    0.063008    0.030230    1.000    2
   length{all}[18]    0.020505    0.000146    0.001401    0.043596    0.018439    1.000    2
   length{all}[19]    0.017159    0.000135    0.000131    0.040068    0.014690    1.003    2
   length{all}[20]    0.012142    0.000084    0.000002    0.029797    0.009974    1.000    2
   length{all}[21]    0.010149    0.000064    0.000064    0.024783    0.008243    1.000    2
   length{all}[22]    0.014694    0.000091    0.000303    0.031799    0.012498    1.001    2
   length{all}[23]    0.027571    0.000216    0.002874    0.057000    0.025293    0.999    2
   length{all}[24]    0.012637    0.000101    0.000033    0.032290    0.010360    0.999    2
   length{all}[25]    0.016820    0.000168    0.000001    0.039023    0.014370    0.999    2
   length{all}[26]    0.012224    0.000106    0.000042    0.030748    0.010049    1.004    2
   length{all}[27]    0.011233    0.000088    0.000030    0.028568    0.009022    0.999    2
   length{all}[28]    0.009123    0.000053    0.000005    0.023219    0.007318    0.998    2
   length{all}[29]    0.007079    0.000048    0.000005    0.021733    0.004924    0.998    2
   length{all}[30]    0.007654    0.000052    0.000007    0.022276    0.005666    1.001    2
   length{all}[31]    0.005041    0.000025    0.000021    0.016424    0.003371    0.997    2
   length{all}[32]    0.004915    0.000021    0.000023    0.013797    0.003388    0.998    2
   length{all}[33]    0.004411    0.000023    0.000027    0.013558    0.003046    1.010    2
   length{all}[34]    0.004905    0.000024    0.000026    0.015257    0.003569    0.999    2
   length{all}[35]    0.004379    0.000016    0.000019    0.012497    0.003276    0.998    2
   length{all}[36]    0.004660    0.000024    0.000017    0.014010    0.003111    1.007    2
   length{all}[37]    0.004424    0.000021    0.000035    0.013061    0.003089    0.998    2
   length{all}[38]    0.005152    0.000035    0.000015    0.016642    0.003146    1.001    2
   length{all}[39]    0.004797    0.000025    0.000001    0.013550    0.003410    0.998    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.005751
       Maximum standard deviation of split frequencies = 0.019315
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.010


   Clade credibility values:

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |---------------------------------------------------------------------- C2 (2)
   |                                                                               
   |---------------------------------------------------------------------- C10 (10)
   |                                                                               
   |---------------------------------------------------------------------- C11 (11)
   |                                                                               
   |---------------------------------------------------------------------- C12 (12)
   |                                                                               
   |---------------------------------------------------------------------- C13 (13)
   |                                                                               
   |---------------------------------------------------------------------- C14 (14)
   +                                                                               
   |                                                       /-------------- C3 (3)
   |                                         /------98-----+                       
   |                                         |             \-------------- C9 (9)
   |                           /------54-----+                                     
   |                           |             \---------------------------- C7 (7)
   |                           |                                                   
   |                           |------------------------------------------ C4 (4)
   |                           |                                                   
   |             /-----100-----+                           /-------------- C5 (5)
   |             |             |------------100------------+                       
   |             |             |                           \-------------- C6 (6)
   \------53-----+             |                                                   
                 |             \------------------------------------------ C8 (8)
                 |                                                                 
                 \-------------------------------------------------------- C15 (15)
                                                                                   

   Phylogram (based on average branch lengths):

   /---- C1 (1)
   |                                                                               
   |------------------------ C2 (2)
   |                                                                               
   |-------- C10 (10)
   |                                                                               
   |--- C11 (11)
   |                                                                               
   |--- C12 (12)
   |                                                                               
   |--- C13 (13)
   |                                                                               
   |----- C14 (14)
   +                                                                               
   |                                               /------------------------ C3 (3)
   |                                        /------+                               
   |                                        |      \-- C9 (9)
   |                                   /----+                                      
   |                                   |    \--------- C7 (7)
   |                                   |                                           
   |                                   |------------ C4 (4)
   |                                   |                                           
   |   /-------------------------------+          /------- C5 (5)
   |   |                               |----------+                                
   |   |                               |          \----- C6 (6)
   \---+                               |                                           
       |                               \---------- C8 (8)
       |                                                                           
       \------- C15 (15)
                                                                                   
   |-----------------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (2930 trees sampled):
      50 % credible set contains 1429 trees
      90 % credible set contains 2630 trees
      95 % credible set contains 2780 trees
      99 % credible set contains 2900 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 15  	ls = 312
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Reading seq # 9: C9     
Reading seq #10: C10     
Reading seq #11: C11     
Reading seq #12: C12     
Reading seq #13: C13     
Reading seq #14: C14     
Reading seq #15: C15     
Sequences read..
Counting site patterns..  0:00

          82 patterns at      104 /      104 sites (100.0%),  0:00
Counting codons..
NG distances for seqs.:
   1   2   3   4   5   6   7   8   9  10  11  12  13  14  15

      840 bytes for distance
    80032 bytes for conP
    11152 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
   240096 bytes for conP, adjusted

    0.026591    0.096847    0.039206    0.012502    0.013366    0.013475    0.023465    0.007386    0.162234    0.008493    0.056454    0.100525    0.008488    0.027259    0.055251    0.074976    0.030754    0.018750    0.071872    0.040156    0.300000    1.300000

ntime & nrate & np:    20     2    22

Bounds (np=22):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    22
lnL0 = -1017.738561

Iterating by ming2
Initial: fx=  1017.738561
x=  0.02659  0.09685  0.03921  0.01250  0.01337  0.01347  0.02347  0.00739  0.16223  0.00849  0.05645  0.10053  0.00849  0.02726  0.05525  0.07498  0.03075  0.01875  0.07187  0.04016  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 429.9799 ++     1010.362080  m 0.0001    27 | 1/22
  2 h-m-p  0.0001 0.0007 228.5956 +YYCYCCC   994.332204  6 0.0006    62 | 1/22
  3 h-m-p  0.0000 0.0000 2576.6189 +YYCCCC   990.001904  5 0.0000    96 | 1/22
  4 h-m-p  0.0001 0.0003 1095.0633 +YYYCCC   977.297145  5 0.0002   129 | 1/22
  5 h-m-p  0.0003 0.0013 608.2738 YCCCC   965.097892  4 0.0006   161 | 1/22
  6 h-m-p  0.0003 0.0014 186.3678 +YYYCCC   953.737892  5 0.0010   194 | 1/22
  7 h-m-p  0.0001 0.0004 192.3226 YCCCCC   952.465108  5 0.0002   228 | 1/22
  8 h-m-p  0.0002 0.0008 114.6681 +YYCCCC   950.611617  5 0.0005   262 | 1/22
  9 h-m-p  0.0002 0.0008 233.4925 CCCCC   948.984391  4 0.0003   295 | 1/22
 10 h-m-p  0.0004 0.0028 155.6165 YCCCC   945.914034  4 0.0010   327 | 1/22
 11 h-m-p  0.0003 0.0015 541.6297 +YYYYYYYYCC   920.319186 10 0.0012   364 | 1/22
 12 h-m-p  0.0000 0.0002 658.3362 YCCCCC   919.512155  5 0.0001   398 | 1/22
 13 h-m-p  0.0023 0.0114   6.8223 YC      919.497526  1 0.0004   424 | 1/22
 14 h-m-p  0.0003 0.0149   8.3673 +CCC    919.407895  2 0.0014   454 | 1/22
 15 h-m-p  0.0020 0.0210   5.9701 +YCC    918.733257  2 0.0069   483 | 1/22
 16 h-m-p  0.0010 0.0049  28.8275 CCCC    917.594076  3 0.0015   514 | 1/22
 17 h-m-p  0.0005 0.0027  15.3768 +YYCYC   914.995820  4 0.0019   545 | 1/22
 18 h-m-p  0.0002 0.0010 120.9768 +CCCC   908.000688  3 0.0008   577 | 1/22
 19 h-m-p  0.0004 0.0018  60.3060 YCC     907.111023  2 0.0005   605 | 1/22
 20 h-m-p  0.0014 0.0069   8.5225 YC      907.085403  1 0.0006   631 | 1/22
 21 h-m-p  0.0039 0.0308   1.4182 YC      907.073192  1 0.0024   657 | 1/22
 22 h-m-p  0.0062 0.4369   0.5552 +++YCYCCC   900.650778  5 0.2984   693 | 1/22
 23 h-m-p  0.0006 0.0028  19.3352 CCCCC   900.512554  4 0.0007   747 | 1/22
 24 h-m-p  0.0710 1.7982   0.1901 ++YYCCC   896.254847  4 0.9260   780 | 1/22
 25 h-m-p  0.1274 0.6372   0.2230 +YCCC   894.435086  3 0.3842   832 | 1/22
 26 h-m-p  0.2515 1.2576   0.1545 +YCCC   892.843569  3 0.8110   884 | 1/22
 27 h-m-p  0.1929 0.9646   0.3129 YCCCC   891.717607  4 0.3459   937 | 1/22
 28 h-m-p  0.2690 1.3449   0.1703 YCCCC   890.927215  4 0.5849   990 | 1/22
 29 h-m-p  0.4505 3.5245   0.2211 +YYYCCCC   888.746899  6 1.8689  1046 | 1/22
 30 h-m-p  0.2577 1.2883   0.3749 YCCCC   887.809831  4 0.5943  1099 | 1/22
 31 h-m-p  0.3713 1.8565   0.3238 YCCCC   886.990232  4 0.7539  1152 | 1/22
 32 h-m-p  0.8756 5.0918   0.2788 CCCC    886.327379  3 1.1485  1204 | 1/22
 33 h-m-p  1.6000 8.0000   0.1518 CCC     885.914263  2 1.4999  1254 | 1/22
 34 h-m-p  1.6000 8.0000   0.0826 CCC     885.574844  2 1.9204  1304 | 1/22
 35 h-m-p  1.6000 8.0000   0.0471 CCC     885.367822  2 2.4526  1354 | 1/22
 36 h-m-p  0.9992 8.0000   0.1157 +YC     885.054688  1 3.1643  1402 | 1/22
 37 h-m-p  1.6000 8.0000   0.1379 CCC     884.913505  2 1.2936  1452 | 1/22
 38 h-m-p  1.6000 8.0000   0.0499 CCC     884.864226  2 2.4438  1502 | 1/22
 39 h-m-p  1.6000 8.0000   0.0187 CC      884.842803  1 2.3481  1550 | 1/22
 40 h-m-p  1.4211 8.0000   0.0310 CC      884.838035  1 1.5114  1598 | 1/22
 41 h-m-p  1.6000 8.0000   0.0033 CC      884.837633  1 1.3278  1646 | 1/22
 42 h-m-p  1.6000 8.0000   0.0005 C       884.837573  0 1.5030  1692 | 1/22
 43 h-m-p  1.5328 8.0000   0.0005 Y       884.837540  0 2.6913  1738 | 1/22
 44 h-m-p  1.6000 8.0000   0.0000 C       884.837535  0 1.3548  1784 | 1/22
 45 h-m-p  0.3075 8.0000   0.0002 +Y      884.837533  0 2.3879  1831 | 1/22
 46 h-m-p  1.6000 8.0000   0.0001 C       884.837533  0 1.4435  1877 | 1/22
 47 h-m-p  1.6000 8.0000   0.0000 C       884.837533  0 1.4534  1923 | 1/22
 48 h-m-p  1.6000 8.0000   0.0000 C       884.837533  0 1.4003  1969 | 1/22
 49 h-m-p  0.8991 8.0000   0.0000 +Y      884.837533  0 2.6778  2016 | 1/22
 50 h-m-p  1.6000 8.0000   0.0000 C       884.837533  0 1.3924  2062 | 1/22
 51 h-m-p  1.6000 8.0000   0.0000 Y       884.837533  0 1.6000  2108 | 1/22
 52 h-m-p  1.6000 8.0000   0.0000 C       884.837533  0 1.9421  2154 | 1/22
 53 h-m-p  1.6000 8.0000   0.0000 --------------Y   884.837533  0 0.0000  2214
Out..
lnL  =  -884.837533
2215 lfun, 2215 eigenQcodon, 44300 P(t)

Time used:  0:10


Model 1: NearlyNeutral

TREE #  1
(1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
    0.026591    0.096847    0.039206    0.012502    0.013366    0.013475    0.023465    0.007386    0.162234    0.008493    0.056454    0.100525    0.008488    0.027259    0.055251    0.074976    0.030754    0.018750    0.071872    0.040156    4.215789    0.500545    0.139499

ntime & nrate & np:    20     2    23

Bounds (np=23):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 3.945826

np =    23
lnL0 =  -897.970636

Iterating by ming2
Initial: fx=   897.970636
x=  0.02659  0.09685  0.03921  0.01250  0.01337  0.01347  0.02347  0.00739  0.16223  0.00849  0.05645  0.10053  0.00849  0.02726  0.05525  0.07498  0.03075  0.01875  0.07187  0.04016  4.21579  0.50054  0.13950

