--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Sep 21 14:10:13 WEST 2018 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta= input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -6475.69 -6487.65 2 -6475.52 -6485.75 -------------------------------------- TOTAL -6475.60 -6487.10 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.895561 0.011177 1.687290 2.097161 1.889524 1399.04 1450.02 1.000 r(A<->C){all} 0.123878 0.000280 0.090650 0.155348 0.123934 1049.95 1144.95 1.000 r(A<->G){all} 0.241281 0.000403 0.203135 0.279797 0.240999 817.56 966.76 1.000 r(A<->T){all} 0.105300 0.000130 0.083087 0.126610 0.105085 1026.39 1072.85 1.000 r(C<->G){all} 0.185298 0.000431 0.143531 0.224369 0.184139 885.37 995.98 1.000 r(C<->T){all} 0.276378 0.000440 0.234768 0.318148 0.275964 718.77 846.08 1.000 r(G<->T){all} 0.067864 0.000130 0.044595 0.089015 0.067514 1262.92 1279.44 1.001 pi(A){all} 0.281423 0.000082 0.263652 0.299474 0.281310 1122.98 1211.01 1.000 pi(C){all} 0.183967 0.000056 0.169401 0.198339 0.183936 1132.09 1155.39 1.000 pi(G){all} 0.213079 0.000069 0.196235 0.228322 0.213049 1180.11 1215.77 1.000 pi(T){all} 0.321531 0.000090 0.303883 0.341016 0.321658 1176.53 1201.33 1.001 alpha{1,2} 1.112746 0.029766 0.772737 1.436359 1.094304 1182.84 1251.66 1.000 alpha{3} 4.050826 0.968518 2.419477 6.018914 3.923917 1462.73 1481.86 1.001 pinvar{all} 0.013031 0.000136 0.000004 0.035546 0.010053 1364.64 1432.82 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -5077.827806 Model 2: PositiveSelection -5074.584286 Model 0: one-ratio -5131.255487 Model 3: discrete -5073.671489 Model 7: beta -5083.471075 Model 8: beta&w>1 -5074.182487 Model 0 vs 1 106.85536200000024 Model 2 vs 1 6.487039999999979 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: Rmultiflora_sc0006888_F_box1) Pr(w>1) post mean +- SE for w 48 S 0.574 2.356 74 C 0.770 2.821 84 L 0.522 2.232 145 F 0.854 3.018 172 N 0.627 2.483 173 R 0.795 2.880 206 N 0.721 2.705 250 A 0.589 2.390 254 T 0.715 2.691 300 Q 0.550 2.297 339 F 0.675 2.596 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: Rmultiflora_sc0006888_F_box1) Pr(w>1) post mean +- SE for w 74 C 0.727 3.340 +- 2.241 84 L 0.516 2.625 +- 2.175 145 F 0.849 3.918 +- 2.323 172 N 0.584 2.785 +- 2.146 173 R 0.784 3.677 +- 2.343 206 N 0.723 3.474 +- 2.388 250 A 0.553 2.693 +- 2.123 254 T 0.715 3.423 +- 2.376 300 Q 0.540 2.712 +- 2.228 339 F 0.621 2.912 +- 2.155 Model 8 vs 7 18.57717600000069 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: Rmultiflora_sc0006888_F_box1) Pr(w>1) post mean +- SE for w 44 S 0.562 1.674 48 S 0.893 2.257 57 W 0.521 1.598 58 R 0.759 2.025 68 F 0.647 1.827 74 C 0.944 2.344 84 L 0.804 2.102 103 A 0.647 1.827 120 S 0.571 1.693 143 R 0.504 1.563 145 F 0.961* 2.372 147 F 0.769 2.042 148 R 0.632 1.798 149 C 0.624 1.786 172 N 0.903 2.276 173 R 0.922 2.306 202 M 0.779 2.059 206 N 0.896 2.261 219 L 0.542 1.640 223 I 0.604 1.754 249 P 0.645 1.817 250 A 0.855 2.191 254 T 0.916 2.297 270 C 0.519 1.595 296 I 0.524 1.607 300 Q 0.844 2.171 316 R 0.631 1.790 317 I 0.818 2.129 337 A 0.563 1.678 339 F 0.908 2.282 342 N 0.589 1.719 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: Rmultiflora_sc0006888_F_box1) Pr(w>1) post mean +- SE for w 48 S 0.766 2.507 +- 1.426 58 R 0.647 2.249 +- 1.535 68 F 0.534 1.934 +- 1.450 74 C 0.901 3.017 +- 1.567 84 L 0.725 2.516 +- 1.630 145 F 0.943 3.171 +- 1.576 147 F 0.662 2.306 +- 1.568 148 R 0.530 1.934 +- 1.472 149 C 0.536 1.976 +- 1.513 172 N 0.823 2.764 +- 1.576 173 R 0.897 3.051 +- 1.617 202 M 0.698 2.447 +- 1.636 206 N 0.861 2.949 +- 1.650 249 P 0.541 1.950 +- 1.453 250 A 0.775 2.636 +- 1.592 254 T 0.876 2.979 +- 1.627 300 Q 0.759 2.606 +- 1.634 316 R 0.555 2.045 +- 1.580 317 I 0.687 2.328 +- 1.491 339 F 0.835 2.802 +- 1.569
>C1 MVVQILSRMPPKSLMRFKCIHKSWNSMINSRHVVAKHLQFHSNLSSSTSI LLRRPVIWRTETKNEEIVFSLLTLCNENNGDEDNLDYDIEDIHFPPSIGL KTRAQFIENPGPTYECADIVGHCGGIICLSLYAAGDLVLYNPAIREFKVI PEPCLPRPRQFYFRCDAFGYDPISEDYILVNVASYGENRYDDDRLVIEPL RAEMYTLGTDSWREIKIHNLETETTMFRPNHFQVYFKGNCYGLAEEIKKE FISSFDSLEEYYIREVIVWFNTSDRVFHSALTPDCLYRYPAHDFTLTVWN NCVALFGYNRCGSKPFEIWVMGDSDGFTCSWIKHISVNITESPQPLVLWE SNQSLLVSPRIRVALYSFATKTFRYLPLCAAEHFDAIPLVNSIVPLNRDP VCVDISoooooooooooooooooooooooooooooooooooooooooooo o >C2 MANYSKLYASEDFVEQILLELPPKPLMRFKCVCNLWCNLIKSPSFVDKHI SSSMRGSSMPILIKRPVPTDKDNNIKDEKKVGNDDDDVETLLTSLNICNE DDDDYPLSTVVEDLNVPLPAPLKLKHSSDLTIAGHCDGIICLKLFTGNVI LCNPAIKEFKLLPKSFLLLCNDNFDDPWSLSYELRYYNEYLGFGYDPKGK DYKVVRFVIYNESCCWFKAEVYTTDSNSWREIKSEYDGKIFIVNWSSDMP LYFNGICYWHVSCAHLESVLSFDMDKELFHEILIPDLPNGCRVVMLTMWK ELIAFFTYQEEIGVPQSYDMWVMMDDLSDGKGSWTKHLTIGPVEGVKFPL IFWKNDQLLMVSNNGSIVLYNLGIQRLNYLPIHSMRDLYYSQALVYVNSI VSISGGNVLEDIYISAFYGNGKFHSINGRDIVDISAFYGNSEEQVSGSPL R >C3 MAVEILSRLPPKSLMRFKCIRKSWNSLINNAHFVAKHLHVHNNVSSSTNI FLKRRVIRATEYRDEEIVCTLLTLRNENNCAEDNIYYDIEDIQFPPSIGL KSRGQFIEIPGHCSYDCAYIVGHCDGTFCLTLYTASDLVLYNPAIKEVKL IPESCLRDKFIGAVGFGYDPKSEDYILVSVTRYGEEAYDDRVVINPLRAE MYTLGTDSWREIKIHNLETETTFFWPAHFQVYFKGNCYWLAYENQKEFIS YLDRLEEQYIRDVIVSFDTGNQVFHTILVPDCLYEYPTHEFYLTVWNESV GLFGFYRGGNKPFEIWVMDDSDGVNSTWIKHLSIDVVEPAIPLALWEKNE ILLVSTWTQVSLYNFVTEKYMYLPLYGALYFEAFPYEPSIVPLKRooooo oooooooooooooooooooooooooooooooooooooooooooooooooo o >C4 MVELCKMSEEIVVQMLSRTPPKSLVRFKCIHKSWYSMINDPQFAAKHLHF YNNPSSSTAFLVKRPVILRSETSNENVVLSYLRLENYSNGDDEDLHFVVE DLIFPPFKGLKTRGQFIELPGRDDSVYIISHCDGIIFLSLYAGDLLLYNP AIKEFKIIPASCCQDCFWSLVGFGYDPRSKDYIILEIACYGETNCDHPQR LIVDPPKAAVYTLGIDSWREIQTDYLQTEDTYFWPTAFDLYSKGILYWFG YEEKKEFLDDMERCEETNKQVMILYDTVDELFHIAMLPDSFNEPACGIHD IHLTLLDNSIALYGFSIFESIHSIQIWVTDDIKEESWTNYLSLEPIDAVR RSLAFWKINKVLMIAKDGRVVLYNLVTGKLKHFPIHGLHLGDDIQGIVCM DSIVSVMRKQoooooooooooooooooooooooooooooooooooooooo o >C5 MTEFSKFPEEMALQILSRMPPKSLMRFKCVRKSWYTLINSPSFVSKHLFN SLHNKQSTCIFCKRYVFRDIATKDVESVISLITFSNDDVGDNDHEHISHS VIQDIDLPLSMSGVPKNHVNEPELLGAVYITGHCDGIICLVHGEIVLWNP AIKQFKVLPKPLLTNGIVNSIGFGYDPRSKDYQVFSFPTHDEDRTSERDF NYPPQVEVYSLSTDSWTEINADHLETETTNLYPEYFQMCFKGIWYWTGSE QQKEFMVVYDSMDEEWVRQLIIVFDMNDQVFEDILFPYSLYHPMIPYLEM RVIVWNESVALFGQYRFGYADDAFGLWVMDDIVKGSWTKQLTLEVIVGTR MILEMWKSDEILMVANDNRIFSYNFRTEKIKFLPIESTHPTFSAAIVCIN SIVPVIHGRQQAoooooooooooooooooooooooooooooooooooooo o CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=99, Nseq=5, Len=503 C1 ------------MVVQILSRMPPKSLMRFKCIHKSWNSMINSRHVVAKHL C2 MANYSKLYASEDFVEQILLELPPKPLMRFKCVCNLWCNLIKSPSFVDKHI C3 ------------MAVEILSRLPPKSLMRFKCIRKSWNSLINNAHFVAKHL C4 MVELCKM--SEEIVVQMLSRTPPKSLVRFKCIHKSWYSMINDPQFAAKHL C5 MTEFSKF--PEEMALQILSRMPPKSLMRFKCVRKSWYTLINSPSFVSKHL :. ::* . ***.*:****: : * .:*:. .. **: C1 QFHSNLSSSTSILLRRPVIWRTET---------KNEEIVFSLLTLCNENN C2 SSSMR-GSSMPILIKRPVPTDKDNNIKDEKKVGNDDDDVETLLTSLNICN C3 HVHNNVSSSTNIFLKRRVIRATEY---------RDEEIVCTLLTLRNENN C4 HFYNNPSSSTAFLVKRPVILRSET---------SNENVVLSYLRLENYSN C5 FNSLHNKQSTCIFCKRYVFRDIAT---------KDVESVISLITFSNDDV . .* :: :* * : : * : : * C1 GDEDNLDY---DIEDIHFPPSIGLKTRAQFIENPGP-TYECADIVGHCGG C2 EDDDDYPLST-VVEDLNVPLPAPLKLKH----------SSDLTIAGHCDG C3 CAEDNIYY---DIEDIQFPPSIGLKSRGQFIEIPGHCSYDCAYIVGHCDG C4 GDDEDLHF---VVEDLIFPPFKGLKTRGQFIELPGR--DDSVYIISHCDG C5 GDNDHEHISHSVIQDIDLPLSMSGVPKNH-VNEPEL--LGAVYITGHCDG ::. ::*: .* : * .**.* C1 IICLSLYAAGDLVLYNPAIREFKVIPEPCLPRPRQFY---FRC------- C2 IICLKLF-TGNVILCNPAIKEFKLLPKSFLLLCNDNFDDPWSLSYELRYY C3 TFCLTLYTASDLVLYNPAIKEVKLIPESCL---RDKF---IGA------- C4 IIFLSLY-AGDLLLYNPAIKEFKIIPASCC---QDCF---WSL------- C5 IICLV---HGEIVLWNPAIKQFKVLPKPLL---TNGI---VNS------- : * .:::* ****::.*::* . : C1 ---DAFGYDPISEDYILVNVASYGENRYDD-DRLVIEPLRAEMYTLGTDS C2 NEYLGFGYDPKGKDYKVVRFVIYNESCCW---------FKAEVYTTDSNS C3 ---VGFGYDPKSEDYILVSVTRYGEEAYD--DRVVINPLRAEMYTLGTDS C4 ---VGFGYDPRSKDYIILEIACYGETNCDHPQRLIVDPPKAAVYTLGIDS C5 ---IGFGYDPRSKDYQVFSFPTHDEDRTS--ERDFNYPPQVEVYSLSTDS .***** .:** :. . :.* :. :*: . :* C1 WREIKIHNLETETTMFRPNHFQVYFKGNCYGLAEEIKKEFISSFDSLEEY C2 WREIKSEYDGKIFIVNWSSDMPLYFNGICYWHVSCAHLE----------- C3 WREIKIHNLETETTFFWPAHFQVYFKGNCYWLAYENQKEFISYLDRLEEQ C4 WREIQTDYLQTEDTYFWPTAFDLYSKGILYWFGYEEKKEFLDDMERCEET C5 WTEINADHLETETTNLYPEYFQMCFKGIWYWTGSEQQKEFMVVYDSMDEE * **: . . . : : :* * : * C1 YIREVIVWFNTSDRVFHSALTPDCLYR--YPAHDFTLTVWNNCVALFGYN C2 ----SVLSFDMDKELFHEILIPDLPN----GCRVVMLTMWKELIAFFTYQ C3 YIRDVIVSFDTGNQVFHTILVPDCLYE--YPTHEFYLTVWNESVGLFGFY C4 N-KQVMILYDTVDELFHIAMLPDSFNEPACGIHDIHLTLLDNSIALYGFS C5 WVRQLIIVFDMNDQVFEDILFPYSLYHPMIPYLEMRVIVWNESVALFGQY :: :: ..:*. : * . : : .: :.:: C1 RCG--SKPFEIWV-MGDSDGFTCSWIKHISVNITESPQ-PLVLWESNQSL C2 EEIGVPQSYDMWVMMDDLSDGKGSWTKHLTIGPVEGVKFPLIFWKNDQLL C3 RGG--NKPFEIWV-MDDSDGVNSTWIKHLSIDVVE-PAIPLALWEKNEIL C4 IFE-SIHSIQIWV-TDDIK--EESWTNYLSLEPIDAVRRSLAFWKINKVL C5 RFGYADDAFGLWV-MDDIV--KGSWTKQLTLEVIVGTRMILEMWKSDEIL .. :** .* :* : ::: * :*: :: * C1 LVSPRIRVALYSFATKTFRYLPLCA---AEHFDAIPLVNSIVPLNRDPVC C2 MVSNNGSIVLYNLGIQRLNYLPIHSMRDLYYSQALVYVNSIVSISGGNVL C3 LVSTWTQVSLYNFVTEKYMYLPLYG---ALYFEAFPYEPSIVPLKRoooo C4 MIAKDGRVVLYNLVTGKLKHFPIHG---LHLG----------DDIQGIVC C5 MVANDNRIFSYNFRTEKIKFLPIES---TH-P----------TFSAAIVC ::: : *.: .:*: . C1 VDISooooooooooooooooooooooooooooooooooooooooooooo- C2 EDIYISAFYGNGKFHSINGRDIVDISAFYGNSEEQVSGSPLR-------- C3 oooooooooooooooooooooooooooooooooooooooooooooooooo C4 MDSIVSVMRKQooooooooooooooooooooooooooooooooooooooo C5 INSIVPVIHGRQQAoooooooooooooooooooooooooooooooooooo C1 --- C2 --- C3 oo- C4 oo- C5 ooo PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 451 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 451 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [21334] Library Relaxation: Multi_proc [72] Relaxation Summary: [21334]--->[13569] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.337 Mb, Max= 30.975 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MVVQILSRMPPKSLMRFKCIHKSWNSMINSRHVVAKHLQFHSNSSSTSIL C2 FVEQILLELPPKPLMRFKCVCNLWCNLIKSPSFVDKHISSSMRGSSMPIL C3 MAVEILSRLPPKSLMRFKCIRKSWNSLINNAHFVAKHLHVHNNSSSTNIF C4 IVVQMLSRTPPKSLVRFKCIHKSWYSMINDPQFAAKHLHFYNNSSSTAFL C5 MALQILSRMPPKSLMRFKCVRKSWYTLINSPSFVSKHLFNSLHKQSTCIF :. ::* . ***.*:****: : * .:*:. .. **: . .* :: C1 LRRPVIWRTETKNEEIVFSLLTLCNENNGDEDNLDYDIEDIHFPPSIGLK C2 IKRPVPTDKDNNDDDDVETLLTSLNICNEDDDDYPLVVEDLNVPLPAPLK C3 LKRRVIRATEYRDEEIVCTLLTLRNENNCAEDNIYYDIEDIQFPPSIGLK C4 VKRPVILRSETSNENVVLSYLRLENYSNGDDEDLHFVVEDLIFPPFKGLK C5 CKRYVFRDIATKDVESVISLITFSNDDVGDNDHEHIVIQDIDLPLSMSGV :* * : : * : : * ::. ::*: .* C1 TRAYECADIVGHCGGIICLSAGDLVLYNPAIREFKVIPEPCLRQFYFRCD C2 LKHSSDLTIAGHCDGIICLKTGNVILCNPAIKEFKLLPKSFLNDNFWSLL C3 SRGYDCAYIVGHCDGTFCLTASDLVLYNPAIKEVKLIPESCLRDKFIGAV C4 TRGDDSVYIISHCDGIIFLSAGDLLLYNPAIKEFKIIPASCCQDCFWSLV C5 PKNLGAVYITGHCDGIICLVHGEIVLWNPAIKQFKVLPKPLLTNGIVNSI : * .**.* : * .:::* ****::.*::* . : C1 AFGYDPISEDYILVNVASYGENRYDLRAEMYTLGTDSWREIKIHNLETET C2 GFGYDPKGKDYKVVRFVIYNESCCWFKAEVYTTDSNSWREIKSEYDGKIF C3 GFGYDPKSEDYILVSVTRYGEEAYDLRAEMYTLGTDSWREIKIHNLETET C4 GFGYDPRSKDYIILEIACYGETNCDPKAAVYTLGIDSWREIQTDYLQTED C5 GFGYDPRSKDYQVFSFPTHDEDRTSPQVEVYSLSTDSWTEINADHLETET .***** .:** :. . :.* :. :*: . :** **: . . C1 TMFRPNHFQVYFKGNCYGLAEEIKKEVIVWFNTSDRVFHSALTPDCLYPA C2 IVNWSSDMPLYFNGICYWHVSCAHLESVLSFDMDKELFHEILIPDLPNGC C3 TFFWPAHFQVYFKGNCYWLAYENQKEVIVSFDTGNQVFHTILVPDCLYPT C4 TYFWPTAFDLYSKGILYWFGYEEKKEVMILYDTVDELFHIAMLPDSFNGI C5 TNLYPEYFQMCFKGIWYWTGSEQQKELIIVFDMNDQVFEDILFPYSLYPY . : : :* * : * :: :: ..:*. : * C1 HDFTLTVWNNCVALFGYNRCGSKPFEIWVMGDSDTCSWIKHISVNITEPQ C2 RVVMLTMWKELIAFFTYQEEIPQSYDMWVMDDLSKGSWTKHLTIGPVEVK C3 HEFYLTVWNESVGLFGFYRGGNKPFEIWVMDDSDNSTWIKHLSIDVVEPA C4 HDIHLTLLDNSIALYGFSIFEIHSIQIWVTDDIKEESWTNYLSLEPIDVR C5 LEMRVIVWNESVALFGQYRFGDDAFGLWVMDDIVKGSWTKQLTLEVIVTR . : : .: :.:: .. :** .* :* : ::: C1 PLVLWESNQSLLVSPRIRVALYSFATKTFRYLPLCAAEFPLNRDPVCVDI C2 PLIFWKNDQLLMVSNNGSIVLYNLGIQRLNYLPIHSLYSSISGGNVLEDI C3 PLALWEKNEILLVSTWTQVSLYNFVTEKYMYLPLYGALFPLKRooooooo C4 SLAFWKINKVLMIAKDGRVVLYNLVTGKLKHFPIHGLHGDDIQGIVCMDS C5 ILEMWKSDEILMVANDNRIFSYNFRTEKIKFLPIESTHPTFSAAIVCINS * :*: :: *::: : *.: .:*: . C1 Soooooooooooooooooooooooooooooooooooooo C2 YISAFYGNGKFHSINGRDIVDISAFYGNSEEQVSGSPLR C3 ooooooooooooooooooooooooooooooooooooooo C4 IVSVMRKQooooooooooooooooooooooooooooooo C5 IVPVIHGRQQAoooooooooooooooooooooooooooo FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:74 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 31.37 C1 C2 31.37 TOP 1 0 31.37 C2 C1 31.37 BOT 0 2 69.28 C1 C3 69.28 TOP 2 0 69.28 C3 C1 69.28 BOT 0 3 49.65 C1 C4 49.65 TOP 3 0 49.65 C4 C1 49.65 BOT 0 4 44.06 C1 C5 44.06 TOP 4 0 44.06 C5 C1 44.06 BOT 1 2 33.58 C2 C3 33.58 TOP 2 1 33.58 C3 C2 33.58 BOT 1 3 35.80 C2 C4 35.80 TOP 3 1 35.80 C4 C2 35.80 BOT 1 4 34.32 C2 C5 34.32 TOP 4 1 34.32 C5 C2 34.32 BOT 2 3 49.20 C3 C4 49.20 TOP 3 2 49.20 C4 C3 49.20 BOT 2 4 46.06 C3 C5 46.06 TOP 4 2 46.06 C5 C3 46.06 BOT 3 4 43.37 C4 C5 43.37 TOP 4 3 43.37 C5 C4 43.37 AVG 0 C1 * 48.59 AVG 1 C2 * 33.77 AVG 2 C3 * 49.53 AVG 3 C4 * 44.51 AVG 4 C5 * 41.95 TOT TOT * 43.67 CLUSTAL W (1.83) multiple sequence alignment C1 ------------------------------------ATGGTGGTACAAAT C2 ATGGCAAACTATAGCAAACTGTATGCGTCTGAGGACTTTGTGGAGCAAAT C3 ------------------------------------ATGGCGGTAGAAAT C4 ATGGTAGAGTTGTGCAAGATG------TCAGAAGAGATAGTGGTGCAAAT C5 ATGACAGAGTTTTCTAAATTT------CCTGAAGAGATGGCCTTGCAAAT :* * :. **** C1 CTTATCCAGAATGCCTCCGAAATCTCTAATGCGATTCAAGTGCATTCATA C2 TCTATTAGAACTGCCTCCCAAACCTTTGATGCGATTTAAGTGTGTATGTA C3 CTTATCCAGACTGCCTCCGAAATCTCTAATGCGATTCAAGTGCATTCGTA C4 GTTATCAAGGACGCCTCCTAAATCTCTAGTGCGATTCAAGTGTATCCACA C5 CTTATCAAGGATGCCACCTAAATCTCTGATGCGATTCAAGTGTGTCCGTA *** ..... ***:** *** ** *..******* ***** .* . * C1 AGTCATGGAACTCTATGATCAATAGTCGCCATGTCGTAGCTAAGCATCTC C2 ATCTGTGGTGCAATTTAATCAAAAGCCCTAGTTTCGTAGATAAACACATT C3 AGTCATGGAATTCTCTGATCAATAATGCCCATTTTGTGGCCAAGCATCTC C4 AGTCATGGTATTCTATGATCAATGATCCACAATTTGCAGCCAAACATCTT C5 AGTCATGGTATACGTTGATCAACAGTCCCAGCTTCGTATCCAAACACCTC * .***:. :. *.***** .. .. * * . . **.** .* C1 CAGTTTCACAGCAACCTATCCTCCTCCACTAGCATCCTTCTAAGGCGTCC C2 TCCAGTTCTATGCGA---GGATCCTCTATGCCCATCCTTATCAAGCGCCC C3 CACGTTCACAACAACGTATCCTCCTCTACTAACATCTTTCTAAAACGTCG C4 CACTTTTATAACAATCCATCTTCGTCCACTGCCTTCCTCGTCAAGCGTCC C5 TTTAATTCCTTGCACAACAAACAGTCCACATGCATCTTTTGCAAGCGTTA * . : .. . ** * *:** * .*..