  1 h-m-p  0.0000 0.0001 359.8182 ++      892.411573  m 0.0001    28 | 1/23
  2 h-m-p  0.0003 0.0016 108.7432 +YYCCCC   886.783476  5 0.0010    63 | 1/23
  3 h-m-p  0.0001 0.0005 306.2802 +CCYC   882.896295  3 0.0004    95 | 1/23
  4 h-m-p  0.0000 0.0001 353.9551 ++      881.405732  m 0.0001   121 | 2/23
  5 h-m-p  0.0002 0.0011 115.8551 +YCCCC   879.904568  4 0.0005   155 | 2/23
  6 h-m-p  0.0004 0.0021  66.7174 CCCC    879.342632  3 0.0005   187 | 1/23
  7 h-m-p  0.0004 0.0018  75.5228 YCY     878.973569  2 0.0003   216 | 1/23
  8 h-m-p  0.0010 0.0058  21.7377 YCC     878.840391  2 0.0007   245 | 1/23
  9 h-m-p  0.0006 0.0054  25.7253 CCCC    878.682467  3 0.0008   277 | 1/23
 10 h-m-p  0.0008 0.0062  28.0024 YC      878.596267  1 0.0005   304 | 1/23
 11 h-m-p  0.0008 0.0038  15.9201 YCCC    878.549174  3 0.0005   335 | 1/23
 12 h-m-p  0.0006 0.0065  12.3642 CCC     878.493837  2 0.0006   365 | 1/23
 13 h-m-p  0.0007 0.0096  10.4708 YC      878.317699  1 0.0016   392 | 1/23
 14 h-m-p  0.0006 0.0028  14.6349 CYCCC   878.082896  4 0.0010   425 | 1/23
 15 h-m-p  0.0002 0.0010  21.2755 CCCC    878.001750  3 0.0003   457 | 1/23
 16 h-m-p  0.0003 0.0022  18.4038 YCCC    877.889067  3 0.0005   488 | 1/23
 17 h-m-p  0.0003 0.0016  16.3670 YCC     877.863988  2 0.0002   517 | 1/23
 18 h-m-p  0.0002 0.0050  15.1516 YC      877.823481  1 0.0005   544 | 1/23
 19 h-m-p  0.0010 0.0183   7.5438 CC      877.796071  1 0.0009   572 | 1/23
 20 h-m-p  0.0053 0.1642   1.3126 +YCCC   877.616971  3 0.0153   604 | 1/23
 21 h-m-p  0.0010 0.0084  19.9225 +YYCCC   876.633279  4 0.0034   637 | 1/23
 22 h-m-p  0.0015 0.0084  44.9985 YCCCCC   873.741649  5 0.0037   672 | 1/23
 23 h-m-p  0.0086 0.0428   5.2276 YC      873.719170  1 0.0016   699 | 1/23
 24 h-m-p  0.2586 1.9860   0.0324 +YCCC   873.064409  3 0.7285   731 | 1/23
 25 h-m-p  0.2299 4.3225   0.1027 +CCC    872.887742  2 0.7805   784 | 1/23
 26 h-m-p  1.2979 8.0000   0.0618 CCC     872.784170  2 1.0225   836 | 1/23
 27 h-m-p  1.4950 7.4752   0.0080 YCC     872.719639  2 1.0214   887 | 1/23
 28 h-m-p  0.2181 8.0000   0.0377 +CC     872.702487  1 1.1186   938 | 1/23
 29 h-m-p  1.6000 8.0000   0.0106 YC      872.699061  1 0.8791   987 | 1/23
 30 h-m-p  1.6000 8.0000   0.0021 YC      872.698713  1 1.0009  1036 | 1/23
 31 h-m-p  1.6000 8.0000   0.0013 C       872.698650  0 1.4618  1084 | 1/23
 32 h-m-p  1.6000 8.0000   0.0008 C       872.698614  0 1.4063  1132 | 1/23
 33 h-m-p  1.6000 8.0000   0.0006 C       872.698600  0 1.4891  1180 | 1/23
 34 h-m-p  1.6000 8.0000   0.0003 Y       872.698600  0 1.0464  1228 | 1/23
 35 h-m-p  1.6000 8.0000   0.0000 Y       872.698599  0 0.9383  1276 | 1/23
 36 h-m-p  1.6000 8.0000   0.0000 Y       872.698599  0 0.8902  1324 | 1/23
 37 h-m-p  1.6000 8.0000   0.0000 -----C   872.698599  0 0.0004  1377
Out..
lnL  =  -872.698599
1378 lfun, 4134 eigenQcodon, 55120 P(t)

Time used:  0:22


Model 2: PositiveSelection

TREE #  1
(1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
initial w for M2:NSpselection reset.

    0.026591    0.096847    0.039206    0.012502    0.013366    0.013475    0.023465    0.007386    0.162234    0.008493    0.056454    0.100525    0.008488    0.027259    0.055251    0.074976    0.030754    0.018750    0.071872    0.040156    4.342616    1.302842    0.509198    0.419451    2.107983

ntime & nrate & np:    20     3    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 3.004316

np =    25
lnL0 =  -909.905030

Iterating by ming2
Initial: fx=   909.905030
x=  0.02659  0.09685  0.03921  0.01250  0.01337  0.01347  0.02347  0.00739  0.16223  0.00849  0.05645  0.10053  0.00849  0.02726  0.05525  0.07498  0.03075  0.01875  0.07187  0.04016  4.34262  1.30284  0.50920  0.41945  2.10798

  1 h-m-p  0.0000 0.0001 365.9627 ++      904.584570  m 0.0001    30 | 1/25
  2 h-m-p  0.0003 0.0016  88.1255 YCCCC   902.131755  4 0.0007    65 | 1/25
  3 h-m-p  0.0003 0.0013 123.6044 CYCC    901.337640  3 0.0003    98 | 1/25
  4 h-m-p  0.0003 0.0024 132.0682 +CCYCCC   894.699859  5 0.0019   137 | 1/25
  5 h-m-p  0.0000 0.0001 2133.7283 ++      889.280455  m 0.0001   165 | 2/25
  6 h-m-p  0.0001 0.0007 120.8160 YCCC    888.866552  3 0.0003   198 | 2/25
  7 h-m-p  0.0001 0.0004 478.3177 CCCC    888.345912  3 0.0001   232 | 2/25
  8 h-m-p  0.0003 0.0021 157.1253 YCCC    886.228563  3 0.0006   265 | 2/25
  9 h-m-p  0.0001 0.0006  52.8780 +YCYCCC   885.550260  5 0.0003   302 | 2/25
 10 h-m-p  0.0001 0.0006 122.5561 YCCCC   884.734466  4 0.0002   337 | 2/25
 11 h-m-p  0.0005 0.0025  32.5939 CCCCC   884.370392  4 0.0008   373 | 2/25
 12 h-m-p  0.0002 0.0010  55.5142 CCCC    884.208526  3 0.0003   407 | 2/25
 13 h-m-p  0.0004 0.0074  41.4583 +CCCC   883.643327  3 0.0017   442 | 2/25
 14 h-m-p  0.0006 0.0030 106.7994 YCCCC   882.669028  4 0.0012   477 | 2/25
 15 h-m-p  0.0003 0.0016 141.1793 YCCCCC   881.921849  5 0.0007   514 | 2/25
 16 h-m-p  0.0006 0.0032 117.1235 CCCC    881.163307  3 0.0010   548 | 2/25
 17 h-m-p  0.0008 0.0042 134.6676 YCCCCC   879.553332  5 0.0017   585 | 2/25
 18 h-m-p  0.0006 0.0032 117.0868 YCCC    879.332532  3 0.0003   618 | 2/25
 19 h-m-p  0.0033 0.0203  11.8919 CCC     879.296913  2 0.0007   650 | 1/25
 20 h-m-p  0.0008 0.0388  11.1750 YCCC    879.264816  3 0.0005   683 | 1/25
 21 h-m-p  0.0028 0.1794   2.0254 +YCC    879.053637  2 0.0182   715 | 1/25
 22 h-m-p  0.0010 0.0689  38.8123 ++CYCC   875.138737  3 0.0158   750 | 1/25
 23 h-m-p  0.0005 0.0027 105.0648 CCCCC   874.597924  4 0.0008   786 | 1/25
 24 h-m-p  0.0664 1.0984   1.2613 ++YCCC   873.350060  3 0.8518   821 | 1/25
 25 h-m-p  0.5213 2.6064   0.2550 YCCC    872.870598  3 1.0465   854 | 1/25
 26 h-m-p  0.9237 4.6184   0.0643 CCC     872.784241  2 0.7836   910 | 1/25
 27 h-m-p  0.5017 8.0000   0.1004 +YCC    872.735203  2 1.3629   966 | 1/25
 28 h-m-p  1.6000 8.0000   0.0695 YCC     872.707005  2 1.0153  1021 | 1/25
 29 h-m-p  1.6000 8.0000   0.0426 YC      872.699267  1 1.1895  1074 | 1/25
 30 h-m-p  1.6000 8.0000   0.0176 C       872.696507  0 1.6199  1126 | 1/25
 31 h-m-p  1.3325 8.0000   0.0213 CC      872.695367  1 1.5404  1180 | 1/25
 32 h-m-p  1.6000 8.0000   0.0190 C       872.694997  0 1.7831  1232 | 1/25
 33 h-m-p  1.6000 8.0000   0.0107 C       872.694865  0 1.9263  1284 | 1/25
 34 h-m-p  1.6000 8.0000   0.0105 C       872.694795  0 1.5588  1336 | 1/25
 35 h-m-p  1.6000 8.0000   0.0098 YC      872.694699  1 3.2978  1389 | 1/25
 36 h-m-p  1.2728 8.0000   0.0253 ++      872.693841  m 8.0000  1441 | 1/25
 37 h-m-p  0.1615 8.0000   1.2540 +YCYC   872.691368  3 0.4705  1498 | 1/25
 38 h-m-p  0.2599 8.0000   2.2702 YCC     872.690261  2 0.1369  1529 | 1/25
 39 h-m-p  0.3879 8.0000   0.8013 YCCC    872.682650  3 0.9180  1562 | 1/25
 40 h-m-p  0.4850 8.0000   1.5167 CCCC    872.668706  3 0.5234  1620 | 1/25
 41 h-m-p  0.8200 8.0000   0.9681 YCC     872.595272  2 1.4843  1651 | 1/25
 42 h-m-p  1.6000 8.0000   0.2980 CCC     872.478646  2 1.4280  1707 | 1/25
 43 h-m-p  0.6610 8.0000   0.6439 YC      872.406674  1 1.3422  1760 | 1/25
 44 h-m-p  1.4286 8.0000   0.6050 CYCCCC   872.277751  5 2.1032  1821 | 1/25
 45 h-m-p  1.1658 8.0000   1.0914 CYC     872.185683  2 1.3521  1876 | 1/25
 46 h-m-p  1.6000 8.0000   0.1232 YCC     872.166428  2 1.1463  1907 | 1/25
 47 h-m-p  1.3643 8.0000   0.1035 CCC     872.158655  2 1.6304  1963 | 1/25
 48 h-m-p  0.5820 8.0000   0.2899 CC      872.151568  1 0.6341  2017 | 1/25
 49 h-m-p  1.6000 8.0000   0.0422 CC      872.148690  1 1.3554  2071 | 1/25
 50 h-m-p  1.6000 8.0000   0.0099 CC      872.148021  1 2.1531  2125 | 1/25
 51 h-m-p  1.6000 8.0000   0.0029 YC      872.147664  1 2.8677  2178 | 1/25
 52 h-m-p  1.6000 8.0000   0.0035 CC      872.147513  1 2.1470  2232 | 1/25
 53 h-m-p  1.6000 8.0000   0.0027 C       872.147494  0 1.6961  2284 | 1/25
 54 h-m-p  1.6000 8.0000   0.0009 Y       872.147493  0 1.1795  2336 | 1/25
 55 h-m-p  1.6000 8.0000   0.0001 C       872.147493  0 1.3924  2388 | 1/25
 56 h-m-p  1.6000 8.0000   0.0000 Y       872.147493  0 0.9562  2440 | 1/25
 57 h-m-p  1.6000 8.0000   0.0000 ----C   872.147493  0 0.0016  2496
Out..
lnL  =  -872.147493
2497 lfun, 9988 eigenQcodon, 149820 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) =  -880.052433  S =  -833.421463   -39.591284
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  82 patterns   0:55
	did  20 /  82 patterns   0:55
	did  30 /  82 patterns   0:55
	did  40 /  82 patterns   0:55
	did  50 /  82 patterns   0:55
	did  60 /  82 patterns   0:55
	did  70 /  82 patterns   0:55
	did  80 /  82 patterns   0:55
	did  82 /  82 patterns   0:55
Time used:  0:55


Model 3: discrete

TREE #  1
(1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
    0.026591    0.096847    0.039206    0.012502    0.013366    0.013475    0.023465    0.007386    0.162234    0.008493    0.056454    0.100525    0.008488    0.027259    0.055251    0.074976    0.030754    0.018750    0.071872    0.040156    4.457893    0.446685    0.067456    0.084388    0.217219    0.299326

ntime & nrate & np:    20     4    26

Bounds (np=26):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 6.429346

np =    26
lnL0 =  -888.238172

Iterating by ming2
Initial: fx=   888.238172
x=  0.02659  0.09685  0.03921  0.01250  0.01337  0.01347  0.02347  0.00739  0.16223  0.00849  0.05645  0.10053  0.00849  0.02726  0.05525  0.07498  0.03075  0.01875  0.07187  0.04016  4.45789  0.44668  0.06746  0.08439  0.21722  0.29933