** C1 TGTCATCTGGAGAACCGAAACT---------------------------A C2 AGTTCCCACGGACAAGGACAATAACATTAAGGATGAGAAGAAAGTTGGGA C3 TGTCATCAGGGCAACTGAATAT---------------------------A C4 TGTCATCCTCAGAAGTGAAACG---------------------------A C5 CGTCTTCAGGGATATCGCAACT---------------------------A ** * . * *..:. * C1 AGAATGAGGAAATCGTTTTTTCTTTGCTTACTCTTTGCAACGAGAATAAT C2 ATGATGACGACGATGTCGAAACTCTCTTGACGTCACTTAATATCTGCAAT C3 GGGATGAGGAAATCGTATGTACGTTACTTACTCTTCGCAATGAGAACAAT C4 GCAATGAGAACGTTGTACTCTCATATCTTCGTCTAGAAAATTATAGTAAT C5 AAGATGTGGAATCTGTAATCTCATTGATTACTTTTTCCAATGATGATGTT . .***: .*. ** :* : * . : ** : . .:* C1 GGTGATGAGGATAACCTAGATTAT---------GACATCGAGGACATCCA C2 GAGGATGATGATGATTACCCTCTATCAACT---GTAGTTGAGGATCTTAA C3 TGTGCTGAGGACAACATATATTAT---------GATATCGAGGACATCCA C4 GGTGACGATGAAGATCTTCATTTC---------GTAGTTGAGGACCTCAT C5 GGCGATAATGACCATGAGCATATCTCTCATTCGGTTATCCAAGACATCGA . *. .* ** * : .* : *: .* *.** .* : C1 CTTTCCACCTTCAATTGGTCTAAAAACTAGGGCACAATTTATTGAGAATC C2 CGTTCCGCTTCCGGCTCCTCTGAAGCTAAAACAT---------------- C3 ATTTCCTCCTTCAATTGGTCTAAAAAGTAGGGGACAATTTATTGAGATCC C4 TTTCCCACCTTTTAAGGGTCTAAAAACTAGGGGACAATTTATTGAGCTCC C5 TCTTCCACTTTCTATGAGTGGAGTACCGAAGAACCAT---GTCAATGAGC * ** * * . * ..:.. *.. C1 CTGGTCCA---ACTTATGAATGTGCAGATATTGTGGGTCATTGTGGTGGG C2 --------------TCCTCGGATCTCACAATTGCAGGTCATTGTGATGGA C3 CTGGTCACTGCTCTTATGATTGTGCATATATTGTTGGTCATTGTGATGGG C4 CTGGACGT------GATGATTCTGTGTATATCATTAGTCACTGTGATGGC C5 CTGAGCTT------CTCGGAGCTGTATATATTACAGGGCATTGTGATGGA * .:** . .* ** ****.*** C1 ATAATCTGTCTCTCTCTTTATGCTGCAGGCGACCTTGTCTTATACAATCC C2 ATCATTTGTTTAAAACTTTTC---ACTGGTAACGTTATTTTATGCAACCC C3 ACATTTTGTCTAACTCTTTATACCGCAAGCGACCTTGTTTTATACAATCC C4 ATTATTTTTCTAAGTCTGTAT---GCTGGCGACCTTCTTTTGTACAATCC C5 ATCATTTGTTTAGTC---------CATGGTGAGATTGTGCTATGGAATCC * :* * * *. .:.* .* ** * *.*. ** ** C1 CGCAATTAGGGAATTCAAGGTTATACCCGAGCCATGCCTCCCACGTCCCC C2 AGCTATAAAGGAATTCAAGCTTCTTCCCAAGTCTTTTCTTCTCCTTTGCA C3 AGCAATCAAAGAAGTCAAGCTTATACCAGAGTCATGCCTT---------C C4 AGCAATCAAAGAATTCAAGATTATTCCGGCGTCATGTTGT---------C C5 AGCAATTAAGCAATTCAAGGTTCTTCCCAAGCCACTCCTT---------A .**:** *.. ** ***** **.*:** ..* *: . C1 GTCAGTTTTAT---------TTCCGTTGT--------------------- C2 ATGATAACTTTGATGATCCCTGGTCGCTTTCTTATGAATTAAGATATTAC C3 GAGATAAGTTT---------ATCGGTGCT--------------------- C4 AAGATTGTTTT---------TGGAGCTTG--------------------- C5 CAAATGGGATC---------GTAAATTCT--------------------- : * :: C1 ---------GATGCATTTGGTTATGATCCCATTTCTGAAGATTATATACT C2 AATGAATATTTGGGATTTGGCTATGATCCCAAAGGTAAAGATTACAAGGT C3 ---------GTAGGATTTGGCTATGATCCGAAGTCTGAAGATTACATACT C4 ---------GTGGGATTCGGATATGATCCGAGATCCAAAGATTACATTAT C5 ---------ATAGGATTTGGCTATGATCCCAGATCTAAAGATTACCAAGT : * *** ** ******** * .******* .: * C1 TGTTAACGTTGCAAGTTATGGTGAAAATAGATACGATGAT---GATCGTC C2 TGTTAGATTCGTAATCTATAATGAGTCATGTTGTTGG------------- C3 GGTTAGCGTTACACGTTATGGTGAAGAAGCATACGAT------GATCGTG C4 TCTAGAAATTGCATGTTATGGTGAGACAAATTGTGACCATCCTCAGCGTC C5 TTTTAGTTTTCCGACTCATGATGAGGACCGAACTAGC------GAGCGTG *:.. * . **..***. . :: . C1 TCGTTATTGAACCTCTGAGAGCAGAGATGTACACACTGGGTACTGATTCT C2 --------------TTCAAAGCAGAAGTATACACTACGGATTCTAATTCT C3 TTGTTATTAATCCTCTGAGAGCAGAAATGTACACACTGGGTACTGATTCT C4 TCATTGTTGATCCTCCAAAAGCTGCAGTTTACACACTAGGCATTGATTCT C5 ATTTTAATTATCCTCCACAGGTTGAAGTATACAGCCTCAGTACCGATTCG ...* :*...* **** . .. : .**** C1 TGGAGAGAGATCAAGATTCACAATTTGGAAACCGAAACTACCATGTTTCG C2 TGGAGAGAGATCAAGTCCGAATATGATGGTAAAATCTTTATTGTTAATTG C3 TGGAGGGAGATCAAGATCCACAATTTGGAAACCGAAACTACTTTTTTTTG C4 TGGAGAGAGATCCAGACTGATTACTTACAAACTGAAGATACCTACTTTTG C5 TGGACAGAGATCAACGCCGATCATTTAGAAACTGAAACTACCAACTTGTA **** .******.* * * : .:*. .:. ** : :: . C1 GCCTAATCATTTCCAGGTGTATTTCAAGGGAAACTGCTACGGGTTGGCAG C2 GTCTTCTGATATGCCTTTATACTTCAACGGAATTTGTTATTGGCACGTAA C3 GCCTGCACATTTCCAGGTGTACTTTAAGGGAAATTGTTACTGGTTGGCAT C4 GCCTACGGCATTCGATTTGTACTCGAAGGGAATTTTGTATTGGTTTGGTT C5 TCCTGAATATTTTCAAATGTGCTTTAAGGGAATTTGGTATTGGACCGGAA ** . .::* . *.*. * ** ****: * ** ** * : C1 AAGAAATCAAGAAGGAATTCATCTCATCGTTTGACAGTCTTGAGGAGTAT C2 GTTGTGCACACCTGGAA--------------------------------- C3 ATGAAAACCAGAAGGAATTCATCAGTTACTTGGACAGACTTGAGGAGCAA C4 ATGAGGAAAAGAAGGAGTTCTTGGATGACATGGAAAGATGTGAGGAGACA C5 GTGAGCAACAAAAGGAATTCATGGTTGTTTATGATAGTATGGATGAGGAA .: . ..* .:***. C1 TACATTAGGGAAGTAATCGTTTGGTTTAACACGAGCGATCGGGTTTTCCA C2 ------------TCTGTTCTTTCATTTGATATGGATAAGGAGCTATTTCA C3 TATATTAGGGACGTCATCGTTTCGTTTGACACGGGCAATCAGGTTTTCCA C4 AAC---AAGCAAGTGATGATTTTGTATGATACGGTAGATGAGCTATTTCA C5 TGGGTGAGGCAGCTGATCATTGTGTTTGATATGAATGATCAAGTATTTGA .* ** .*:*.* * *. .* .. *:** * C1 TAGTGCATTGACTCCTGATTGTTTGTATCGA------TATCCAGCGCATG C2 TGAGATATTGATTCCAGATTTGCCAAAC------------GGATGTAGAG C3 TACTATATTGGTTCCGGATTGTTTGTATGAA------TATCCAACGCATG C4 TATTGCAATGCTTCCGGATAGTTTCAACGAGCCTGCTTGCGGCATACATG C5 AGACATACTATTTCCATATAGTTTATACCACCCGATGATTCCTTATTTAG :. . * *. *** **: :* :* C1 ACTTCACTCTTACAGTGTGGAACAATTGCGTTGCTCTTTTTGGCTATAAT C2 TAGTGATGCTTACTATGTGGAAAGAGCTCATTGCTTTTTTCACCTATCAA C3 AATTTTACCTCACAGTATGGAACGAATCAGTTGGTCTTTTTGGCTTTTAT C4 ATATTCATCTTACATTGTTAGATAATTCAATTGCTCTTTATGGTTTTAGC C5 AAATGCGCGTTATTGTGTGGAATGAATCCGTCGCTCTTTTTGGTCAGTAC : * * * : *.* ..* .* ..* * * ***: . : . C1 CGTTGTGGA------AGTAAACCATTTGAAATTTGGGTG---ATGGGTGA C2 GAAGAAATTGGAGTTCCTCAATCTTACGATATGTGGGTGATGATGGATGA C3 CGTGGTGGA------AATAAACCCTTTGAAATTTGGGTG---ATGGATGA C4 ATTTTTGAA---TCGATTCATTCCATTCAAATATGGGTG---ACAGATGA C5 CGTTTTGGTTATGCTGATGATGCTTTTGGATTATGGGTA---ATGGATGA : :. : * *: * :: .::* *****. * .*.*** C1 CTCTGATGGTTTCACTTGTTCATGGATAAAGCACATATCGGTTAACATTA C2 TCTTAGTGATGGTAAGGGTTCATGGACAAAACATTTAACTATAGGACCTG C3 TTCTGATGGTGTTAACTCTACGTGGATAAAACACCTATCCATTGACGTTG C4 CATTAAA------GAGGAATCTTGGACAAATTACTTGTCCTTAGAGCCGA C5 TATTGTC------AAGGGTTCTTGGACAAAACAATTAACCCTAGAGGTCA *. .. ::* **** *** * *.:* *:.. . C1 CGGAATCTCCTCAA---CCATTGGTACTGTGGGAGAGCAACCAGAGTCTT C2 TGGAAGGTGTTAAATTTCCATTGATATTTTGGAAAAATGACCAACTTCTT C3 TGGAA---CCTGCTATACCATTGGCACTCTGGGAGAAAAATGAGATTCTT C4 TAGATGCTGTTCGGAGGTCATTGGCCTTTTGGAAGATCAACAAGGTTCTT C5 TAGTTGGTACTCGAATGATTTTGGAAATGTGGAAGAGCGACGAGATTCTT .*:: * :***. . * ***.*.* .* *. **** C1 TTGGTGTCCCCGCGTATACGAGTAGCCTTGTACAGCTTTGCAACCAAAAC C2 ATGGTTTCTAATAACGGAAGTATCGTCTTATATAACCTTGGCATACAGAG C3 TTGGTCTCCACATGGACACAAGTATCCTTGTACAACTTTGTAACTGAAAA C4 ATGATTGCCAAAGATGGGCGTGTAGTTCTCTACAATCTGGTTACAGGAAA C5 ATGGTGGCTAATGACAACCGTATATTCTCCTACAATTTCAGAACTGAAAA :**.* * .. . . ..:.*. ** *. * . * ..* C1 GTTCAGGTATTTACCACTATGTGCT---------GCTGAACATTTCGATG C2 ATTAAACTATCTTCCTATTCATTCCATGAGAGATCTTTACTATAGTCAAG C3 GTACATGTATTTACCGCTTTATGGT---------GCGCTTTATTTCGAAG C4 GCTCAAGCATTTTCCTATTCATGGC---------CTGCACCTAGGA---- C5 GATTAAATTTCTTCCCATTGAAAGT---------ACGCAT---CCA---- . : * :* *:** .*: .: : C1 CTATACCTCTTGTGAATAGTATAGTTCCACTCAATAGGGACCCAGTTTGT C2 CACTTGTTTATGTAAATAGTATTGTTTCCATCAGCGGAGGCAATGTACTT C3 CATTTCCCTATGAACCTAGTATAGTTCCACTCAAGAGG------------ C4 --------------------------GATGATATTCAAGGCATTGTTTGT C5 --------------------------ACTTTTTCCGCAGCTATTGTATGC . : : . C1 GTTGATATTTCT-------------------------------------- C2 GAAGATATATATATTTCTGCGTTTTATGGCAATGGAAAATTTCATTCCAT C3 -------------------------------------------------- C4 ATGGATAGTATAGTTTCAGTTATGAGAAAACAA----------------- C5 ATAAACAGTATAGTTCCGGTTATTCATGGGAGGCAGCAAGCA-------- C1 -------------------------------------------------- C2 CAACGGACGAGACATAGTAGATATTTCCGCTTTTTATGGCAATAGCGAGG C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C1 -------------------------------------------------- C2 AACAAGTCTCAGGTTCACCCCTTAGG------------------------ C3 -------------------------------------------------- C4 -------------------------------------------------- C5 -------------------------------------------------- C1 --------- C2 --------- C3 --------- C4 --------- C5 --------- >C1 ------------------------------------ATGGTGGTACAAAT CTTATCCAGAATGCCTCCGAAATCTCTAATGCGATTCAAGTGCATTCATA AGTCATGGAACTCTATGATCAATAGTCGCCATGTCGTAGCTAAGCATCTC CAGTTTCACAGCAACCTATCCTCCTCCACTAGCATCCTTCTAAGGCGTCC TGTCATCTGGAGAACCGAAACT---------------------------A AGAATGAGGAAATCGTTTTTTCTTTGCTTACTCTTTGCAACGAGAATAAT GGTGATGAGGATAACCTAGATTAT---------GACATCGAGGACATCCA CTTTCCACCTTCAATTGGTCTAAAAACTAGGGCACAATTTATTGAGAATC CTGGTCCA---ACTTATGAATGTGCAGATATTGTGGGTCATTGTGGTGGG ATAATCTGTCTCTCTCTTTATGCTGCAGGCGACCTTGTCTTATACAATCC CGCAATTAGGGAATTCAAGGTTATACCCGAGCCATGCCTCCCACGTCCCC GTCAGTTTTAT---------TTCCGTTGT--------------------- ---------GATGCATTTGGTTATGATCCCATTTCTGAAGATTATATACT TGTTAACGTTGCAAGTTATGGTGAAAATAGATACGATGAT---GATCGTC TCGTTATTGAACCTCTGAGAGCAGAGATGTACACACTGGGTACTGATTCT TGGAGAGAGATCAAGATTCACAATTTGGAAACCGAAACTACCATGTTTCG GCCTAATCATTTCCAGGTGTATTTCAAGGGAAACTGCTACGGGTTGGCAG AAGAAATCAAGAAGGAATTCATCTCATCGTTTGACAGTCTTGAGGAGTAT TACATTAGGGAAGTAATCGTTTGGTTTAACACGAGCGATCGGGTTTTCCA TAGTGCATTGACTCCTGATTGTTTGTATCGA------TATCCAGCGCATG ACTTCACTCTTACAGTGTGGAACAATTGCGTTGCTCTTTTTGGCTATAAT CGTTGTGGA------AGTAAACCATTTGAAATTTGGGTG---ATGGGTGA CTCTGATGGTTTCACTTGTTCATGGATAAAGCACATATCGGTTAACATTA CGGAATCTCCTCAA---CCATTGGTACTGTGGGAGAGCAACCAGAGTCTT TTGGTGTCCCCGCGTATACGAGTAGCCTTGTACAGCTTTGCAACCAAAAC GTTCAGGTATTTACCACTATGTGCT---------GCTGAACATTTCGATG CTATACCTCTTGTGAATAGTATAGTTCCACTCAATAGGGACCCAGTTTGT GTTGATATTTCT-------------------------------------- -------------------------------------------------- -------------------------------------------------- --------- >C2 ATGGCAAACTATAGCAAACTGTATGCGTCTGAGGACTTTGTGGAGCAAAT TCTATTAGAACTGCCTCCCAAACCTTTGATGCGATTTAAGTGTGTATGTA ATCTGTGGTGCAATTTAATCAAAAGCCCTAGTTTCGTAGATAAACACATT TCCAGTTCTATGCGA---GGATCCTCTATGCCCATCCTTATCAAGCGCCC AGTTCCCACGGACAAGGACAATAACATTAAGGATGAGAAGAAAGTTGGGA ATGATGACGACGATGTCGAAACTCTCTTGACGTCACTTAATATCTGCAAT GAGGATGATGATGATTACCCTCTATCAACT---GTAGTTGAGGATCTTAA CGTTCCGCTTCCGGCTCCTCTGAAGCTAAAACAT---------------- --------------TCCTCGGATCTCACAATTGCAGGTCATTGTGATGGA ATCATTTGTTTAAAACTTTTC---ACTGGTAACGTTATTTTATGCAACCC AGCTATAAAGGAATTCAAGCTTCTTCCCAAGTCTTTTCTTCTCCTTTGCA ATGATAACTTTGATGATCCCTGGTCGCTTTCTTATGAATTAAGATATTAC AATGAATATTTGGGATTTGGCTATGATCCCAAAGGTAAAGATTACAAGGT TGTTAGATTCGTAATCTATAATGAGTCATGTTGTTGG------------- --------------TTCAAAGCAGAAGTATACACTACGGATTCTAATTCT TGGAGAGAGATCAAGTCCGAATATGATGGTAAAATCTTTATTGTTAATTG GTCTTCTGATATGCCTTTATACTTCAACGGAATTTGTTATTGGCACGTAA GTTGTGCACACCTGGAA--------------------------------- ------------TCTGTTCTTTCATTTGATATGGATAAGGAGCTATTTCA TGAGATATTGATTCCAGATTTGCCAAAC------------GGATGTAGAG TAGTGATGCTTACTATGTGGAAAGAGCTCATTGCTTTTTTCACCTATCAA GAAGAAATTGGAGTTCCTCAATCTTACGATATGTGGGTGATGATGGATGA TCTTAGTGATGGTAAGGGTTCATGGACAAAACATTTAACTATAGGACCTG TGGAAGGTGTTAAATTTCCATTGATATTTTGGAAAAATGACCAACTTCTT ATGGTTTCTAATAACGGAAGTATCGTCTTATATAACCTTGGCATACAGAG ATTAAACTATCTTCCTATTCATTCCATGAGAGATCTTTACTATAGTCAAG CACTTGTTTATGTAAATAGTATTGTTTCCATCAGCGGAGGCAATGTACTT GAAGATATATATATTTCTGCGTTTTATGGCAATGGAAAATTTCATTCCAT CAACGGACGAGACATAGTAGATATTTCCGCTTTTTATGGCAATAGCGAGG AACAAGTCTCAGGTTCACCCCTTAGG------------------------ --------- >C3 ------------------------------------ATGGCGGTAGAAAT CTTATCCAGACTGCCTCCGAAATCTCTAATGCGATTCAAGTGCATTCGTA AGTCATGGAATTCTCTGATCAATAATGCCCATTTTGTGGCCAAGCATCTC CACGTTCACAACAACGTATCCTCCTCTACTAACATCTTTCTAAAACGTCG TGTCATCAGGGCAACTGAATAT---------------------------A GGGATGAGGAAATCGTATGTACGTTACTTACTCTTCGCAATGAGAACAAT TGTGCTGAGGACAACATATATTAT---------GATATCGAGGACATCCA ATTTCCTCCTTCAATTGGTCTAAAAAGTAGGGGACAATTTATTGAGATCC CTGGTCACTGCTCTTATGATTGTGCATATATTGTTGGTCATTGTGATGGG ACATTTTGTCTAACTCTTTATACCGCAAGCGACCTTGTTTTATACAATCC AGCAATCAAAGAAGTCAAGCTTATACCAGAGTCATGCCTT---------C GAGATAAGTTT---------ATCGGTGCT--------------------- ---------GTAGGATTTGGCTATGATCCGAAGTCTGAAGATTACATACT GGTTAGCGTTACACGTTATGGTGAAGAAGCATACGAT------GATCGTG TTGTTATTAATCCTCTGAGAGCAGAAATGTACACACTGGGTACTGATTCT TGGAGGGAGATCAAGATCCACAATTTGGAAACCGAAACTACTTTTTTTTG GCCTGCACATTTCCAGGTGTACTTTAAGGGAAATTGTTACTGGTTGGCAT ATGAAAACCAGAAGGAATTCATCAGTTACTTGGACAGACTTGAGGAGCAA TATATTAGGGACGTCATCGTTTCGTTTGACACGGGCAATCAGGTTTTCCA TACTATATTGGTTCCGGATTGTTTGTATGAA------TATCCAACGCATG AATTTTACCTCACAGTATGGAACGAATCAGTTGGTCTTTTTGGCTTTTAT CGTGGTGGA------AATAAACCCTTTGAAATTTGGGTG---ATGGATGA TTCTGATGGTGTTAACTCTACGTGGATAAAACACCTATCCATTGACGTTG TGGAA---CCTGCTATACCATTGGCACTCTGGGAGAAAAATGAGATTCTT TTGGTCTCCACATGGACACAAGTATCCTTGTACAACTTTGTAACTGAAAA GTACATGTATTTACCGCTTTATGGT---------GCGCTTTATTTCGAAG CATTTCCCTATGAACCTAGTATAGTTCCACTCAAGAGG------------ -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- --------- >C4 ATGGTAGAGTTGTGCAAGATG------TCAGAAGAGATAGTGGTGCAAAT GTTATCAAGGACGCCTCCTAAATCTCTAGTGCGATTCAAGTGTATCCACA AGTCATGGTATTCTATGATCAATGATCCACAATTTGCAGCCAAACATCTT CACTTTTATAACAATCCATCTTCGTCCACTGCCTTCCTCGTCAAGCGTCC TGTCATCCTCAGAAGTGAAACG---------------------------A GCAATGAGAACGTTGTACTCTCATATCTTCGTCTAGAAAATTATAGTAAT GGTGACGATGAAGATCTTCATTTC---------GTAGTTGAGGACCTCAT TTTCCCACCTTTTAAGGGTCTAAAAACTAGGGGACAATTTATTGAGCTCC CTGGACGT------GATGATTCTGTGTATATCATTAGTCACTGTGATGGC ATTATTTTTCTAAGTCTGTAT---GCTGGCGACCTTCTTTTGTACAATCC AGCAATCAAAGAATTCAAGATTATTCCGGCGTCATGTTGT---------C AAGATTGTTTT---------TGGAGCTTG--------------------- ---------GTGGGATTCGGATATGATCCGAGATCCAAAGATTACATTAT TCTAGAAATTGCATGTTATGGTGAGACAAATTGTGACCATCCTCAGCGTC TCATTGTTGATCCTCCAAAAGCTGCAGTTTACACACTAGGCATTGATTCT TGGAGAGAGATCCAGACTGATTACTTACAAACTGAAGATACCTACTTTTG GCCTACGGCATTCGATTTGTACTCGAAGGGAATTTTGTATTGGTTTGGTT ATGAGGAAAAGAAGGAGTTCTTGGATGACATGGAAAGATGTGAGGAGACA AAC---AAGCAAGTGATGATTTTGTATGATACGGTAGATGAGCTATTTCA TATTGCAATGCTTCCGGATAGTTTCAACGAGCCTGCTTGCGGCATACATG ATATTCATCTTACATTGTTAGATAATTCAATTGCTCTTTATGGTTTTAGC ATTTTTGAA---TCGATTCATTCCATTCAAATATGGGTG---ACAGATGA CATTAAA------GAGGAATCTTGGACAAATTACTTGTCCTTAGAGCCGA TAGATGCTGTTCGGAGGTCATTGGCCTTTTGGAAGATCAACAAGGTTCTT ATGATTGCCAAAGATGGGCGTGTAGTTCTCTACAATCTGGTTACAGGAAA GCTCAAGCATTTTCCTATTCATGGC---------CTGCACCTAGGA---- --------------------------GATGATATTCAAGGCATTGTTTGT ATGGATAGTATAGTTTCAGTTATGAGAAAACAA----------------- -------------------------------------------------- -------------------------------------------------- --------- >C5 ATGACAGAGTTTTCTAAATTT------CCTGAAGAGATGGCCTTGCAAAT CTTATCAAGGATGCCACCTAAATCTCTGATGCGATTCAAGTGTGTCCGTA AGTCATGGTATACGTTGATCAACAGTCCCAGCTTCGTATCCAAACACCTC TTTAATTCCTTGCACAACAAACAGTCCACATGCATCTTTTGCAAGCGTTA CGTCTTCAGGGATATCGCAACT---------------------------A AAGATGTGGAATCTGTAATCTCATTGATTACTTTTTCCAATGATGATGTT GGCGATAATGACCATGAGCATATCTCTCATTCGGTTATCCAAGACATCGA TCTTCCACTTTCTATGAGTGGAGTACCGAAGAACCAT---GTCAATGAGC CTGAGCTT------CTCGGAGCTGTATATATTACAGGGCATTGTGATGGA