  1 h-m-p  0.0000 0.0001 316.6561 ++      883.812533  m 0.0001    31 | 1/26
  2 h-m-p  0.0002 0.0010  90.0823 YCCCCC   882.046614  5 0.0004    69 | 1/26
  3 h-m-p  0.0001 0.0004 169.1142 CCC     881.402898  2 0.0001   102 | 1/26
  4 h-m-p  0.0001 0.0006  97.6249 ++      879.932305  m 0.0006   131 | 2/26
  5 h-m-p  0.0007 0.0035  27.7907 YC      879.819187  1 0.0005   161 | 2/26
  6 h-m-p  0.0002 0.0019  59.3413 YC      879.606262  1 0.0005   191 | 2/26
  7 h-m-p  0.0002 0.0008 118.2817 CCCC    879.425460  3 0.0002   226 | 2/26
  8 h-m-p  0.0002 0.0008  89.1088 CCCC    879.280247  3 0.0002   261 | 2/26
  9 h-m-p  0.0002 0.0046 101.6136 +YCCC   878.013931  3 0.0019   296 | 2/26
 10 h-m-p  0.0001 0.0006 407.6573 +CYC    876.713300  2 0.0005   329 | 2/26
 11 h-m-p  0.0002 0.0008  76.7099 YC      876.538159  1 0.0004   359 | 2/26
 12 h-m-p  0.0005 0.0023  29.4975 CCC     876.475921  2 0.0004   392 | 2/26
 13 h-m-p  0.0006 0.0082  20.9217 CCC     876.408812  2 0.0008   425 | 2/26
 14 h-m-p  0.0009 0.0124  17.9505 YCC     876.310202  2 0.0015   457 | 2/26
 15 h-m-p  0.0006 0.0062  44.3311 YCCC    876.250402  3 0.0004   491 | 2/26
 16 h-m-p  0.0013 0.0266  13.3287 YCC     876.210226  2 0.0009   523 | 2/26
 17 h-m-p  0.0012 0.0093   9.6051 YCC     876.179222  2 0.0008   555 | 2/26
 18 h-m-p  0.0008 0.0409   9.7933 +CCC    875.966110  2 0.0047   589 | 2/26
 19 h-m-p  0.0028 0.0459  16.3690 CYCC    875.663408  3 0.0039   623 | 2/26
 20 h-m-p  0.0009 0.0056  68.9170 CCCC    875.143877  3 0.0014   658 | 2/26
 21 h-m-p  0.0075 0.0375   7.7917 CCC     875.087461  2 0.0027   691 | 2/26
 22 h-m-p  0.0040 0.0202   4.3208 CCC     875.078660  2 0.0012   724 | 2/26
 23 h-m-p  0.0007 0.3255   7.8986 ++++YCCC   873.602891  3 0.1138   762 | 2/26
 24 h-m-p  0.3317 1.6587   0.7406 CCCCC   872.937831  4 0.5979   799 | 2/26
 25 h-m-p  0.4504 2.2519   0.1951 CCCC    872.786533  3 0.5216   858 | 2/26
 26 h-m-p  1.2341 8.0000   0.0825 YCC     872.732798  2 0.8652   914 | 1/26
 27 h-m-p  0.0802 1.3980   0.8896 --CC    872.732504  1 0.0010   971 | 1/26
 28 h-m-p  0.0199 8.0000   0.0457 +++YC   872.713523  1 1.0009  1029 | 1/26
 29 h-m-p  1.3154 8.0000   0.0347 YCC     872.705868  2 0.7895  1086 | 1/26
 30 h-m-p  1.4161 8.0000   0.0194 C       872.701878  0 1.3877  1140 | 1/26
 31 h-m-p  1.6000 8.0000   0.0080 YC      872.700802  1 1.2741  1195 | 1/26
 32 h-m-p  1.6000 8.0000   0.0028 YC      872.700273  1 2.9342  1250 | 1/26
 33 h-m-p  0.9659 8.0000   0.0084 +CC     872.699183  1 4.5313  1307 | 1/26
 34 h-m-p  1.6000 8.0000   0.0136 C       872.698616  0 1.3021  1361 | 1/26
 35 h-m-p  1.6000 8.0000   0.0049 C       872.698210  0 1.7851  1415 | 1/26
 36 h-m-p  0.5208 7.6437   0.0167 YC      872.697752  1 1.1019  1470 | 1/26
 37 h-m-p  1.6000 8.0000   0.0080 C       872.697459  0 1.4681  1524 | 1/26
 38 h-m-p  1.6000 8.0000   0.0014 C       872.697391  0 1.7469  1578 | 1/26
 39 h-m-p  1.6000 8.0000   0.0014 Y       872.697383  0 1.1919  1632 | 1/26
 40 h-m-p  1.6000 8.0000   0.0007 Y       872.697382  0 0.6579  1686 | 1/26
 41 h-m-p  1.6000 8.0000   0.0002 Y       872.697382  0 0.9383  1740 | 1/26
 42 h-m-p  1.6000 8.0000   0.0000 Y       872.697382  0 1.2739  1794 | 1/26
 43 h-m-p  0.8041 8.0000   0.0000 C       872.697382  0 1.0890  1848 | 1/26
 44 h-m-p  1.6000 8.0000   0.0000 Y       872.697382  0 1.1164  1902 | 1/26
 45 h-m-p  1.6000 8.0000   0.0000 -C      872.697382  0 0.1433  1957 | 1/26
 46 h-m-p  0.1001 8.0000   0.0000 -----Y   872.697382  0 0.0000  2016
Out..
lnL  =  -872.697382
2017 lfun, 8068 eigenQcodon, 121020 P(t)

Time used:  1:22


Model 7: beta

TREE #  1
(1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
    0.026591    0.096847    0.039206    0.012502    0.013366    0.013475    0.023465    0.007386    0.162234    0.008493    0.056454    0.100525    0.008488    0.027259    0.055251    0.074976    0.030754    0.018750    0.071872    0.040156    4.350703    1.051152    1.246982

ntime & nrate & np:    20     1    23

Bounds (np=23):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 4.379999

np =    23
lnL0 =  -896.038955

Iterating by ming2
Initial: fx=   896.038955
x=  0.02659  0.09685  0.03921  0.01250  0.01337  0.01347  0.02347  0.00739  0.16223  0.00849  0.05645  0.10053  0.00849  0.02726  0.05525  0.07498  0.03075  0.01875  0.07187  0.04016  4.35070  1.05115  1.24698

  1 h-m-p  0.0000 0.0001 341.2396 ++      891.273453  m 0.0001    28 | 1/23
  2 h-m-p  0.0003 0.0013  78.0965 CCCCC   889.925621  4 0.0005    62 | 1/23
  3 h-m-p  0.0002 0.0009  86.7163 CCCC    889.655910  3 0.0001    94 | 1/23
  4 h-m-p  0.0003 0.0028  41.2957 YCC     889.374399  2 0.0005   123 | 1/23
  5 h-m-p  0.0004 0.0030  53.9969 YCCC    888.858483  3 0.0009   154 | 1/23
  6 h-m-p  0.0002 0.0012 125.7248 CYC     888.542341  2 0.0003   183 | 1/23
  7 h-m-p  0.0002 0.0036 162.2363 +YCCCC   885.736130  4 0.0020   217 | 1/23
  8 h-m-p  0.0003 0.0015 555.4041 CCCCC   884.220895  4 0.0004   251 | 1/23
  9 h-m-p  0.0003 0.0016 375.7280 CYCCCC   881.483423  5 0.0007   286 | 1/23
 10 h-m-p  0.0002 0.0009 128.6432 CCC     881.281463  2 0.0002   316 | 1/23
 11 h-m-p  0.0004 0.0019  42.5616 YCC     881.201364  2 0.0003   345 | 1/23
 12 h-m-p  0.0007 0.0077  16.4658 YC      881.158996  1 0.0005   372 | 1/23
 13 h-m-p  0.0007 0.0081  12.0176 CCC     881.109441  2 0.0011   402 | 1/23
 14 h-m-p  0.0003 0.0139  41.0584 +YCCC   880.770499  3 0.0022   434 | 1/23
 15 h-m-p  0.0009 0.0071 105.0523 CC      880.485447  1 0.0008   462 | 1/23
 16 h-m-p  0.0009 0.0121  94.7265 +YCCCCC   879.080625  5 0.0041   498 | 1/23
 17 h-m-p  0.0006 0.0028 355.6157 CCCCC   878.042424  4 0.0008   532 | 1/23
 18 h-m-p  0.0030 0.0149  10.1306 CCC     878.025426  2 0.0006   562 | 1/23
 19 h-m-p  0.0025 0.0317   2.5474 YC      878.019507  1 0.0013   589 | 1/23
 20 h-m-p  0.0012 0.0611   2.6652 YC      878.008158  1 0.0021   616 | 1/23
 21 h-m-p  0.0064 0.4403   0.8692 +YCCC   877.681532  3 0.0593   648 | 1/23
 22 h-m-p  0.0008 0.0061  66.9110 +YCCC   876.528392  3 0.0022   702 | 1/23
 23 h-m-p  0.3583 4.1263   0.4176 +YYCCC   876.007366  4 1.2153   735 | 1/23
 24 h-m-p  0.7620 3.8100   0.5076 +YYCYCCC   874.585815  6 2.4652   793 | 1/23
 25 h-m-p  0.0192 0.0961   8.0180 +YYCYCCC   873.775443  6 0.0669   852 | 1/23
 26 h-m-p  1.0706 5.3528   0.3896 CCC     873.210375  2 0.9791   882 | 1/23
 27 h-m-p  0.4024 2.0121   0.9341 CYC     873.109826  2 0.1302   933 | 1/23
 28 h-m-p  0.3039 1.5195   0.3818 CCCCC   872.901144  4 0.4926   989 | 1/23
 29 h-m-p  1.4350 7.1749   0.0109 YCC     872.833887  2 1.0539  1040 | 1/23
 30 h-m-p  0.1666 8.0000   0.0690 +CCC    872.810958  2 0.7967  1093 | 1/23
 31 h-m-p  1.3525 8.0000   0.0406 CC      872.801393  1 1.5431  1143 | 1/23
 32 h-m-p  1.6000 8.0000   0.0055 CC      872.797142  1 1.8490  1193 | 1/23
 33 h-m-p  0.8957 8.0000   0.0114 CC      872.796212  1 1.1341  1243 | 1/23
 34 h-m-p  1.6000 8.0000   0.0012 YC      872.796180  1 0.8518  1292 | 1/23
 35 h-m-p  1.6000 8.0000   0.0002 Y       872.796178  0 0.9582  1340 | 1/23
 36 h-m-p  1.6000 8.0000   0.0001 Y       872.796177  0 0.9170  1388 | 1/23
 37 h-m-p  1.6000 8.0000   0.0000 Y       872.796177  0 0.8719  1436 | 1/23
 38 h-m-p  1.6000 8.0000   0.0000 Y       872.796177  0 1.1396  1484 | 1/23
 39 h-m-p  1.3408 8.0000   0.0000 C       872.796177  0 0.5191  1532 | 1/23
 40 h-m-p  0.5649 8.0000   0.0000 Y       872.796177  0 0.1412  1580 | 1/23
 41 h-m-p  0.2375 8.0000   0.0000 -------------C   872.796177  0 0.0000  1641
Out..
lnL  =  -872.796177
1642 lfun, 18062 eigenQcodon, 328400 P(t)

Time used:  2:35


Model 8: beta&w>1

TREE #  1
(1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
initial w for M8:NSbetaw>1 reset.

    0.026591    0.096847    0.039206    0.012502    0.013366    0.013475    0.023465    0.007386    0.162234    0.008493    0.056454    0.100525    0.008488    0.027259    0.055251    0.074976    0.030754    0.018750    0.071872    0.040156    4.282625    0.900000    0.607855    1.105757    2.513519

ntime & nrate & np:    20     2    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 3.899347

np =    25
lnL0 =  -893.541026

Iterating by ming2
Initial: fx=   893.541026
x=  0.02659  0.09685  0.03921  0.01250  0.01337  0.01347  0.02347  0.00739  0.16223  0.00849  0.05645  0.10053  0.00849  0.02726  0.05525  0.07498  0.03075  0.01875  0.07187  0.04016  4.28263  0.90000  0.60785  1.10576  2.51352