ATCATTTGTTTAGTC---------CATGGTGAGATTGTGCTATGGAATCC AGCAATTAAGCAATTCAAGGTTCTTCCCAAGCCACTCCTT---------A CAAATGGGATC---------GTAAATTCT--------------------- ---------ATAGGATTTGGCTATGATCCCAGATCTAAAGATTACCAAGT TTTTAGTTTTCCGACTCATGATGAGGACCGAACTAGC------GAGCGTG ATTTTAATTATCCTCCACAGGTTGAAGTATACAGCCTCAGTACCGATTCG TGGACAGAGATCAACGCCGATCATTTAGAAACTGAAACTACCAACTTGTA TCCTGAATATTTTCAAATGTGCTTTAAGGGAATTTGGTATTGGACCGGAA GTGAGCAACAAAAGGAATTCATGGTTGTTTATGATAGTATGGATGAGGAA TGGGTGAGGCAGCTGATCATTGTGTTTGATATGAATGATCAAGTATTTGA AGACATACTATTTCCATATAGTTTATACCACCCGATGATTCCTTATTTAG AAATGCGCGTTATTGTGTGGAATGAATCCGTCGCTCTTTTTGGTCAGTAC CGTTTTGGTTATGCTGATGATGCTTTTGGATTATGGGTA---ATGGATGA TATTGTC------AAGGGTTCTTGGACAAAACAATTAACCCTAGAGGTCA TAGTTGGTACTCGAATGATTTTGGAAATGTGGAAGAGCGACGAGATTCTT ATGGTGGCTAATGACAACCGTATATTCTCCTACAATTTCAGAACTGAAAA GATTAAATTTCTTCCCATTGAAAGT---------ACGCAT---CCA---- --------------------------ACTTTTTCCGCAGCTATTGTATGC ATAAACAGTATAGTTCCGGTTATTCATGGGAGGCAGCAAGCA-------- -------------------------------------------------- -------------------------------------------------- --------- >C1 ooooooooooooMVVQILSRMPPKSLMRFKCIHKSWNSMINSRHVVAKHL QFHSNLSSSTSILLRRPVIWRTEToooooooooKNEEIVFSLLTLCNENN GDEDNLDYoooDIEDIHFPPSIGLKTRAQFIENPGPoTYECADIVGHCGG IICLSLYAAGDLVLYNPAIREFKVIPEPCLPRPRQFYoooFRCooooooo oooDAFGYDPISEDYILVNVASYGENRYDDoDRLVIEPLRAEMYTLGTDS WREIKIHNLETETTMFRPNHFQVYFKGNCYGLAEEIKKEFISSFDSLEEY YIREVIVWFNTSDRVFHSALTPDCLYRooYPAHDFTLTVWNNCVALFGYN RCGooSKPFEIWVoMGDSDGFTCSWIKHISVNITESPQoPLVLWESNQSL LVSPRIRVALYSFATKTFRYLPLCAoooAEHFDAIPLVNSIVPLNRDPVC VDISoooooooooooooooooooooooooooooooooooooo >C2 MANYSKLYASEDFVEQILLELPPKPLMRFKCVCNLWCNLIKSPSFVDKHI SSSMRoGSSMPILIKRPVPTDKDNNIKDEKKVGNDDDDVETLLTSLNICN EDDDDYPLSToVVEDLNVPLPAPLKLKHooooooooooSSDLTIAGHCDG IICLKLFoTGNVILCNPAIKEFKLLPKSFLLLCNDNFDDPWSLSYELRYY NEYLGFGYDPKGKDYKVVRFVIYNESCCWoooooooooFKAEVYTTDSNS WREIKSEYDGKIFIVNWSSDMPLYFNGICYWHVSCAHLEooooooooooo ooooSVLSFDMDKELFHEILIPDLPNooooGCRVVMLTMWKELIAFFTYQ EEIGVPQSYDMWVMMDDLSDGKGSWTKHLTIGPVEGVKFPLIFWKNDQLL MVSNNGSIVLYNLGIQRLNYLPIHSMRDLYYSQALVYVNSIVSISGGNVL EDIYISAFYGNGKFHSINGRDIVDISAFYGNSEEQVSGSPLR >C3 ooooooooooooMAVEILSRLPPKSLMRFKCIRKSWNSLINNAHFVAKHL HVHNNVSSSTNIFLKRRVIRATEYoooooooooRDEEIVCTLLTLRNENN CAEDNIYYoooDIEDIQFPPSIGLKSRGQFIEIPGHCSYDCAYIVGHCDG TFCLTLYTASDLVLYNPAIKEVKLIPESCLoooRDKFoooIGAooooooo oooVGFGYDPKSEDYILVSVTRYGEEAYDooDRVVINPLRAEMYTLGTDS WREIKIHNLETETTFFWPAHFQVYFKGNCYWLAYENQKEFISYLDRLEEQ YIRDVIVSFDTGNQVFHTILVPDCLYEooYPTHEFYLTVWNESVGLFGFY RGGooNKPFEIWVoMDDSDGVNSTWIKHLSIDVVEoPAIPLALWEKNEIL LVSTWTQVSLYNFVTEKYMYLPLYGoooALYFEAFPYEPSIVPLKRoooo oooooooooooooooooooooooooooooooooooooooooo >C4 MVELCKMooSEEIVVQMLSRTPPKSLVRFKCIHKSWYSMINDPQFAAKHL HFYNNPSSSTAFLVKRPVILRSEToooooooooSNENVVLSYLRLENYSN GDDEDLHFoooVVEDLIFPPFKGLKTRGQFIELPGRooDDSVYIISHCDG IIFLSLYoAGDLLLYNPAIKEFKIIPASCCoooQDCFoooWSLooooooo oooVGFGYDPRSKDYIILEIACYGETNCDHPQRLIVDPPKAAVYTLGIDS WREIQTDYLQTEDTYFWPTAFDLYSKGILYWFGYEEKKEFLDDMERCEET NoKQVMILYDTVDELFHIAMLPDSFNEPACGIHDIHLTLLDNSIALYGFS IFEoSIHSIQIWVoTDDIKooEESWTNYLSLEPIDAVRRSLAFWKINKVL MIAKDGRVVLYNLVTGKLKHFPIHGoooLHLGooooooooooDDIQGIVC MDSIVSVMRKQooooooooooooooooooooooooooooooo >C5 MTEFSKFooPEEMALQILSRMPPKSLMRFKCVRKSWYTLINSPSFVSKHL FNSLHNKQSTCIFCKRYVFRDIAToooooooooKDVESVISLITFSNDDV GDNDHEHISHSVIQDIDLPLSMSGVPKNHoVNEPELooLGAVYITGHCDG IICLVoooHGEIVLWNPAIKQFKVLPKPLLoooTNGIoooVNSooooooo oooIGFGYDPRSKDYQVFSFPTHDEDRTSooERDFNYPPQVEVYSLSTDS WTEINADHLETETTNLYPEYFQMCFKGIWYWTGSEQQKEFMVVYDSMDEE WVRQLIIVFDMNDQVFEDILFPYSLYHPMIPYLEMRVIVWNESVALFGQY RFGYADDAFGLWVoMDDIVooKGSWTKQLTLEVIVGTRMILEMWKSDEIL MVANDNRIFSYNFRTEKIKFLPIESoooTHoPooooooooooTFSAAIVC INSIVPVIHGRQQAoooooooooooooooooooooooooooo MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1509 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1537534577 Setting output file names to "/opt/ADOPS1/multi6888/Muscle/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1495502017 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3445090203 Seed = 512798682 Swapseed = 1537534577 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 238 unique site patterns Division 2 has 197 unique site patterns Division 3 has 248 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -7334.237819 -- -25.624409 Chain 2 -- -7238.137278 -- -25.624409 Chain 3 -- -7026.142039 -- -25.624409 Chain 4 -- -7352.175465 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -7352.175465 -- -25.624409 Chain 2 -- -7319.050522 -- -25.624409 Chain 3 -- -7241.322987 -- -25.624409 Chain 4 -- -7333.971721 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-7334.238] (-7238.137) (-7026.142) (-7352.175) * [-7352.175] (-7319.051) (-7241.323) (-7333.972) 500 -- [-6533.707] (-6558.535) (-6539.142) (-6569.609) * (-6528.557) (-6537.859) [-6515.917] (-6549.131) -- 0:00:00 1000 -- [-6509.664] (-6519.790) (-6495.456) (-6536.538) * (-6510.737) [-6510.836] (-6484.738) (-6513.362) -- 0:16:39 1500 -- (-6483.667) (-6500.047) [-6488.878] (-6506.829) * (-6494.442) (-6505.616) [-6486.220] (-6491.242) -- 0:11:05 2000 -- [-6479.093] (-6497.819) (-6484.277) (-6512.670) * (-6481.109) (-6493.180) [-6484.672] (-6482.643) -- 0:08:19 2500 -- [-6482.384] (-6489.446) (-6474.570) (-6489.600) * (-6475.735) (-6491.316) [-6479.549] (-6479.203) -- 0:13:18 3000 -- (-6475.018) (-6488.852) [-6475.891] (-6487.247) * (-6478.818) (-6485.568) [-6475.756] (-6487.189) -- 0:11:04 3500 -- (-6482.349) (-6494.207) (-6485.974) [-6480.497] * (-6479.837) [-6486.442] (-6481.212) (-6479.450) -- 0:14:14 4000 -- (-6482.522) [-6481.736] (-6477.964) (-6488.661) * (-6481.799) (-6478.996) (-6485.770) [-6478.523] -- 0:12:27 4500 -- (-6482.933) (-6475.631) (-6478.369) [-6485.759] * (-6475.025) (-6480.786) [-6481.454] (-6476.205) -- 0:11:03 5000 -- (-6494.944) (-6483.610) [-6478.605] (-6474.330) * [-6473.134] (-6474.926) (-6478.991) (-6486.170) -- 0:13:16 Average standard deviation of split frequencies: 0.000000 5500 -- [-6480.904] (-6482.405) (-6484.230) (-6481.874) * (-6478.200) (-6476.480) (-6489.737) [-6479.002] -- 0:12:03 6000 -- (-6480.374) [-6479.733] (-6480.985) (-6480.742) * (-6480.042) (-6476.555) (-6481.614) [-6480.516] -- 0:13:48 6500 -- (-6478.833) (-6482.658) [-6480.265] (-6483.776) * (-6486.002) (-6477.612) [-6477.535] (-6477.171) -- 0:12:44 7000 -- (-6477.286) (-6482.479) (-6486.062) [-6483.425] * (-6481.284) [-6481.717] (-6480.478) (-6479.333) -- 0:11:49 7500 -- (-6483.992) (-6480.948) [-6477.291] (-6485.155) * [-6481.641] (-6479.209) (-6487.403) (-6480.421) -- 0:13:14 8000 -- (-6480.850) (-6481.784) (-6474.742) [-6476.477] * [-6475.870] (-6481.550) (-6487.217) (-6488.556) -- 0:12:24 8500 -- (-6479.567) (-6486.617) (-6479.967) [-6480.239] * (-6477.861) (-6480.813) [-6480.426] (-6480.397) -- 0:13:36 9000 -- (-6484.262) [-6483.477] (-6478.921) (-6489.012) * (-6479.671) (-6486.956) [-6477.486] (-6477.919) -- 0:12:50 9500 -- [-6485.005] (-6476.169) (-6480.765) (-6482.130) * (-6477.882) (-6481.256) [-6475.543] (-6479.402) -- 0:12:09 10000 -- (-6481.835) (-6487.486) [-6489.384] (-6481.167) * [-6479.414] (-6483.959) (-6477.023) (-6483.353) -- 0:13:12 Average standard deviation of