  1 h-m-p  0.0000 0.0001 364.6108 ++      887.695068  m 0.0001    30 | 1/25
  2 h-m-p  0.0003 0.0014 107.4818 +YCCCC   883.200568  4 0.0008    66 | 1/25
  3 h-m-p  0.0001 0.0005 100.2581 +YCCC   882.390957  3 0.0003   100 | 1/25
  4 h-m-p  0.0001 0.0003  88.2133 +YYCC   881.871034  3 0.0002   133 | 1/25
  5 h-m-p  0.0004 0.0050  47.5113 +YYYCCCC   880.618063  6 0.0018   171 | 1/25
  6 h-m-p  0.0002 0.0010 234.4649 +YYCCCC   878.485377  5 0.0006   208 | 1/25
  7 h-m-p  0.0001 0.0007 503.8191 CYCCC   876.788669  4 0.0003   243 | 1/25
  8 h-m-p  0.0001 0.0006 230.6152 YCCCC   876.060582  4 0.0002   278 | 1/25
  9 h-m-p  0.0002 0.0008  53.5830 CCCC    875.943020  3 0.0002   312 | 1/25
 10 h-m-p  0.0003 0.0023  45.9606 CCC     875.807473  2 0.0004   344 | 1/25
 11 h-m-p  0.0010 0.0073  17.3639 YC      875.764777  1 0.0005   373 | 1/25
 12 h-m-p  0.0012 0.0195   7.0422 CCC     875.735367  2 0.0013   405 | 1/25
 13 h-m-p  0.0005 0.0165  20.6542 +CYC    875.634608  2 0.0017   437 | 1/25
 14 h-m-p  0.0005 0.0095  71.1061 +CCCC   875.147846  3 0.0024   472 | 1/25
 15 h-m-p  0.0006 0.0032 262.9585 CYC     874.750789  2 0.0006   503 | 1/25
 16 h-m-p  0.0017 0.0090  85.1332 YCC     874.461861  2 0.0013   534 | 1/25
 17 h-m-p  0.0013 0.0065  83.8996 YC      874.320914  1 0.0006   563 | 1/25
 18 h-m-p  0.0007 0.0033  33.3136 YCC     874.285154  2 0.0004   594 | 1/25
 19 h-m-p  0.0007 0.0203  19.4357 YCC     874.262540  2 0.0005   625 | 1/25
 20 h-m-p  0.0074 0.0463   1.3874 -CC     874.261165  1 0.0007   656 | 1/25
 21 h-m-p  0.0014 0.7009   0.6497 +++CCCC   873.919312  3 0.1204   693 | 1/25
 22 h-m-p  0.0011 0.0054  37.7649 CCCC    873.690182  3 0.0013   751 | 1/25
 23 h-m-p  0.0008 0.0071  67.3888 CCCC    873.315829  3 0.0012   785 | 1/25
 24 h-m-p  0.2732 6.1456   0.3071 +YCCC   873.105856  3 0.7700   819 | 1/25
 25 h-m-p  1.1616 8.0000   0.2036 YCCCC   872.901398  4 2.6228   878 | 1/25
 26 h-m-p  0.6507 3.2533   0.4005 CYCCC   872.660842  4 1.2730   938 | 1/25
 27 h-m-p  1.6000 8.0000   0.0803 YCC     872.597954  2 1.1553   993 | 1/25
 28 h-m-p  1.6000 8.0000   0.0436 YC      872.581863  1 1.1664  1046 | 1/25
 29 h-m-p  0.5767 8.0000   0.0882 YCC     872.565213  2 1.1764  1101 | 1/25
 30 h-m-p  0.6464 5.0409   0.1604 YCYC    872.526264  3 1.5088  1157 | 1/25
 31 h-m-p  0.2005 1.0025   0.7096 CYCCC   872.497428  4 0.3208  1216 | 1/25
 32 h-m-p  0.5814 2.9635   0.3916 YCCCC   872.414783  4 1.2022  1275 | 1/25
 33 h-m-p  0.7155 8.0000   0.6579 YCCC    872.336649  3 0.4176  1332 | 1/25
 34 h-m-p  0.3896 6.1441   0.7052 +YCCCCC   872.159595  5 1.7480  1394 | 1/25
 35 h-m-p  1.6000 8.0000   0.7146 CCC     872.038405  2 1.5114  1450 | 1/25
 36 h-m-p  1.1409 5.7045   0.3448 YYC     872.001097  2 0.8884  1504 | 1/25
 37 h-m-p  0.6759 3.6554   0.4533 YCC     871.992264  2 0.4135  1559 | 1/25
 38 h-m-p  1.6000 8.0000   0.0593 YC      871.988605  1 1.1286  1612 | 1/25
 39 h-m-p  1.6000 8.0000   0.0338 CC      871.987754  1 1.3726  1666 | 1/25
 40 h-m-p  1.6000 8.0000   0.0104 CC      871.987375  1 2.3320  1720 | 1/25
 41 h-m-p  1.6000 8.0000   0.0034 Y       871.987320  0 1.2630  1772 | 1/25
 42 h-m-p  1.6000 8.0000   0.0012 Y       871.987318  0 0.9295  1824 | 1/25
 43 h-m-p  1.6000 8.0000   0.0003 Y       871.987318  0 1.0309  1876 | 1/25
 44 h-m-p  1.6000 8.0000   0.0000 Y       871.987318  0 1.0540  1928 | 1/25
 45 h-m-p  0.8183 8.0000   0.0000 C       871.987318  0 1.0420  1980 | 1/25
 46 h-m-p  1.6000 8.0000   0.0000 +Y      871.987318  0 4.6457  2033 | 1/25
 47 h-m-p  1.3321 8.0000   0.0000 ----------------..  | 1/25
 48 h-m-p  0.0160 8.0000   0.0007 ------------- | 1/25
 49 h-m-p  0.0160 8.0000   0.0007 -------------
Out..
lnL  =  -871.987318
2226 lfun, 26712 eigenQcodon, 489720 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) =  -879.879745  S =  -833.558722   -40.029735
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  82 patterns   4:22
	did  20 /  82 patterns   4:22
	did  30 /  82 patterns   4:23
	did  40 /  82 patterns   4:23
	did  50 /  82 patterns   4:23
	did  60 /  82 patterns   4:23
	did  70 /  82 patterns   4:23
	did  80 /  82 patterns   4:23
	did  82 /  82 patterns   4:24
Time used:  4:24
CodeML output code: -1
Download 
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=15, Len=104 

gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C                                                 MKNPKEEIRRIRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C                                              MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           MKNPKRKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C                                             MKNPKKRSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C      MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C                                         MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C                                              MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           MKNPKKKSGRFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C                                            MKNPKKKSGGFRIVNMLGRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C                MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C               MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C   MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C                                                MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C                                         MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
                                                                                                                                            *****..   :****** ******.*:***********************

gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C                                                 LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C                                              LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C                                             LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C      LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C                                         LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C                                              LAFLRFTAIKPSLGLINRWGTVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C                                            LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C                LAFLRFMAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C               LAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKE
gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C   LAFLRFTAIKPSLGLINRWGSVGKKEAMEIMKKFKKDLAAMLRIINARKE
gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C                                                LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINAGKE
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C                                         LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
                                                                                                                                            ****** *************:****:****:**************** **

gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           KKRR
gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C                                                 KKRR
gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C                                              RKRR
gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           RKRR
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C                                             RKRR
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C      RKRR
gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C                                         KKRR
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C                                              RKRR
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C                                           RKRR
gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C                                            KKRR
gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C                KKRR
gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C               KKRR
gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C   KKRR
gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C                                                KKRR
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C                                         KKKR
                                                                                                                                            :*:*
Download 
>gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCTAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCTATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCCAAAGAAGAAATCCGGAGGATCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATA
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCCAAAGAAGAAATCCGGAGGATCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTTATCAA
CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAAGAG
AGGAAGAGACGT
>gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAGAGGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATTAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAGATAATAAAGAAGT
TTAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAGAAGAGATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
CGGCCGGACTTCTGCTGGGCCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
TAGATGGGGTTCCGTGGGGAAGAAGGAGGCTATGGAAATAATAAAAAAGT
TCAAGAAAGACCTTGCTGCCATGTTGAGAATTATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGGGGTTTGAAGAGGCTGC
CGGCCGGACTCCTGCTGGGCCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTCTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
TAGATGGGGTTCCGTGGGGAAGAAGGAGGCTATGGAAATAATAAAAAAGT
TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGGTTCACGGCAATCAAGCCATCACTGGGCCTTATCAA
CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTTGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAGAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
TTAGCCTTTTTGAGATTCACAGCAATCAAGCCATCACTGGGCCTCATCAA
CAGATGGGGTACCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAAAAAT
TTAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAGGAG
AGGAAGAGACGT
>gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAGAAGAAATCCGGAAGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTAAACCCCTTGGGAGGTTTGAAGAGGTTGC
CAGCCGGACTTCTGCTGGGTCATGGACCCATCAGAATGGTTTTGGCGATA
CTAGCCTTTTTGAGATTTACAGCAATCAAGCCATCACTGGGCCTTATCAA
CAGATGGGGTTCCGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTTGCTGCCATGTTGAGAATAATCAATGCTAGGAAAGAG
AGGAAGAGACGT
>gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AGGACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCTGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
CAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCATGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGATGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATGAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAGACGA
>gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCGATT
CTAGCCTTCTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGATGGGGTTCAGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTGGGAAGGAG
AAGAAGAGACGA
>gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C
ATGAAAAACCCAAAAAAGAAATCCGGAGGATTCCGGATTGTCAATATGCT
AAAACGCGGAGTAGCCCGTGTGAGCCCCTTTGGGGGCTTGAAGAGGCTGC
CAGCCGGACTTCTGCTGGGTCATGGGCCCATCAGGATGGTCTTGGCAATA
CTAGCCTTTTTGAGATTCACGGCAATCAAGCCATCACTGGGTCTCATCAA
TAGGTGGGGTTCTGTGGGGAAAAAAGAGGCTATGGAAATAATAAAGAAGT
TCAAGAAAGATCTGGCTGCCATGCTGAGAATAATCAATGCTAGGAAGGAG
AAGAAGAAACGA
Download 
>gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKEEIRRIRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKEEIRRIRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKRKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKRSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGTVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGRFRIVNMLKRGVARVNPLGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
RKRR
>gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLGRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFMAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKRR
>gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKDAMEIIKKFKKDLAAMLRIINARKE
KKRR
>gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIMKKFKKDLAAMLRIINARKE
KKRR
>gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINAGKE
KKRR
>gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C
MKNPKKKSGGFRIVNMLKRGVARVSPFGGLKRLPAGLLLGHGPIRMVLAI
LAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKE
KKKR
Download 
Reading sequence file aligned.fasta
Allocating space for 15 taxa and 312 sites
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig):  5.9%
Found 40 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to:      Phi.inf.list
Using a window size of 100 with k as 13

Calculating analytical mean and variance

Doing permutation test for PHI

Doing permutation test for NSS

Doing Permutation test for MAXCHI

 Writing  alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 41 polymorphic sites

       p-Value(s)
       ----------

NSS:                 0.00e+00  (1000 permutations)
Max Chi^2:           1.60e-02  (1000 permutations)
PHI (Permutation):   1.00e-03  (1000 permutations)
PHI (Normal):        6.19e-08
Download 
#NEXUS

[ID: 5441657506]
begin taxa;
	dimensions ntax=15;
	taxlabels
		gb_KX447510|Organism_Zika_virus|Strain_Name_1_0049_PF|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_EU545988|Organism_Zika_virus|Strain_Name_FSM|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_AY632535|Organism_Zika_virus|Strain_Name_MR_766|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KF383117|Organism_Zika_virus|Strain_Name_ArD128000|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KF383116|Organism_Zika_virus|Strain_Name_ArD7117|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KY241712|Organism_Zika_virus|Strain_Name_ZIKV-SG-042|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KY288905|Organism_Zika_virus|Strain_Name_MP1751|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KF383118|Organism_Zika_virus|Strain_Name_ArD157995|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KY328290|Organism_Zika_virus|Strain_Name_ZK-YN001|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_MF574571|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KX702400|Organism_Zika_virus|Strain_Name_Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KY785424|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KU761560|Organism_Zika_virus|Strain_Name_ZJ03|Protein_Name_capsid_protein_C|Gene_Symbol_C
		gb_KY241680|Organism_Zika_virus|Strain_Name_ZIKV-SG-010|Protein_Name_capsid_protein_C|Gene_Symbol_C
		;
end;
begin trees;
	translate
		1	gb_KX447510|Organism_Zika_virus|Strain_Name_1_0049_PF|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		2	gb_EU545988|Organism_Zika_virus|Strain_Name_FSM|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		3	gb_AY632535|Organism_Zika_virus|Strain_Name_MR_766|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		4	gb_KF383117|Organism_Zika_virus|Strain_Name_ArD128000|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		5	gb_KF383116|Organism_Zika_virus|Strain_Name_ArD7117|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		6	gb_KU963574|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		7	gb_KY241712|Organism_Zika_virus|Strain_Name_ZIKV-SG-042|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		8	gb_KY288905|Organism_Zika_virus|Strain_Name_MP1751|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		9	gb_KF383118|Organism_Zika_virus|Strain_Name_ArD157995|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		10	gb_KY328290|Organism_Zika_virus|Strain_Name_ZK-YN001|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		11	gb_MF574571|Organism_Zika_virus|Strain_Name_ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		12	gb_KX702400|Organism_Zika_virus|Strain_Name_Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		13	gb_KY785424|Organism_Zika_virus|Strain_Name_Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		14	gb_KU761560|Organism_Zika_virus|Strain_Name_ZJ03|Protein_Name_capsid_protein_C|Gene_Symbol_C,
		15	gb_KY241680|Organism_Zika_virus|Strain_Name_ZIKV-SG-010|Protein_Name_capsid_protein_C|Gene_Symbol_C
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.01166325,2:0.06644675,10:0.02195736,11:0.00747845,12:0.007952073,13:0.007861034,14:0.01243747,((((3:0.06501365,9:0.003898613)0.979:0.01843856,7:0.02194201)0.544:0.01468956,4:0.03269284,(5:0.01776392,6:0.01239411)1.000:0.03022994,8:0.02633213)1.000:0.08887183,15:0.02069303)0.527:0.009973503);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.01166325,2:0.06644675,10:0.02195736,11:0.00747845,12:0.007952073,13:0.007861034,14:0.01243747,((((3:0.06501365,9:0.003898613):0.01843856,7:0.02194201):0.01468956,4:0.03269284,(5:0.01776392,6:0.01239411):0.03022994,8:0.02633213):0.08887183,15:0.02069303):0.009973503);
end;
Download 
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -904.32          -928.62
2       -905.06          -929.06
--------------------------------------
TOTAL     -904.62          -928.86
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.596162    0.008314    0.430291    0.775473    0.587543   1202.83   1351.91    1.000
r(A<->C){all}   0.031876    0.000437    0.000029    0.072190    0.028215    837.49    921.55    1.000
r(A<->G){all}   0.300426    0.004537    0.183088    0.445040    0.297105    513.89    573.29    1.000
r(A<->T){all}   0.122645    0.001542    0.047636    0.196706    0.117938    614.31    653.59    1.000
r(C<->G){all}   0.025682    0.000412    0.000077    0.064511    0.021067    543.71    659.97    1.001
r(C<->T){all}   0.473610    0.007317    0.306951    0.639662    0.471423    500.12    502.99    1.001
r(G<->T){all}   0.045762    0.000644    0.002256    0.093212    0.042011    684.73    809.80    1.000
pi(A){all}      0.313542    0.000554    0.266559    0.356358    0.313504   1208.42   1302.18    1.000
pi(C){all}      0.192577    0.000413    0.153156    0.232237    0.192017   1192.06   1235.91    1.001
pi(G){all}      0.280818    0.000543    0.235507    0.325112    0.280091    989.47   1139.25    1.001
pi(T){all}      0.213063    0.000429    0.172701    0.253739    0.212570   1041.84   1170.64    1.000
alpha{1,2}      0.095377    0.004184    0.000229    0.210169    0.088981    809.61    905.28    1.000
alpha{3}        1.473509    0.422139    0.507450    2.776763    1.345862   1243.14   1350.30    1.001
pinvar{all}     0.185639    0.013253    0.000304    0.401313    0.170090    838.63   1001.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
Download 
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS1/Zikaomegamapresults/C/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =  15  ls = 104