split frequencies: 0.000000 10500 -- (-6481.892) [-6477.056] (-6480.220) (-6477.081) * (-6490.099) (-6477.405) (-6486.490) [-6481.531] -- 0:12:33 11000 -- (-6483.306) [-6482.458] (-6477.675) (-6479.995) * [-6482.131] (-6478.253) (-6485.380) (-6479.106) -- 0:13:29 11500 -- (-6485.794) [-6474.897] (-6477.671) (-6485.384) * (-6485.279) [-6477.954] (-6475.462) (-6478.124) -- 0:12:53 12000 -- (-6485.581) (-6478.328) [-6472.122] (-6483.220) * [-6480.445] (-6482.187) (-6480.035) (-6482.118) -- 0:12:21 12500 -- [-6480.295] (-6482.291) (-6477.217) (-6483.859) * (-6479.235) (-6480.242) [-6483.768] (-6482.129) -- 0:13:10 13000 -- (-6474.956) (-6479.851) [-6474.859] (-6481.217) * (-6475.904) (-6485.705) (-6486.424) [-6478.582] -- 0:12:39 13500 -- (-6476.899) (-6476.224) [-6475.089] (-6482.102) * (-6477.261) (-6486.776) (-6481.720) [-6476.610] -- 0:13:23 14000 -- [-6478.215] (-6483.237) (-6471.538) (-6478.835) * (-6476.457) (-6484.286) [-6479.933] (-6474.750) -- 0:12:54 14500 -- (-6480.246) [-6480.102] (-6475.745) (-6474.713) * [-6477.027] (-6484.759) (-6476.059) (-6474.582) -- 0:12:27 15000 -- (-6486.172) (-6481.258) (-6485.851) [-6478.362] * (-6480.480) [-6482.706] (-6478.431) (-6479.670) -- 0:13:08 Average standard deviation of split frequencies: 0.000000 15500 -- (-6483.815) [-6480.606] (-6479.138) (-6476.511) * (-6475.147) (-6480.651) (-6482.108) [-6480.939] -- 0:12:42 16000 -- [-6483.804] (-6480.620) (-6481.338) (-6485.652) * [-6480.280] (-6478.626) (-6482.381) (-6481.170) -- 0:13:19 16500 -- (-6486.614) [-6480.205] (-6480.301) (-6475.489) * (-6480.094) (-6475.745) (-6488.751) [-6475.406] -- 0:12:54 17000 -- (-6482.039) [-6484.553] (-6473.724) (-6483.160) * (-6484.960) [-6475.561] (-6483.470) (-6484.705) -- 0:12:31 17500 -- [-6478.390] (-6483.330) (-6473.415) (-6480.583) * (-6479.201) (-6472.881) [-6475.099] (-6475.817) -- 0:13:06 18000 -- (-6473.088) (-6486.681) (-6476.423) [-6480.372] * (-6477.041) (-6477.459) [-6474.453] (-6477.149) -- 0:12:43 18500 -- (-6473.691) (-6481.402) [-6478.716] (-6479.094) * (-6475.259) (-6478.650) [-6478.597] (-6479.364) -- 0:13:15 19000 -- (-6486.436) [-6477.423] (-6477.281) (-6489.156) * (-6476.972) (-6482.751) (-6481.429) [-6479.315] -- 0:12:54 19500 -- (-6483.298) (-6478.332) (-6478.401) [-6482.184] * [-6477.910] (-6480.065) (-6485.060) (-6479.848) -- 0:12:34 20000 -- (-6483.812) (-6485.770) (-6481.288) [-6480.597] * [-6474.490] (-6475.188) (-6482.288) (-6481.368) -- 0:13:04 Average standard deviation of split frequencies: 0.000000 20500 -- (-6484.931) [-6479.888] (-6477.190) (-6482.235) * (-6481.689) [-6477.897] (-6479.280) (-6478.301) -- 0:12:44 21000 -- (-6482.817) (-6484.429) [-6485.451] (-6479.528) * (-6478.084) (-6492.155) (-6483.052) [-6479.293] -- 0:13:12 21500 -- (-6479.869) [-6479.792] (-6487.650) (-6476.406) * (-6483.440) [-6482.659] (-6478.158) (-6485.488) -- 0:12:53 22000 -- (-6475.102) (-6481.325) (-6477.653) [-6485.318] * (-6479.386) (-6484.069) (-6478.001) [-6481.030] -- 0:12:35 22500 -- (-6472.521) (-6476.978) (-6482.313) [-6478.787] * [-6478.164] (-6483.142) (-6481.469) (-6479.303) -- 0:13:02 23000 -- (-6471.680) [-6477.170] (-6474.747) (-6475.842) * (-6478.585) [-6483.970] (-6479.060) (-6479.963) -- 0:12:44 23500 -- (-6487.271) (-6478.722) (-6476.147) [-6477.025] * [-6482.078] (-6483.499) (-6476.386) (-6488.053) -- 0:13:09 24000 -- (-6482.441) [-6477.211] (-6482.885) (-6480.245) * (-6482.519) (-6475.425) [-6479.388] (-6491.543) -- 0:12:52 24500 -- (-6478.823) (-6477.663) [-6479.550] (-6473.989) * (-6483.009) [-6481.678] (-6481.733) (-6477.653) -- 0:12:36 25000 -- (-6480.467) [-6480.402] (-6480.633) (-6482.098) * (-6478.584) (-6491.606) [-6479.562] (-6477.131) -- 0:13:00 Average standard deviation of split frequencies: 0.000000 25500 -- (-6479.995) (-6475.291) [-6476.646] (-6482.810) * (-6489.567) (-6483.844) [-6475.210] (-6479.159) -- 0:12:44 26000 -- (-6485.508) (-6483.750) (-6481.847) [-6472.218] * (-6487.728) (-6477.682) (-6485.379) [-6477.044] -- 0:13:06 26500 -- (-6484.261) [-6480.193] (-6487.418) (-6480.676) * (-6483.791) [-6481.848] (-6488.002) (-6475.632) -- 0:12:51 27000 -- (-6488.776) [-6481.478] (-6492.854) (-6480.761) * [-6478.669] (-6482.414) (-6481.314) (-6482.904) -- 0:12:36 27500 -- (-6482.290) (-6480.224) (-6478.690) [-6478.276] * (-6479.466) [-6476.075] (-6476.733) (-6473.543) -- 0:12:58 28000 -- (-6477.324) [-6475.120] (-6481.799) (-6477.481) * (-6483.623) (-6479.216) (-6476.693) [-6474.932] -- 0:12:43 28500 -- [-6476.999] (-6483.262) (-6484.863) (-6479.375) * (-6484.608) (-6475.197) [-6472.294] (-6482.047) -- 0:13:04 29000 -- (-6480.745) (-6485.059) [-6477.430] (-6477.604) * (-6484.467) (-6477.833) [-6480.691] (-6476.322) -- 0:12:50 29500 -- (-6482.952) [-6478.760] (-6479.750) (-6478.781) * [-6478.319] (-6486.759) (-6485.415) (-6480.549) -- 0:12:36 30000 -- (-6481.339) [-6476.803] (-6474.237) (-6482.735) * (-6482.794) (-6492.248) [-6479.809] (-6480.396) -- 0:12:56 Average standard deviation of split frequencies: 0.000000 30500 -- (-6477.685) (-6474.202) [-6476.842] (-6478.642) * [-6477.647] (-6484.435) (-6485.204) (-6482.223) -- 0:12:42 31000 -- (-6478.093) (-6479.212) (-6481.857) [-6480.316] * [-6482.031] (-6485.433) (-6484.939) (-6481.563) -- 0:12:30 31500 -- [-6478.703] (-6480.503) (-6484.608) (-6478.494) * (-6480.435) (-6487.212) [-6483.087] (-6478.317) -- 0:12:48 32000 -- [-6477.686] (-6475.253) (-6474.961) (-6479.513) * (-6491.337) [-6484.186] (-6479.541) (-6480.449) -- 0:12:36 32500 -- (-6481.863) [-6475.990] (-6476.901) (-6481.081) * (-6478.990) (-6480.548) [-6476.619] (-6483.618) -- 0:12:54 33000 -- (-6476.157) (-6480.290) [-6483.250] (-6477.578) * (-6490.007) (-6481.686) [-6479.769] (-6475.005) -- 0:12:41 33500 -- (-6483.475) (-6484.542) (-6480.671) [-6475.303] * [-6483.135] (-6485.529) (-6486.783) (-6480.844) -- 0:12:30 34000 -- (-6479.187) (-6491.864) (-6478.552) [-6477.472] * (-6487.040) (-6482.976) (-6490.524) [-6477.589] -- 0:12:47 34500 -- (-6476.889) (-6484.544) [-6484.143] (-6476.257) * (-6474.940) (-6485.366) [-6480.918] (-6478.918) -- 0:12:35 35000 -- (-6477.682) (-6478.846) (-6480.112) [-6474.208] * [-6475.706] (-6479.128) (-6478.133) (-6481.189) -- 0:12:24 Average standard deviation of split frequencies: 0.000000 35500 -- (-6481.756) (-6481.469) (-6491.098) [-6474.188] * (-6479.384) (-6481.804) [-6481.590] (-6480.453) -- 0:12:40 36000 -- [-6489.840] (-6494.205) (-6483.237) (-6480.157) * (-6486.033) (-6484.381) [-6476.700] (-6481.633) -- 0:12:29 36500 -- [-6478.450] (-6491.404) (-6481.803) (-6481.741) * (-6483.543) [-6479.523] (-6476.408) (-6479.411) -- 0:12:19 37000 -- [-6480.212] (-6480.439) (-6480.859) (-6482.954) * [-6486.625] (-6479.348) (-6479.346) (-6480.868) -- 0:12:34 37500 -- (-6482.438) (-6487.656) (-6476.892) [-6473.975] * (-6486.046) (-6479.663) (-6486.526) [-6474.632] -- 0:12:24 38000 -- [-6476.680] (-6477.169) (-6482.341) (-6489.796) * (-6484.197) (-6485.246) [-6480.080] (-6474.150) -- 0:12:39 38500 -- (-6481.639) (-6474.600) (-6477.742) [-6480.521] * (-6475.615) (-6476.541) (-6475.802) [-6474.706] -- 