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   2   2   2   3   1   0 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   0   0   0   0   0   0
    TTC   3   2   1   1   3   4 |     TCC   1   0   1   1   2   2 |     TAC   0   0   0   0   0   0 |     TGC   0   0   0   0   0   0
Leu TTA   0   0   0   0   0   0 |     TCA   2   2   1   2   1   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   3   3   6   5   5   5 |     TCG   0   0   0   0   0   0 |     TAG   0   0   0   0   0   0 | Trp TGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   1   1   3   2   2   1 | Pro CCT   1   0   0   0   0   0 | His CAT   1   1   1   1   1   1 | Arg CGT   1   1   2   2   2   2
    CTC   1   1   0   1   1   2 |     CCC   2   3   3   2   2   2 |     CAC   0   0   0   0   0   0 |     CGC   1   1   1   1   1   1
    CTA   2   2   2   2   2   2 |     CCA   2   2   2   3   2   2 | Gln CAA   0   0   0   0   0   0 |     CGA   1   1   0   0   0   0
    CTG   6   6   3   4   4   4 |     CCG   0   0   0   0   1   1 |     CAG   0   0   0   0   0   0 |     CGG   1   2   2   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   2   1   1   2   2   1 | Thr ACT   0   0   0   0   0   0 | Asn AAT   3   3   2   3   3   3 | Ser AGT   0   0   0   0   0   0
    ATC   4   6   6   3   4   4 |     ACC   0   0   0   0   0   0 |     AAC   1   1   3   2   2   2 |     AGC   1   1   0   0   0   0
    ATA   3   4   4   4   3   4 |     ACA   0   0   1   1   1   1 | Lys AAA   7   6   7   6   4   5 | Arg AGA   4   4   5   5   6   5
Met ATG   5   5   5   5   5   5 |     ACG   1   1   0   0   0   0 |     AAG   9   8   6   8  10  10 |     AGG   3   4   4   4   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   0   0   1   1   1   1 | Ala GCT   4   3   3   3   3   3 | Asp GAT   1   1   1   1   0   1 | Gly GGT   3   3   3   3   2   2
    GTC   2   2   1   1   1   1 |     GCC   4   4   4   4   4   4 |     GAC   0   0   0   0   1   0 |     GGC   1   1   1   1   2   2
    GTA   1   1   2   2   2   2 |     GCA   0   1   1   1   1   1 | Glu GAA   1   3   3   0   1   1 |     GGA   4   2   4   5   5   5
    GTG   2   2   1   1   1   1 |     GCG   1   1   1   1   1   1 |     GAG   2   2   2   3   2   2 |     GGG   3   3   1   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   1   2   2   2   2   2 | Ser TCT   0   0   0   0   0   0 | Tyr TAT   0   0   0   0   0   0 | Cys TGT   0   0   0   0   0   0
    TTC   3   2   2   3   3   3 |     TCC   2   1   2   1   1   1 |     TAC   0   0   0   0   0   0 |     TGC   0   0   0   0   0   0
Leu TTA   0   1   0   0   0   0 |     TCA   1   1   1   2   2   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   5   5   6   3   3   3 |     TCG   0   0   0   0   0   0 |     TAG   0   0   0   0   0   0 | Trp TGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   3   2   3   1   1   1 | Pro CCT   0   0   0   0   0   0 | His CAT   1   1   1   1   1   1 | Arg CGT   1   2   2   1   1   1
    CTC   0   1   0   1   1   1 |     CCC   2   2   2   2   2   2 |     CAC   0   0   0   0   0   0 |     CGC   1   1   1   1   1   1
    CTA   2   1   2   2   2   2 |     CCA   3   3   3   3   3   3 | Gln CAA   0   0   0   0   0   0 |     CGA   1   0   0   1   1   1
    CTG   4   4   3   6   6   6 |     CCG   0   0   0   0   0   0 |     CAG   0   0   0   0   0   0 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   1   1   1   2   2   2 | Thr ACT   0   0   0   0   0   0 | Asn AAT   2   2   2   2   3   3 | Ser AGT   0   0   0   0   0   0
    ATC   4   4   4   4   4   4 |     ACC   0   1   0   0   0   0 |     AAC   3   3   3   2   1   1 |     AGC   0   0   0   1   1   1
    ATA   4   4   4   3   3   3 |     ACA   0   1   1   0   0   0 | Lys AAA   6   8   7   6   7   7 | Arg AGA   4   5   6   4   4   4
Met ATG   5   5   5   5   6   5 |     ACG   1   0   0   1   0   1 |     AAG  10   7   8   9   9   9 |     AGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   1   1   0   0   0 | Ala GCT   3   3   3   4   3   3 | Asp GAT   1   1   1   1   1   2 | Gly GGT   3   3   3   3   3   3
    GTC   1   1   1   2   2   2 |     GCC   4   4   4   3   4   4 |     GAC   0   0   0   0   0   0 |     GGC   1   1   1   1   1   1
    GTA   2   2   2   1   1   1 |     GCA   1   1   1   1   1   1 | Glu GAA   1   1   1   1   1   1 |     GGA   6   6   5   5   4   4
    GTG   1   1   1   2   2   2 |     GCG   1   1   1   1   1   1 |     GAG   2   2   2   2   2   1 |     GGG   1   1   1   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------
Phe TTT   2   1   2 | Ser TCT   0   0   1 | Tyr TAT   0   0   0 | Cys TGT   0   0   0
    TTC   3   4   3 |     TCC   1   1   1 |     TAC   0   0   0 |     TGC   0   0   0
Leu TTA   0   0   0 |     TCA   2   2   1 | *** TAA   0   0   0 | *** TGA   0   0   0
    TTG   3   3   3 |     TCG   0   0   0 |     TAG   0   0   0 | Trp TGG   1   1   1
--------------------------------------------------------------------------------------
Leu CTT   1   1   1 | Pro CCT   0   0   0 | His CAT   1   1   1 | Arg CGT   1   1   1
    CTC   1   1   1 |     CCC   2   2   2 |     CAC   0   0   0 |     CGC   1   1   1
    CTA   2   2   2 |     CCA   3   3   3 | Gln CAA   0   0   0 |     CGA   1   1   1
    CTG   6   6   6 |     CCG   0   0   0 |     CAG   0   0   0 |     CGG   1   1   1
--------------------------------------------------------------------------------------
Ile ATT   2   2   1 | Thr ACT   0   0   0 | Asn AAT   3   3   3 | Ser AGT   0   0   0
    ATC   4   4   4 |     ACC   0   0   0 |     AAC   1   1   1 |     AGC   1   1   1
    ATA   2   3   4 |     ACA   0   0   0 | Lys AAA   7   7   8 | Arg AGA   4   4   2
Met ATG   6   5   5 |     ACG   1   1   1 |     AAG   9   9   9 |     AGG   3   2   4
--------------------------------------------------------------------------------------
Val GTT   0   0   0 | Ala GCT   3   3   3 | Asp GAT   1   1   1 | Gly GGT   3   3   3
    GTC   2   2   2 |     GCC   4   4   4 |     GAC   0   0   0 |     GGC   1   1   1
    GTA   1   1   1 |     GCA   1   1   2 | Glu GAA   1   1   1 |     GGA   4   4   4
    GTG   2   2   2 |     GCG   1   1   0 |     GAG   2   2   2 |     GGG   3   4   3
--------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.11538    C:0.19231    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.18269    C:0.20192    A:0.25962    G:0.35577
Average         T:0.21795    C:0.18910    A:0.30449    G:0.28846

#2: gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.09615    C:0.20192    A:0.42308    G:0.27885
position  2:    T:0.36538    C:0.16346    A:0.24038    G:0.23077
position  3:    T:0.15385    C:0.21154    A:0.26923    G:0.36538
Average         T:0.20513    C:0.19231    A:0.31090    G:0.29167

#3: gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.11538    C:0.18269    A:0.42308    G:0.27885
position  2:    T:0.36538    C:0.16346    A:0.24038    G:0.23077
position  3:    T:0.18269    C:0.20192    A:0.30769    G:0.30769
Average         T:0.22115    C:0.18269    A:0.32372    G:0.27244

#4: gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.12500    C:0.18269    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.23077    G:0.24038
position  3:    T:0.20192    C:0.16346    A:0.29808    G:0.33654
Average         T:0.22756    C:0.17308    A:0.31410    G:0.28526

#5: gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.12500    C:0.18269    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.23077    G:0.24038
position  3:    T:0.16346    C:0.22115    A:0.26923    G:0.34615
Average         T:0.21474    C:0.19231    A:0.30449    G:0.28846

#6: gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.12500    C:0.18269    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.14423    C:0.23077    A:0.27885    G:0.34615
Average         T:0.20833    C:0.19551    A:0.31090    G:0.28526

#7: gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.12500    C:0.18269    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.25000    G:0.22115
position  3:    T:0.16346    C:0.20192    A:0.29808    G:0.33654
Average         T:0.21474    C:0.18590    A:0.32051    G:0.27885

#8: gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.12500    C:0.17308    A:0.42308    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.17308    C:0.20192    A:0.32692    G:0.29808
Average         T:0.21795    C:0.18269    A:0.33013    G:0.26923

#9: gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C             
position  1:    T:0.13462    C:0.17308    A:0.42308    G:0.26923
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.18269    C:0.19231    A:0.31731    G:0.30769
Average         T:0.22436    C:0.17949    A:0.32692    G:0.26923

#10: gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C            
position  1:    T:0.11538    C:0.19231    A:0.40385    G:0.28846
position  2:    T:0.35577    C:0.17308    A:0.23077    G:0.24038
position  3:    T:0.16346    C:0.20192    A:0.27885    G:0.35577
Average         T:0.21154    C:0.18910    A:0.30449    G:0.29487

#11: gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C            
position  1:    T:0.11538    C:0.19231    A:0.41346    G:0.27885
position  2:    T:0.36538    C:0.16346    A:0.24038    G:0.23077
position  3:    T:0.16346    C:0.20192    A:0.27885    G:0.35577
Average         T:0.21474    C:0.18590    A:0.31090    G:0.28846

#12: gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C            
position  1:    T:0.11538    C:0.19231    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.17308    C:0.20192    A:0.27885    G:0.34615
Average         T:0.21474    C:0.18910    A:0.31090    G:0.28526

#13: gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C            
position  1:    T:0.11538    C:0.19231    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.16346    C:0.20192    A:0.26923    G:0.36538
Average         T:0.21154    C:0.18910    A:0.30769    G:0.29167

#14: gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C            
position  1:    T:0.11538    C:0.19231    A:0.40385    G:0.28846
position  2:    T:0.35577    C:0.17308    A:0.24038    G:0.23077
position  3:    T:0.15385    C:0.21154    A:0.27885    G:0.35577
Average         T:0.20833    C:0.19231    A:0.30769    G:0.29167

#15: gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C            
position  1:    T:0.11538    C:0.19231    A:0.41346    G:0.27885
position  2:    T:0.35577    C:0.17308    A:0.25000    G:0.22115
position  3:    T:0.16346    C:0.20192    A:0.27885    G:0.35577
Average         T:0.21154    C:0.18910    A:0.31410    G:0.28526

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      26 | Ser S TCT       1 | Tyr Y TAT       0 | Cys C TGT       0
      TTC      40 |       TCC      18 |       TAC       0 |       TGC       0
Leu L TTA       1 |       TCA      23 | *** * TAA       0 | *** * TGA       0
      TTG      61 |       TCG       0 |       TAG       0 | Trp W TGG      15
------------------------------------------------------------------------------
Leu L CTT      24 | Pro P CCT       1 | His H CAT      15 | Arg R CGT      21
      CTC      13 |       CCC      32 |       CAC       0 |       CGC      15
      CTA      29 |       CCA      40 | Gln Q CAA       0 |       CGA       9
      CTG      74 |       CCG       2 |       CAG       0 |       CGG      17
------------------------------------------------------------------------------
Ile I ATT      23 | Thr T ACT       0 | Asn N AAT      40 | Ser S AGT       0
      ATC      63 |       ACC       1 |       AAC      27 |       AGC       8
      ATA      52 |       ACA       6 | Lys K AAA      98 | Arg R AGA      66
Met M ATG      77 |       ACG       8 |       AAG     130 |       AGG      48
------------------------------------------------------------------------------
Val V GTT       7 | Ala A GCT      47 | Asp D GAT      15 | Gly G GGT      43
      GTC      23 |       GCC      59 |       GAC       1 |       GGC      17
      GTA      22 |       GCA      15 | Glu E GAA      18 |       GGA      67
      GTG      23 |       GCG      14 |       GAG      30 |       GGG      35
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.11859    C:0.18718    A:0.41474    G:0.27949
position  2:    T:0.35769    C:0.17115    A:0.23974    G:0.23141
position  3:    T:0.16859    C:0.20321    A:0.28590    G:0.34231
Average         T:0.21496    C:0.18718    A:0.31346    G:0.28440


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C                  
gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.3715 (0.0304 0.0819)
gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.1143 (0.0438 0.3829) 0.0489 (0.0129 0.2631)
gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.0618 (0.0172 0.2790) 0.1621 (0.0484 0.2984) 0.1659 (0.0348 0.2096)
gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.0481 (0.0172 0.3584) 0.1272 (0.0484 0.3801) 0.1232 (0.0348 0.2822) 0.0491 (0.0086 0.1745)
gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.0358 (0.0129 0.3594) 0.1149 (0.0438 0.3812) 0.1071 (0.0303 0.2830) 0.0244 (0.0043 0.1749) 0.0791 (0.0043 0.0539)
gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.0328 (0.0086 0.2610) 0.1405 (0.0393 0.2799) 0.2175 (0.0348 0.1598) 0.0447 (0.0086 0.1913) 0.0379 (0.0086 0.2257) 0.0188 (0.0043 0.2263)
gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.0506 (0.0172 0.3400) 0.1336 (0.0483 0.3612) 0.1791 (0.0347 0.1938) 0.0670 (0.0085 0.1276) 0.0537 (0.0085 0.1593) 0.0267 (0.0043 0.1597) 0.0595 (0.0085 0.1435)
gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C                   0.0504 (0.0172 0.3412) 0.1082 (0.0392 0.3625) 0.3751 (0.0259 0.0689) 0.0667 (0.0085 0.1280) 0.0443 (0.0085 0.1929) 0.0220 (0.0043 0.1934) 0.1028 (0.0085 0.0830) 0.0752 (0.0085 0.1134)
gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C                  0.1611 (0.0086 0.0533) 0.4105 (0.0394 0.0960) 0.1472 (0.0529 0.3594) 0.0939 (0.0260 0.2775) 0.0731 (0.0260 0.3563) 0.0605 (0.0216 0.3573) 0.0770 (0.0173 0.2239) 0.0871 (0.0260 0.2984) 0.0867 (0.0260 0.2994)
gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C                  0.1611 (0.0043 0.0265) 0.5110 (0.0348 0.0681) 0.1424 (0.0504 0.3541) 0.1009 (0.0238 0.2353) 0.0765 (0.0237 0.3105) 0.0622 (0.0194 0.3114) 0.0567 (0.0129 0.2269) 0.0809 (0.0237 0.2929) 0.0806 (0.0237 0.2939) 0.4890 (0.0129 0.0264)
gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C                  0.1624 (0.0043 0.0263) 0.5154 (0.0349 0.0677) 0.1334 (0.0483 0.3618) 0.0891 (0.0216 0.2425) 0.0679 (0.0216 0.3179) 0.0540 (0.0172 0.3188) 0.0572 (0.0129 0.2253) 0.0718 (0.0216 0.3003) 0.0715 (0.0215 0.3013) 0.4930 (0.0129 0.0262)-1.0000 (0.0086 0.0000)
gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C                  0.1616 (0.0043 0.0264) 0.5126 (0.0348 0.0680) 0.1325 (0.0482 0.3636) 0.0886 (0.0216 0.2436) 0.0675 (0.0216 0.3195) 0.0537 (0.0172 0.3204) 0.0568 (0.0129 0.2263) 0.0714 (0.0215 0.3018) 0.0711 (0.0215 0.3028) 0.4904 (0.0129 0.0263)-1.0000 (0.0085 0.0000)-1.0000 (0.0086 0.0000)
gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C                  0.1077 (0.0043 0.0397) 0.4271 (0.0349 0.0817) 0.1265 (0.0483 0.3818) 0.0833 (0.0216 0.2597) 0.0642 (0.0216 0.3368) 0.0578 (0.0172 0.2982) 0.0532 (0.0129 0.2422) 0.0677 (0.0216 0.3189) 0.0674 (0.0216 0.3200) 0.3270 (0.0129 0.0395) 0.6539 (0.0086 0.0131) 0.6593 (0.0086 0.0130) 0.6558 (0.0086 0.0131)
gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C                  0.0520 (0.0043 0.0822) 0.3595 (0.0348 0.0969) 0.1252 (0.0482 0.3849) 0.0770 (0.0216 0.2803) 0.0636 (0.0216 0.3394) 0.0505 (0.0172 0.3404) 0.0527 (0.0129 0.2440) 0.0670 (0.0215 0.3213) 0.0667 (0.0215 0.3225) 0.1577 (0.0129 0.0818) 0.1578 (0.0085 0.0541) 0.1591 (0.0086 0.0538) 0.1583 (0.0085 0.0540) 0.1266 (0.0086 0.0677)


Model 0: one-ratio


TREE #  1:  (1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
lnL(ntime: 20  np: 22):   -884.837533      +0.000000
  16..1    16..2    16..10   16..11   16..12   16..13   16..14   16..17   17..18   18..19   19..20   20..3    20..9    19..7    18..4    18..21   21..5    21..6    18..8    17..15 
 0.019327 0.121670 0.038747 0.009569 0.009603 0.009562 0.019197 0.017145 0.159733 0.038949 0.029315 0.110351 0.000004 0.050060 0.061908 0.050108 0.029685 0.019558 0.065105 0.033047 4.215789 0.168777

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.89264

(1: 0.019327, 2: 0.121670, 10: 0.038747, 11: 0.009569, 12: 0.009603, 13: 0.009562, 14: 0.019197, ((((3: 0.110351, 9: 0.000004): 0.029315, 7: 0.050060): 0.038949, 4: 0.061908, (5: 0.029685, 6: 0.019558): 0.050108, 8: 0.065105): 0.159733, 15: 0.033047): 0.017145);

(gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019327, gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.121670, gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.038747, gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009569, gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009603, gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009562, gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019197, ((((gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.110351, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.000004): 0.029315, gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.050060): 0.038949, gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.061908, (gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.029685, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019558): 0.050108, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.065105): 0.159733, gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.033047): 0.017145);

Detailed output identifying parameters

kappa (ts/tv) =  4.21579

omega (dN/dS) =  0.16878

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1      0.019   227.7    84.3  0.1688  0.0028  0.0164   0.6   1.4
  16..2      0.122   227.7    84.3  0.1688  0.0174  0.1031   4.0   8.7
  16..10     0.039   227.7    84.3  0.1688  0.0055  0.0328   1.3   2.8
  16..11     0.010   227.7    84.3  0.1688  0.0014  0.0081   0.3   0.7
  16..12     0.010   227.7    84.3  0.1688  0.0014  0.0081   0.3   0.7
  16..13     0.010   227.7    84.3  0.1688  0.0014  0.0081   0.3   0.7
  16..14     0.019   227.7    84.3  0.1688  0.0027  0.0163   0.6   1.4
  16..17     0.017   227.7    84.3  0.1688  0.0025  0.0145   0.6   1.2
  17..18     0.160   227.7    84.3  0.1688  0.0229  0.1354   5.2  11.4
  18..19     0.039   227.7    84.3  0.1688  0.0056  0.0330   1.3   2.8
  19..20     0.029   227.7    84.3  0.1688  0.0042  0.0248   1.0   2.1
  20..3      0.110   227.7    84.3  0.1688  0.0158  0.0935   3.6   7.9
  20..9      0.000   227.7    84.3  0.1688  0.0000  0.0000   0.0   0.0
  19..7      0.050   227.7    84.3  0.1688  0.0072  0.0424   1.6   3.6
  18..4      0.062   227.7    84.3  0.1688  0.0089  0.0525   2.0   4.4
  18..21     0.050   227.7    84.3  0.1688  0.0072  0.0425   1.6   3.6
  21..5      0.030   227.7    84.3  0.1688  0.0042  0.0252   1.0   2.1
  21..6      0.020   227.7    84.3  0.1688  0.0028  0.0166   0.6   1.4
  18..8      0.065   227.7    84.3  0.1688  0.0093  0.0552   2.1   4.6
  17..15     0.033   227.7    84.3  0.1688  0.0047  0.0280   1.1   2.4

tree length for dN:       0.1277
tree length for dS:       0.7566


Time used:  0:10


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
lnL(ntime: 20  np: 23):   -872.698599      +0.000000
  16..1    16..2    16..10   16..11   16..12   16..13   16..14   16..17   17..18   18..19   19..20   20..3    20..9    19..7    18..4    18..21   21..5    21..6    18..8    17..15 
 0.019572 0.125264 0.039408 0.009663 0.009735 0.009674 0.019461 0.018030 0.165818 0.040191 0.029660 0.113482 0.000004 0.051165 0.063286 0.051421 0.029985 0.020146 0.066413 0.033105 4.342616 0.840093 0.026477

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.91548

(1: 0.019572, 2: 0.125264, 10: 0.039408, 11: 0.009663, 12: 0.009735, 13: 0.009674, 14: 0.019461, ((((3: 0.113482, 9: 0.000004): 0.029660, 7: 0.051165): 0.040191, 4: 0.063286, (5: 0.029985, 6: 0.020146): 0.051421, 8: 0.066413): 0.165818, 15: 0.033105): 0.018030);

(gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019572, gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.125264, gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.039408, gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009663, gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009735, gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009674, gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019461, ((((gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.113482, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.000004): 0.029660, gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.051165): 0.040191, gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.063286, (gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.029985, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020146): 0.051421, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.066413): 0.165818, gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.033105): 0.018030);

Detailed output identifying parameters

kappa (ts/tv) =  4.34262


dN/dS (w) for site classes (K=2)

p:   0.84009  0.15991
w:   0.02648  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.020    227.5     84.5   0.1822   0.0029   0.0162    0.7    1.4
  16..2       0.125    227.5     84.5   0.1822   0.0188   0.1035    4.3    8.7
  16..10      0.039    227.5     84.5   0.1822   0.0059   0.0326    1.3    2.7
  16..11      0.010    227.5     84.5   0.1822   0.0015   0.0080    0.3    0.7
  16..12      0.010    227.5     84.5   0.1822   0.0015   0.0080    0.3    0.7
  16..13      0.010    227.5     84.5   0.1822   0.0015   0.0080    0.3    0.7
  16..14      0.019    227.5     84.5   0.1822   0.0029   0.0161    0.7    1.4
  16..17      0.018    227.5     84.5   0.1822   0.0027   0.0149    0.6    1.3
  17..18      0.166    227.5     84.5   0.1822   0.0249   0.1370    5.7   11.6
  18..19      0.040    227.5     84.5   0.1822   0.0060   0.0332    1.4    2.8
  19..20      0.030    227.5     84.5   0.1822   0.0045   0.0245    1.0    2.1
  20..3       0.113    227.5     84.5   0.1822   0.0171   0.0937    3.9    7.9
  20..9       0.000    227.5     84.5   0.1822   0.0000   0.0000    0.0    0.0
  19..7       0.051    227.5     84.5   0.1822   0.0077   0.0423    1.8    3.6
  18..4       0.063    227.5     84.5   0.1822   0.0095   0.0523    2.2    4.4
  18..21      0.051    227.5     84.5   0.1822   0.0077   0.0425    1.8    3.6
  21..5       0.030    227.5     84.5   0.1822   0.0045   0.0248    1.0    2.1
  21..6       0.020    227.5     84.5   0.1822   0.0030   0.0166    0.7    1.4
  18..8       0.066    227.5     84.5   0.1822   0.0100   0.0549    2.3    4.6
  17..15      0.033    227.5     84.5   0.1822   0.0050   0.0273    1.1    2.3


Time used:  0:22


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
lnL(ntime: 20  np: 25):   -872.147493      +0.000000
  16..1    16..2    16..10   16..11   16..12   16..13   16..14   16..17   17..18   18..19   19..20   20..3    20..9    19..7    18..4    18..21   21..5    21..6    18..8    17..15 
 0.020375 0.129837 0.041021 0.010063 0.010133 0.010072 0.020261 0.018823 0.172185 0.041825 0.030868 0.117614 0.000004 0.053227 0.065786 0.053481 0.031199 0.020962 0.069212 0.034406 4.457893 0.843244 0.149157 0.028795 6.221128

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.95136

(1: 0.020375, 2: 0.129837, 10: 0.041021, 11: 0.010063, 12: 0.010133, 13: 0.010072, 14: 0.020261, ((((3: 0.117614, 9: 0.000004): 0.030868, 7: 0.053227): 0.041825, 4: 0.065786, (5: 0.031199, 6: 0.020962): 0.053481, 8: 0.069212): 0.172185, 15: 0.034406): 0.018823);

(gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020375, gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.129837, gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.041021, gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.010063, gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.010133, gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.010072, gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020261, ((((gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.117614, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.000004): 0.030868, gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.053227): 0.041825, gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.065786, (gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.031199, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020962): 0.053481, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.069212): 0.172185, gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.034406): 0.018823);

Detailed output identifying parameters

kappa (ts/tv) =  4.45789


dN/dS (w) for site classes (K=3)

p:   0.84324  0.14916  0.00760
w:   0.02879  1.00000  6.22113

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.020    227.3     84.7   0.2207   0.0035   0.0157    0.8    1.3
  16..2       0.130    227.3     84.7   0.2207   0.0221   0.1001    5.0    8.5
  16..10      0.041    227.3     84.7   0.2207   0.0070   0.0316    1.6    2.7
  16..11      0.010    227.3     84.7   0.2207   0.0017   0.0078    0.4    0.7
  16..12      0.010    227.3     84.7   0.2207   0.0017   0.0078    0.4    0.7
  16..13      0.010    227.3     84.7   0.2207   0.0017   0.0078    0.4    0.7
  16..14      0.020    227.3     84.7   0.2207   0.0034   0.0156    0.8    1.3
  16..17      0.019    227.3     84.7   0.2207   0.0032   0.0145    0.7    1.2
  17..18      0.172    227.3     84.7   0.2207   0.0293   0.1328    6.7   11.2
  18..19      0.042    227.3     84.7   0.2207   0.0071   0.0323    1.6    2.7
  19..20      0.031    227.3     84.7   0.2207   0.0053   0.0238    1.2    2.0
  20..3       0.118    227.3     84.7   0.2207   0.0200   0.0907    4.6    7.7
  20..9       0.000    227.3     84.7   0.2207   0.0000   0.0000    0.0    0.0
  19..7       0.053    227.3     84.7   0.2207   0.0091   0.0411    2.1    3.5
  18..4       0.066    227.3     84.7   0.2207   0.0112   0.0507    2.5    4.3
  18..21      0.053    227.3     84.7   0.2207   0.0091   0.0413    2.1    3.5
  21..5       0.031    227.3     84.7   0.2207   0.0053   0.0241    1.2    2.0
  21..6       0.021    227.3     84.7   0.2207   0.0036   0.0162    0.8    1.4
  18..8       0.069    227.3     84.7   0.2207   0.0118   0.0534    2.7    4.5
  17..15      0.034    227.3     84.7   0.2207   0.0059   0.0265    1.3    2.2


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C)

            Pr(w>1)     post mean +- SE for w

     8 S      0.745         4.889


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C)

            Pr(w>1)     post mean +- SE for w

     8 S      0.837         3.794 +- 2.818



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.992  0.008  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.328  0.166  0.102  0.081  0.071  0.065  0.058  0.051  0.043  0.036

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.054
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.042 0.585
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.007 0.057 0.176 0.072

sum of density on p0-p1 =   1.000000

Time used:  0:55


Model 3: discrete (3 categories)


TREE #  1:  (1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
lnL(ntime: 20  np: 26):   -872.697382      +0.000000
  16..1    16..2    16..10   16..11   16..12   16..13   16..14   16..17   17..18   18..19   19..20   20..3    20..9    19..7    18..4    18..21   21..5    21..6    18..8    17..15 
 0.019579 0.125328 0.039424 0.009667 0.009738 0.009677 0.019468 0.018039 0.165885 0.040216 0.029666 0.113538 0.000004 0.051185 0.063304 0.051443 0.029989 0.020158 0.066445 0.033116 4.350703 0.394002 0.448870 0.027376 0.027377 1.021249

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.91587

(1: 0.019579, 2: 0.125328, 10: 0.039424, 11: 0.009667, 12: 0.009738, 13: 0.009677, 14: 0.019468, ((((3: 0.113538, 9: 0.000004): 0.029666, 7: 0.051185): 0.040216, 4: 0.063304, (5: 0.029989, 6: 0.020158): 0.051443, 8: 0.066445): 0.165885, 15: 0.033116): 0.018039);

(gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019579, gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.125328, gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.039424, gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009667, gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009738, gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009677, gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019468, ((((gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.113538, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.000004): 0.029666, gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.051185): 0.040216, gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.063304, (gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.029989, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020158): 0.051443, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.066445): 0.165885, gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.033116): 0.018039);

Detailed output identifying parameters

kappa (ts/tv) =  4.35070


dN/dS (w) for site classes (K=3)

p:   0.39400  0.44887  0.15713
w:   0.02738  0.02738  1.02125

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.020    227.5     84.5   0.1835   0.0030   0.0161    0.7    1.4
  16..2       0.125    227.5     84.5   0.1835   0.0190   0.1032    4.3    8.7
  16..10      0.039    227.5     84.5   0.1835   0.0060   0.0325    1.4    2.7
  16..11      0.010    227.5     84.5   0.1835   0.0015   0.0080    0.3    0.7
  16..12      0.010    227.5     84.5   0.1835   0.0015   0.0080    0.3    0.7
  16..13      0.010    227.5     84.5   0.1835   0.0015   0.0080    0.3    0.7
  16..14      0.019    227.5     84.5   0.1835   0.0029   0.0160    0.7    1.4
  16..17      0.018    227.5     84.5   0.1835   0.0027   0.0149    0.6    1.3
  17..18      0.166    227.5     84.5   0.1835   0.0251   0.1367    5.7   11.5
  18..19      0.040    227.5     84.5   0.1835   0.0061   0.0331    1.4    2.8
  19..20      0.030    227.5     84.5   0.1835   0.0045   0.0244    1.0    2.1
  20..3       0.114    227.5     84.5   0.1835   0.0172   0.0935    3.9    7.9
  20..9       0.000    227.5     84.5   0.1835   0.0000   0.0000    0.0    0.0
  19..7       0.051    227.5     84.5   0.1835   0.0077   0.0422    1.8    3.6
  18..4       0.063    227.5     84.5   0.1835   0.0096   0.0522    2.2    4.4
  18..21      0.051    227.5     84.5   0.1835   0.0078   0.0424    1.8    3.6
  21..5       0.030    227.5     84.5   0.1835   0.0045   0.0247    1.0    2.1
  21..6       0.020    227.5     84.5   0.1835   0.0030   0.0166    0.7    1.4
  18..8       0.066    227.5     84.5   0.1835   0.0100   0.0547    2.3    4.6
  17..15      0.033    227.5     84.5   0.1835   0.0050   0.0273    1.1    2.3


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C)

            Pr(w>1)     post mean +- SE for w

     6 K      0.999**       1.020
     7 K      0.999**       1.021
     8 S      1.000**       1.021
     9 G      0.983*        1.005
    10 G      0.981*        1.003
    11 F      0.990**       1.011
    18 K      0.976*        0.997
    25 S      0.587         0.610
    27 F      0.747         0.770
    71 S      0.781         0.804
   101 K      0.968*        0.990
   103 R      0.552         0.576


Time used:  1:22


Model 7: beta (10 categories)


TREE #  1:  (1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
lnL(ntime: 20  np: 23):   -872.796177      +0.000000
  16..1    16..2    16..10   16..11   16..12   16..13   16..14   16..17   17..18   18..19   19..20   20..3    20..9    19..7    18..4    18..21   21..5    21..6    18..8    17..15 
 0.019517 0.124740 0.039278 0.009631 0.009712 0.009643 0.019410 0.017986 0.165311 0.039969 0.029614 0.113053 0.000004 0.051007 0.063132 0.051255 0.029946 0.020061 0.066191 0.032988 4.282625 0.059487 0.281154

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.91245

(1: 0.019517, 2: 0.124740, 10: 0.039278, 11: 0.009631, 12: 0.009712, 13: 0.009643, 14: 0.019410, ((((3: 0.113053, 9: 0.000004): 0.029614, 7: 0.051007): 0.039969, 4: 0.063132, (5: 0.029946, 6: 0.020061): 0.051255, 8: 0.066191): 0.165311, 15: 0.032988): 0.017986);

(gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019517, gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.124740, gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.039278, gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009631, gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009712, gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.009643, gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.019410, ((((gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.113053, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.000004): 0.029614, gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.051007): 0.039969, gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.063132, (gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.029946, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020061): 0.051255, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.066191): 0.165311, gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.032988): 0.017986);

Detailed output identifying parameters

kappa (ts/tv) =  4.28263

Parameters in M7 (beta):
 p =   0.05949  q =   0.28115


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00003  0.00075  0.01232  0.12587  0.61815  0.98927

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.020    227.6     84.4   0.1746   0.0029   0.0164    0.7    1.4
  16..2       0.125    227.6     84.4   0.1746   0.0183   0.1045    4.2    8.8
  16..10      0.039    227.6     84.4   0.1746   0.0057   0.0329    1.3    2.8
  16..11      0.010    227.6     84.4   0.1746   0.0014   0.0081    0.3    0.7
  16..12      0.010    227.6     84.4   0.1746   0.0014   0.0081    0.3    0.7
  16..13      0.010    227.6     84.4   0.1746   0.0014   0.0081    0.3    0.7
  16..14      0.019    227.6     84.4   0.1746   0.0028   0.0163    0.6    1.4
  16..17      0.018    227.6     84.4   0.1746   0.0026   0.0151    0.6    1.3
  17..18      0.165    227.6     84.4   0.1746   0.0242   0.1385    5.5   11.7
  18..19      0.040    227.6     84.4   0.1746   0.0058   0.0335    1.3    2.8
  19..20      0.030    227.6     84.4   0.1746   0.0043   0.0248    1.0    2.1
  20..3       0.113    227.6     84.4   0.1746   0.0165   0.0947    3.8    8.0
  20..9       0.000    227.6     84.4   0.1746   0.0000   0.0000    0.0    0.0
  19..7       0.051    227.6     84.4   0.1746   0.0075   0.0427    1.7    3.6
  18..4       0.063    227.6     84.4   0.1746   0.0092   0.0529    2.1    4.5
  18..21      0.051    227.6     84.4   0.1746   0.0075   0.0429    1.7    3.6
  21..5       0.030    227.6     84.4   0.1746   0.0044   0.0251    1.0    2.1
  21..6       0.020    227.6     84.4   0.1746   0.0029   0.0168    0.7    1.4
  18..8       0.066    227.6     84.4   0.1746   0.0097   0.0555    2.2    4.7
  17..15      0.033    227.6     84.4   0.1746   0.0048   0.0276    1.1    2.3


Time used:  2:35


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, 2, 10, 11, 12, 13, 14, ((((3, 9), 7), 4, (5, 6), 8), 15));   MP score: 81
check convergence..
lnL(ntime: 20  np: 25):   -871.987318      +0.000000
  16..1    16..2    16..10   16..11   16..12   16..13   16..14   16..17   17..18   18..19   19..20   20..3    20..9    19..7    18..4    18..21   21..5    21..6    18..8    17..15 
 0.020432 0.129897 0.041108 0.010088 0.010164 0.010097 0.020317 0.018815 0.172550 0.041778 0.030991 0.117675 0.000004 0.053349 0.065991 0.053590 0.031332 0.020978 0.069308 0.034534 4.383334 0.991446 0.081382 0.427562 6.064528

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.95300

(1: 0.020432, 2: 0.129897, 10: 0.041108, 11: 0.010088, 12: 0.010164, 13: 0.010097, 14: 0.020317, ((((3: 0.117675, 9: 0.000004): 0.030991, 7: 0.053349): 0.041778, 4: 0.065991, (5: 0.031332, 6: 0.020978): 0.053590, 8: 0.069308): 0.172550, 15: 0.034534): 0.018815);

(gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020432, gb:EU545988|Organism:Zika_virus|Strain_Name:FSM|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.129897, gb:KY328290|Organism:Zika_virus|Strain_Name:ZK-YN001|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.041108, gb:MF574571|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/COL/FLR_00005/2015|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.010088, gb:KX702400|Organism:Zika_virus|Strain_Name:Zika_virus/Homo_sapiens/VEN/UF-1/2016|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.010164, gb:KY785424|Organism:Zika_virus|Strain_Name:Zika_virus/H.sapiens-wt/JAM/2016/MA-WGS16-025-SER|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.010097, gb:KU761560|Organism:Zika_virus|Strain_Name:ZJ03|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020317, ((((gb:AY632535|Organism:Zika_virus|Strain_Name:MR_766|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.117675, gb:KF383118|Organism:Zika_virus|Strain_Name:ArD157995|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.000004): 0.030991, gb:KY241712|Organism:Zika_virus|Strain_Name:ZIKV-SG-042|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.053349): 0.041778, gb:KF383117|Organism:Zika_virus|Strain_Name:ArD128000|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.065991, (gb:KF383116|Organism:Zika_virus|Strain_Name:ArD7117|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.031332, gb:KU963574|Organism:Zika_virus|Strain_Name:ZIKV/Homo_sapiens/NGA/IbH-30656_SM21V1-V3/1968|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.020978): 0.053590, gb:KY288905|Organism:Zika_virus|Strain_Name:MP1751|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.069308): 0.172550, gb:KY241680|Organism:Zika_virus|Strain_Name:ZIKV-SG-010|Protein_Name:capsid_protein_C|Gene_Symbol:C: 0.034534): 0.018815);

Detailed output identifying parameters

kappa (ts/tv) =  4.38333

Parameters in M8 (beta&w>1):
  p0 =   0.99145  p =   0.08138 q =   0.42756
 (p1 =   0.00855) w =   6.06453


dN/dS (w) for site classes (K=11)

p:   0.09914  0.09914  0.09914  0.09914  0.09914  0.09914  0.09914  0.09914  0.09914  0.09914  0.00855
w:   0.00000  0.00000  0.00000  0.00001  0.00028  0.00326  0.02511  0.13677  0.49312  0.94249  6.06453

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  16..1       0.020    227.5     84.5   0.2106   0.0034   0.0160    0.8    1.4
  16..2       0.130    227.5     84.5   0.2106   0.0215   0.1020    4.9    8.6
  16..10      0.041    227.5     84.5   0.2106   0.0068   0.0323    1.5    2.7
  16..11      0.010    227.5     84.5   0.2106   0.0017   0.0079    0.4    0.7
  16..12      0.010    227.5     84.5   0.2106   0.0017   0.0080    0.4    0.7
  16..13      0.010    227.5     84.5   0.2106   0.0017   0.0079    0.4    0.7
  16..14      0.020    227.5     84.5   0.2106   0.0034   0.0160    0.8    1.3
  16..17      0.019    227.5     84.5   0.2106   0.0031   0.0148    0.7    1.2
  17..18      0.173    227.5     84.5   0.2106   0.0285   0.1355    6.5   11.5
  18..19      0.042    227.5     84.5   0.2106   0.0069   0.0328    1.6    2.8
  19..20      0.031    227.5     84.5   0.2106   0.0051   0.0243    1.2    2.1
  20..3       0.118    227.5     84.5   0.2106   0.0195   0.0924    4.4    7.8
  20..9       0.000    227.5     84.5   0.2106   0.0000   0.0000    0.0    0.0
  19..7       0.053    227.5     84.5   0.2106   0.0088   0.0419    2.0    3.5
  18..4       0.066    227.5     84.5   0.2106   0.0109   0.0518    2.5    4.4
  18..21      0.054    227.5     84.5   0.2106   0.0089   0.0421    2.0    3.6
  21..5       0.031    227.5     84.5   0.2106   0.0052   0.0246    1.2    2.1
  21..6       0.021    227.5     84.5   0.2106   0.0035   0.0165    0.8    1.4
  18..8       0.069    227.5     84.5   0.2106   0.0115   0.0544    2.6    4.6
  17..15      0.035    227.5     84.5   0.2106   0.0057   0.0271    1.3    2.3


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C)

            Pr(w>1)     post mean +- SE for w

     8 S      0.836         5.216


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: gb:KX447510|Organism:Zika_virus|Strain_Name:1_0049_PF|Protein_Name:capsid_protein_C|Gene_Symbol:C)

            Pr(w>1)     post mean +- SE for w

     8 S      0.942         2.889 +- 2.136



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.001  0.077  0.923
p :   0.859  0.135  0.006  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.004  0.062  0.122  0.138  0.135  0.131  0.131  0.135  0.140
ws:   0.456  0.246  0.100  0.054  0.038  0.030  0.025  0.021  0.017  0.014

Time used:  4:24
Download 
Model 1: NearlyNeutral	-872.698599
Model 2: PositiveSelection	-872.147493
Model 0: one-ratio	-884.837533
Model 3: discrete	-872.697382
Model 7: beta	-872.796177
Model 8: beta&w>1	-871.987318


Model 0 vs 1	24.277868000000126

Model 2 vs 1	1.1022119999997813

Model 8 vs 7	1.617717999999968
Download 
		omega		Posterior		rho				Synonymous theta			kappa			phi	
Site	Lower	Point	Higher	prob of +ve	Lower	Point	Higher		Lower	Point	Higher	Lower	Point	Higher	Lower	Point	Higher
	95% HPD	estimate	95% HPD	selection	95% HPD	estimate	95% HPD		95% HPD	estimate	95% HPD	95% HPD	estimate	95% HPD	95% HPD	estimate	95% HPD
0	0.0100142	0.0567842	0.642518	0.0124389	0.010078	0.213583	1.88793		0.118339	0.163191	0.219916	3.69047	7.02596	13.2077	0	0	0
1	0.0100407	0.0570333	0.647091	0.0133274	0.010078	0.205517	1.55821
2	0.0100142	0.057677	0.655913	0.0133274	0.0127437	0.197802	1.55272
3	0.0100142	0.0612475	0.764686	0.0235451	0.0137158	0.195144	1.55351
4	0.0100142	0.0915694	1.39879	0.104842	0.0138925	0.181077	1.30468
5	0.443101	1.40739	4.64317	0.749	0.013534	0.172497	1.11226
6	0.428298	1.41237	4.2285	0.752999	0.0136512	0.171077	1.09941
7	0.435823	1.39751	4.14235	0.746779	0.0138925	0.172063	1.09941
8	0.349271	1.33273	3.65063	0.723234	0.0136091	0.173972	1.08681
9	0.326277	1.28418	3.7183	0.705908	0.0155201	0.180493	1.30468
10	0.0796967	0.780017	3.57613	0.530875	0.0136512	0.201432	1.48866
11	0.0340417	0.202774	2.26313	0.11817	0.0117171	0.222391	1.88793
12	0.0294333	0.152121	1.33915	0.0337628	0.01015	0.24564	2.58575
13	0.0315395	0.142016	0.987137	0.0142159	0.0106914	0.255381	3.1941
14	0.0343766	0.13777	0.938512	0.00666371	0.011256	0.258268	4.04971
15	0.0340417	0.137397	0.840638	0.00488672	0.0106914	0.263218	5.5816
16	0.0348149	0.140839	0.782278	0.00533096	0.0106914	0.259602	6.93858
17	0.0363365	0.144974	0.782278	0.00932919	0.0106914	0.236563	4.6231
18	0.0359276	0.131996	0.724227	0.00222124	0.0105002	0.217298	2.82238
19	0.0318655	0.125384	0.65232	0.000888494	0.0105002	0.197304	1.85751
20	0.0314936	0.121836	0.646996	0.000888494	0.0104824	0.17512	1.42235
21	0.0314165	0.119644	0.654703	0.000888494	0.0104824	0.148741	0.884924
22	0.0302843	0.117419	0.638999	0.000444247	0.0108782	0.125406	0.604192
23	0.0302843	0.116611	0.638999	0.000444247	0.0108782	0.109675	0.473373
24	0.0305336	0.116526	0.633412	0.000888494	0.0108782	0.103836	0.442959
25	0.0296041	0.114154	0.633412	0.00133274	0.0108782	0.102354	0.442959
26	0.0286158	0.111624	0.633412	0.00177699	0.0104824	0.100049	0.423794
27	0.0181951	0.0915233	0.514811	0.000444247	0.0104824	0.0976709	0.415177
28	0.014974	0.0816398	0.420785	0	0.0105002	0.0967254	0.415177
29	0.0137725	0.0743544	0.354476	0	0.0105002	0.0960087	0.415177
30	0.0107813	0.0700373	0.259784	0	0.0108009	0.0954409	0.426911
31	0.0102923	0.0657552	0.212868	0	0.0107284	0.095953	0.424777
32	0.0102923	0.0638933	0.197587	0	0.0106379	0.0966166	0.424777
33	0.0102923	0.0616476	0.180411	0	0.0112671	0.0980933	0.454888
34	0.0106982	0.0601268	0.174968	0	0.0115654	0.100256	0.471804
35	0.0106982	0.0589168	0.167558	0	0.010894	0.101457	0.447199
36	0.0106982	0.0580087	0.161465	0	0.0106379	0.102737	0.449916
37	0.0102923	0.0574541	0.151812	0	0.0104824	0.104828	0.452633
38	0.0106982	0.0566098	0.150577	0	0.0106914	0.108639	0.477714
39	0.0106982	0.0564009	0.148851	0	0.0104824	0.111673	0.481689
40	0.0126214	0.0558687	0.172055	0	0.0113958	0.117722	0.549186
41	0.0125703	0.0556476	0.170463	0	0.0116149	0.124238	0.585985
42	0.0129386	0.0556222	0.172055	0	0.0114243	0.13513	0.619671
43	0.0130557	0.0553263	0.172055	0	0.0108177	0.144313	0.614967
44	0.0130319	0.0552016	0.172055	0	0.010868	0.158548	0.679373
45	0.0130319	0.055208	0.170359	0	0.0132634	0.174654	0.866881
46	0.0130319	0.0553121	0.169207	0	0.0124151	0.19898	0.879849
47	0.0130737	0.0556451	0.169207	0	0.0129903	0.22374	0.997236
48	0.0130557	0.0557677	0.170359	0	0.0133395	0.255888	1.07991
49	0.0130557	0.0559811	0.170359	0	0.0280471	0.307716	2.03052
50	0.0130737	0.0562052	0.169207	0	0.0485462	0.362053	2.49231
51	0.0130319	0.0566324	0.164634	0	0.0754323	0.400519	2.61992
52	0.0137068	0.0571766	0.169207	0	0.103031	0.411114	2.27507
53	0.0139651	0.0578181	0.171165	0	0.0992326	0.413089	1.7636
54	0.0139651	0.0584196	0.171823	0	0.109965	0.401827	1.71242
55	0.0140862	0.0589426	0.171823	0	0.103385	0.39705	1.48379
56	0.0144216	0.0598277	0.170625	0	0.105887	0.394875	1.44273
57	0.0144216	0.0597467	0.170359	0	0.103031	0.388855	1.37525
58	0.0143869	0.0594388	0.168304	0	0.109589	0.379895	1.36096
59	0.0144216	0.0593836	0.169207	0	0.105887	0.373245	1.29577
60	0.0143869	0.0594177	0.170359	0	0.109589	0.368346	1.29219
61	0.0143869	0.059466	0.170625	0	0.105285	0.365077	1.21993
62	0.0143869	0.0596956	0.171165	0	0.105428	0.361324	1.22945
63	0.014255	0.0598065	0.171165	0	0.105285	0.358582	1.21993
64	0.0143869	0.0600049	0.171165	0	0.105285	0.355435	1.21993
65	0.0141951	0.0605192	0.171165	0	0.105285	0.354696	1.1655
66	0.0143869	0.061016	0.175308	0	0.101873	0.353788	1.17407
67	0.0154155	0.0614475	0.192227	0	0.101873	0.350334	1.1844
68	0.0154522	0.0620999	0.19318	0	0.105285	0.343694	1.28785
69	0.0154522	0.062683	0.19318	0	0.0836687	0.337808	1.1655
70	0.0154155	0.0635969	0.192227	0	0.0836687	0.333064	1.22945
71	0.0148888	0.064158	0.18979	0	0.0836687	0.327315	1.28266
72	0.0154155	0.065502	0.19824	0	0.0687752	0.320534	1.13905
73	0.0154155	0.0663313	0.197346	0	0.0687752	0.315092	1.1844
74	0.0148888	0.0675908	0.19318	0	0.0687752	0.311673	1.22945
75	0.0187778	0.0697192	0.236737	0	0.0689436	0.310886	1.27064
76	0.0182117	0.0698484	0.229951	0	0.06477	0.311405	1.27064
77	0.0191148	0.0700053	0.239103	0	0.06477	0.311588	1.37525
78	0.0182117	0.0703026	0.224452	0	0.06477	0.31567	1.30156
79	0.0190691	0.0705578	0.239103	0	0.06477	0.318489	1.40797
80	0.0191148	0.0712903	0.239103	0	0.0611864	0.323621	1.42832
81	0.0183068	0.0710485	0.236737	0	0.0511556	0.337286	1.27064
82	0.0182117	0.0706921	0.242981	0	0.0515785	0.351397	1.39682
83	0.0182117	0.0709109	0.244161	0	0.0504779	0.373211	1.8369
84	0.0182002	0.070982	0.241521	0	0.0515785	0.391067	2.29016
85	0.0168815	0.0710233	0.236737	0	0.052774	0.390129	3.37278
86	0.0182002	0.0714824	0.256475	0	0.0426572	0.344995	2.71262
87	0.0183068	0.0714301	0.268501	0	0.0307826	0.31456	2.07081
88	0.0183068	0.0722812	0.268501	0	0.0162949	0.268889	1.19348
89	0.0186954	0.0729335	0.279585	0	0.014362	0.233357	1.04378
90	0.0183068	0.0741085	0.279585	0	0.0123219	0.203853	0.855628
91	0.0181017	0.0752972	0.290316	0	0.01245	0.179621	0.796366
92	0.0187373	0.0767169	0.3196	0	0.0123219	0.162696	0.758808
93	0.0181017	0.0788242	0.325227	0	0.0115056	0.152716	0.677788
94	0.0181017	0.0830971	0.346642	0.000888494	0.011562	0.142047	0.677788
95	0.0186216	0.0886646	0.397193	0.000444247	0.0115514	0.135151	0.658577
96	0.0224795	0.0972863	0.53577	0.00222124	0.0105786	0.130199	0.600928
97	0.0293184	0.113241	0.625522	0.00399822	0.0105786	0.12584	0.588608
98	0.0293184	0.115789	0.626919	0.00399822	0.0107273	0.121329	0.588608
99	0.0311401	0.120429	0.659067	0.00399822	0.0106145	0.119693	0.586887
100	0.0327325	0.132551	0.734694	0.0111062	0.0106145	0.118089	0.588608
101	0.0321234	0.134302	0.73732	0.0119947	0.0105786	0.116906	0.584042
102	0.0315502	0.138751	0.759813	0.0164371	0.0105441	0.116482	0.584042
103	0.032526	0.137906	0.827767	0.0168814

i3S

Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal

If you use B+, please cite us:

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3

IBMC INEB IPATIMUP UPORTO