0:12:29 39000 -- (-6481.141) (-6477.220) (-6480.715) [-6477.188] * (-6473.795) [-6479.636] (-6488.096) (-6488.128) -- 0:12:19 39500 -- (-6489.747) [-6477.170] (-6477.389) (-6476.251) * (-6482.627) [-6474.814] (-6486.655) (-6480.012) -- 0:12:33 40000 -- (-6479.001) [-6477.248] (-6488.151) (-6483.699) * (-6482.661) (-6476.526) (-6480.498) [-6476.977] -- 0:12:24 Average standard deviation of split frequencies: 0.000000 40500 -- [-6474.224] (-6481.507) (-6477.903) (-6487.618) * [-6480.583] (-6482.498) (-6479.785) (-6475.660) -- 0:12:14 41000 -- [-6473.931] (-6480.721) (-6478.564) (-6485.108) * (-6481.629) (-6481.603) (-6482.664) [-6477.405] -- 0:12:28 41500 -- (-6477.627) [-6476.893] (-6478.998) (-6488.855) * (-6475.128) (-6481.720) [-6480.351] (-6476.388) -- 0:12:19 42000 -- (-6479.758) [-6477.477] (-6480.828) (-6487.188) * [-6475.786] (-6475.647) (-6478.563) (-6486.413) -- 0:12:32 42500 -- (-6478.344) [-6479.156] (-6480.347) (-6481.036) * (-6484.560) (-6480.423) (-6482.742) [-6482.237] -- 0:12:23 43000 -- (-6482.430) [-6484.352] (-6488.962) (-6482.555) * [-6476.660] (-6479.721) (-6478.374) (-6488.627) -- 0:12:14 43500 -- (-6480.654) (-6482.382) (-6479.056) [-6480.287] * (-6478.631) (-6476.846) [-6481.199] (-6478.631) -- 0:12:27 44000 -- (-6482.659) (-6489.570) [-6473.870] (-6484.306) * (-6477.909) (-6479.714) [-6478.862] (-6486.328) -- 0:12:18 44500 -- [-6485.288] (-6486.748) (-6489.601) (-6481.574) * (-6489.741) (-6479.546) [-6478.884] (-6480.573) -- 0:12:10 45000 -- [-6474.460] (-6473.328) (-6484.056) (-6482.225) * [-6481.720] (-6489.292) (-6482.611) (-6478.503) -- 0:12:22 Average standard deviation of split frequencies: 0.000000 45500 -- (-6478.070) (-6478.671) (-6483.964) [-6479.111] * [-6478.238] (-6475.646) (-6483.135) (-6485.238) -- 0:12:14 46000 -- (-6477.278) (-6487.662) [-6479.975] (-6472.478) * (-6482.251) [-6473.162] (-6478.007) (-6477.208) -- 0:12:26 46500 -- (-6481.328) [-6478.861] (-6478.999) (-6483.351) * (-6480.938) [-6472.642] (-6477.236) (-6477.196) -- 0:12:18 47000 -- (-6484.577) [-6480.962] (-6480.708) (-6485.175) * [-6475.437] (-6474.420) (-6480.177) (-6476.551) -- 0:12:09 47500 -- (-6484.301) [-6480.357] (-6483.941) (-6479.665) * (-6478.612) [-6476.410] (-6474.699) (-6475.880) -- 0:12:21 48000 -- (-6474.823) [-6476.025] (-6478.350) (-6481.170) * (-6474.856) (-6477.410) [-6471.963] (-6479.846) -- 0:12:13 48500 -- [-6476.243] (-6478.283) (-6477.950) (-6476.889) * (-6482.254) (-6476.626) (-6479.869) [-6478.399] -- 0:12:05 49000 -- (-6477.508) [-6475.846] (-6480.115) (-6474.544) * [-6480.471] (-6478.652) (-6492.976) (-6480.173) -- 0:12:17 49500 -- (-6473.371) [-6479.690] (-6478.230) (-6479.024) * [-6477.703] (-6483.437) (-6487.236) (-6481.597) -- 0:12:09 50000 -- (-6476.463) (-6481.674) (-6478.897) [-6478.385] * (-6474.384) [-6480.085] (-6490.405) (-6478.534) -- 0:12:21 Average standard deviation of split frequencies: 0.000000 50500 -- (-6477.465) [-6478.625] (-6477.676) (-6483.399) * (-6483.305) (-6483.596) [-6477.918] (-6482.671) -- 0:12:13 51000 -- (-6478.285) (-6481.410) (-6481.359) [-6479.384] * (-6475.292) [-6479.512] (-6477.939) (-6482.060) -- 0:12:05 51500 -- (-6478.421) [-6479.554] (-6477.583) (-6474.777) * (-6481.348) (-6475.824) [-6476.178] (-6479.040) -- 0:12:16 52000 -- (-6477.787) [-6483.112] (-6477.790) (-6480.338) * (-6479.130) [-6483.795] (-6482.122) (-6480.400) -- 0:12:09 52500 -- (-6478.679) (-6484.015) [-6483.754] (-6484.129) * (-6481.303) (-6480.095) [-6479.993] (-6486.001) -- 0:12:01 53000 -- (-6482.060) (-6473.988) (-6480.743) [-6488.574] * (-6476.351) (-6480.746) (-6487.404) [-6486.828] -- 0:12:12 53500 -- [-6476.798] (-6477.631) (-6482.250) (-6486.334) * [-6473.336] (-6489.270) (-6481.042) (-6478.162) -- 0:12:05 54000 -- (-6475.653) [-6476.822] (-6474.349) (-6477.830) * (-6483.708) [-6477.288] (-6481.059) (-6477.634) -- 0:12:15 54500 -- (-6477.393) [-6479.550] (-6482.812) (-6472.140) * (-6483.893) (-6474.447) [-6483.112] (-6481.256) -- 0:12:08 55000 -- [-6474.362] (-6485.667) (-6478.412) (-6482.558) * [-6478.693] (-6475.660) (-6479.217) (-6475.584) -- 0:12:01 Average standard deviation of split frequencies: 0.000000 55500 -- [-6479.305] (-6483.005) (-6480.303) (-6476.040) * (-6477.171) (-6487.672) (-6483.251) [-6476.770] -- 0:12:11 56000 -- (-6476.822) [-6477.359] (-6480.005) (-6476.358) * (-6486.974) (-6477.033) (-6477.088) [-6477.947] -- 0:12:04 56500 -- (-6473.468) [-6475.811] (-6479.312) (-6480.727) * (-6482.494) [-6478.969] (-6475.709) (-6484.829) -- 0:12:14 57000 -- (-6480.671) (-6479.422) [-6481.357] (-6479.840) * (-6482.311) [-6479.252] (-6477.347) (-6478.409) -- 0:12:07 57500 -- (-6482.457) [-6475.497] (-6481.273) (-6479.222) * [-6483.866] (-6475.535) (-6475.370) (-6478.914) -- 0:12:01 58000 -- [-6484.237] (-6479.700) (-6483.619) (-6482.702) * (-6480.234) [-6480.545] (-6485.913) (-6476.544) -- 0:12:10 58500 -- [-6480.758] (-6478.725) (-6485.507) (-6484.980) * (-6482.957) (-6479.937) [-6481.021] (-6473.833) -- 0:12:04 59000 -- (-6476.949) (-6481.094) (-6479.997) [-6475.646] * (-6480.309) (-6480.473) [-6478.140] (-6473.764) -- 0:11:57 59500 -- (-6479.543) (-6492.807) [-6476.306] (-6477.117) * (-6486.436) [-6472.180] (-6487.770) (-6477.835) -- 0:12:07 60000 -- [-6478.411] (-6480.133) (-6474.958) (-6493.633) * (-6481.788) (-6476.904) [-6483.426] (-6474.715) -- 0:12:00 Average standard deviation of split frequencies: 0.000000 60500 -- (-6481.185) (-6476.304) (-6479.714) [-6485.837] * (-6476.629) (-6481.951) [-6473.831] (-6476.570) -- 0:12:09 61000 -- (-6478.514) (-6485.341) (-6479.570) [-6483.398] * (-6479.458) (-6481.548) [-6481.764] (-6477.766) -- 0:12:03 61500 -- (-6475.122) (-6483.395) (-6481.805) [-6480.864] * [-6493.810] (-6473.906) (-6478.732) (-6483.493) -- 0:11:57 62000 -- (-6478.546) [-6482.721] (-6479.866) (-6476.919) * (-6489.738) (-6477.758) (-6478.100) [-6480.670] -- 0:12:06 62500 -- (-6479.838) (-6482.565) [-6481.873] (-6475.960) * (-6485.578) (-6475.324) (-6475.105) [-6481.187] -- 0:12:00 63000 -- (-6481.539) [-6478.560] (-6480.831) (-6480.580) * (-6481.591) (-6481.930) (-6479.957) [-6482.125] -- 0:12:08 63500 -- [-6475.868] (-6473.020) (-6480.735) (-6474.892) * (-6482.877) [-6477.234] (-6480.523) (-6479.587) -- 0:12:02 64000 -- (-6477.635) (-6485.740) (-6482.897) [-6479.466] * (-6477.846) (-6478.573) [-6479.042] (-6478.129) -- 0:11:56 64500 -- (-6478.333) (-6481.467) [-6486.961] (-6481.424) * (-6478.900) [-6481.130] (-6476.101) (-6474.227) -- 0:12:05 65000 -- [-6483.218] (-6477.322) (-6484.916) (-6483.845) * (-6485.364) (-6483.340) (-6476.034) [-6477.568] -- 0:11:59 Average standard deviation of split frequencies: 0.000000 65500 -- (-6481.511) (-6487.959) [-6483.213] (-6478.099) * [-6477.302] (-6476.353) (-6480.635) (-6475.623) -- 0:11:53 66000 -- [-6476.465] (-6485.300) (-6482.160) (-6488.399) * [-6474.607] (-6474.815) (-6478.697) (-6482.793) -- 0:12:01 66500 -- (-6475.925) (-6484.982) [-6475.376] (-6478.735) * (-6476.688) (-6488.140) [-6476.185] (-6488.203) -- 0:11:55 67000 -- [-6477.558] (-6483.912) (-6479.497) (-6482.155) * [-6480.635] (-6477.032) (-6481.096) (-6479.945) -- 0:12:04 67500 -- [-6480.677] (-6481.037) (-6476.320) (-6478.790) * (-6483.444) [-6480.264] (-6476.501) (-6479.264) -- 0:11:58 68000 -- [-6479.206] (-6476.707) (-6477.262) (-6479.833) * (-6481.088) (-6482.698) [-6477.195] (-6486.481) -- 0:11:52 68500 -- (-6476.537) [-6476.725] (-6477.937) (-6482.413) * (-6479.494) (-6479.611) [-6481.442] (-6481.104) -- 0:12:00 69000 -- (-6488.692) (-6476.606) [-6477.264] (-6480.174) * (-6485.274) (-6474.381) [-6482.073] (-6480.286) -- 0:11:55 69500 -- (-6473.049) (-6478.806) [-6481.533] (-6479.021) * (-6485.255) (-6482.076) [-6478.918] (-6477.550) -- 0:12:02 70000 -- [-6478.658] (-6486.251) (-6478.835) (-6485.035) * (-6482.600) (-6477.575) [-6476.162] (-6485.111) -- 0:11:57 Average standard deviation of split frequencies: 0.000000 70500 -- (-6479.171) (-6487.145) [-6475.672] (-6487.835) * (-6477.559) (-6481.195) (-6482.237) [-6480.775] -- 0:11:51 71000 -- [-6481.312] (-6479.250) (-6478.850) (-6476.956) * (-6481.084) (-6481.299) (-6494.029) [-6484.777] -- 0:11:59 71500 -- (-6481.040) (-6488.479) (-6487.057) [-6483.100] * (-6472.926) [-6477.952] (-6489.960) (-6481.732) -- 0:11:54 72000 -- [-6491.945] (-6485.298) (-6474.228) (-6483.835) * (-6470.498) [-6482.290] (-6483.619) (-6487.776) -- 0:11:48 72500 -- (-6472.898) (-6480.068) [-6478.827] (-6475.715) * [-6476.323] (-6474.518) (-6478.729) (-6479.874) -- 0:11:56 73000 -- (-6481.172) [-6482.006] (-6477.584) (-6481.151) * [-6473.814] (-6481.121) (-6478.933) (-6477.390) -- 0:11:51 73500 -- [-6478.533] (-6479.295) (-6480.034) (-6484.748) * (-6481.669) [-6475.601] (-6479.670) (-6477.073) -- 0:11:58 74000 -- (-6479.769) [-6475.359] (-6478.291) (-6482.769) * (-6480.969) [-6482.528] (-6479.174) (-6484.461) -- 0:11:53 74500 -- [-6481.046] (-6476.704) (-6479.591) (-6474.634) * (-6475.639) (-6476.413) (-6479.974) [-6482.610] -- 0:11:48 75000 -- (-6479.553) (-6476.039) [-6475.140] (-6483.247) * (-6483.704) [-6482.963] (-6473.536) (-6480.771) -- 0:11:55 Average standard deviation of split frequencies: 0.000000 75500 -- [-6480.728] (-6473.492) (-6480.013) (-6477.601) * (-6484.700) (-6476.415) (-6483.877) [-6484.615] -- 0:11:50 76000 -- (-6483.148) [-6480.877] (-6481.457) (-6477.215) * (-6490.956) (-6480.612) (-6484.868) [-6477.865] -- 0:11:57 76500 -- (-6473.245) (-6478.436) (-6479.564) [-6484.128] * [-6484.972] (-6477.177) (-6481.060) (-6485.588) -- 0:11:52 77000 -- (-6479.635) (-6478.264) (-6481.074) [-6483.555] * (-6483.975) (-6481.636) (-6482.262) [-6477.001] -- 0:11:47 77500 -- (-6484.369) (-6474.138) [-6476.167] (-6481.262) * (-6478.900) (-6480.529) [-6475.115] (-6477.022) -- 0:11:54 78000 -- (-6484.413) (-6487.714) (-6477.783) [-6482.989] * [-6478.715] (-6484.775) (-6479.853) (-6488.479) -- 0:11:49 78500 -- (-6483.243) (-6481.071) [-6475.231] (-6483.785) * (-6479.673) (-6483.619) [-6477.400] (-6483.138) -- 0:11:44 79000 -- (-6488.262) (-6483.421) (-6479.234) [-6482.858] * (-6485.622) (-6478.682) [-6471.660] (-6480.648) -- 0:11:51 79500 -- (-6497.341) [-6476.779] (-6480.284) (-6479.135) * [-6476.787] (-6474.806) (-6476.368) (-6488.958) -- 0:11:46 80000 -- (-6488.712) (-6476.817) [-6480.302] (-6477.869) * [-6477.307] (-6484.501) (-6481.143) (-6480.628) -- 0:11:53 Average standard deviation of split frequencies: 0.000000 80500 -- (-6475.671) (-6483.763) (-6481.083) [-6478.325] * (-6480.305) [-6477.755] (-6479.666) (-6486.142) -- 0:11:48 81000 -- [-6477.784] (-6484.474) (-6479.656) (-6487.998) * (-6477.669) (-6477.125) [-6480.113] (-6478.343) -- 0:11:43 81500 -- (-6479.463) [-6482.643] (-6490.201) (-6477.645) * [-6479.705] (-6480.894) (-6473.334) (-6480.643) -- 0:11:50 82000 -- [-6481.889] (-6476.606) (-6487.654) (-6482.760) * (-6477.221) [-6475.993] (-6477.854) (-6479.417) -- 0:11:45 82500 -- (-6483.115) [-6475.682] (-6479.103) (-6474.136) * [-6481.806] (-6479.331) (-6484.948) (-6477.888) -- 0:11:51 83000 -- (-6487.759) [-6476.825] (-6479.929) (-6480.329) * (-6485.649) (-6480.734) [-6474.553] (-6487.016) -- 0:11:47 83500 -- [-6480.295] (-6479.913) (-6484.488) (-6472.228) * (-6482.526) (-6482.586) (-6482.505) [-6481.896] -- 0:11:42 84000 -- (-6479.695) (-6476.405) (-6475.024) [-6477.903] * (-6484.295) (-6483.325) (-6478.145) [-6474.035] -- 0:11:48 84500 -- (-6477.491) (-6481.102) (-6481.136) [-6478.189] * [-6478.075] (-6478.747) (-6480.436) (-6489.479) -- 0:11:44 85000 -- (-6481.598) (-6487.209) [-6477.911] (-6481.481) * [-6476.776] (-6480.508) (-6485.887) (-6479.621) -- 0:11:50 Average standard deviation of split frequencies: 0.000000 85500 -- [-6480.135] (-6484.289) (-6491.138) (-6475.298) * (-6474.591) (-6485.900) (-6478.135) [-6476.855] -- 0:11:45 86000 -- [-6475.623] (-6475.546) (-6483.836) (-6477.845) * (-6482.970) (-6476.980) [-6480.989] (-6478.637) -- 0:11:41 86500 -- (-6478.309) [-6480.769] (-6481.902) (-6479.483) * (-6474.987) (-6480.186) [-6476.961] (-6484.615) -- 0:11:47 87000 -- (-6479.675) [-6483.377] (-6482.380) (-6474.994) * [-6478.272] (-6483.966) (-6472.273) (-6483.092) -- 0:11:43 87500 -- (-6478.929) (-6475.213) [-6482.729] (-6482.893) * (-6483.870) (-6485.317) [-6477.959] (-6475.265) -- 0:11:38 88000 -- [-6479.151] (-6479.812) (-6482.646) (-6480.610) * (-6478.696) (-6484.877) (-6481.079) [-6482.072] -- 0:11:44 88500 -- [-6476.355] (-6477.613) (-6479.600) (-6478.090) * (-6488.282) (-6477.911) [-6475.589] (-6483.966) -- 0:11:40 89000 -- (-6480.648) (-6475.303) (-6482.650) [-6483.570] * (-6495.076) [-6477.809] (-6477.143) (-6480.880) -- 0:11:46 89500 -- [-6481.671] (-6482.354) (-6474.512) (-6485.476) * (-6481.235) [-6477.160] (-6480.032) (-6487.377) -- 0:11:41 90000 -- (-6480.281) [-6476.172] (-6478.995) (-6480.672) * (-6483.233) (-6484.486) (-6482.300) [-6483.131] -- 0:11:37 Average standard deviation of split frequencies: 0.000000 90500 -- (-6481.485) (-6479.202) (-6482.854) [-6474.903] * (-6486.740) [-6476.082] (-6476.281) (-6483.979) -- 0:11:43 91000 -- (-6482.449) (-6481.704) (-6483.555) [-6482.481] * (-6487.405) (-6486.594) (-6478.921) [-6477.560] -- 0:11:39 91500 -- (-6483.966) (-6484.919) (-6474.560) [-6477.357] * (-6486.803) (-6474.396) [-6475.128] (-6483.036) -- 0:11:44 92000 -- (-6482.563) (-6476.626) [-6476.769] (-6479.550) * (-6482.187) (-6474.560) (-6495.249) [-6477.201] -- 0:11:40 92500 -- (-6480.037) [-6479.642] (-6479.223) (-6480.409) * (-6494.277) [-6473.414] (-6478.059) (-6490.485) -- 0:11:36 93000 -- (-6476.617) (-6480.255) [-6482.471] (-6482.306) * (-6484.175) [-6475.770] (-6476.148) (-6482.687) -- 0:11:42 93500 -- (-6475.873) [-6476.939] (-6481.125) (-6475.844) * (-6484.924) (-6475.548) [-6476.630] (-6482.158) -- 0:11:38 94000 -- (-6476.918) [-6488.212] (-6473.522) (-6482.370) * (-6487.593) [-6477.822] (-6475.160) (-6483.225) -- 0:11:33 94500 -- [-6475.111] (-6485.126) (-6481.824) (-6481.468) * (-6489.136) (-6487.919) [-6480.663] (-6483.385) -- 0:11:39 95000 -- (-6487.397) (-6482.070) [-6473.844] (-6480.855) * (-6480.586) [-6487.570] (-6489.149) (-6478.771) -- 0:11:35 Average standard deviation of split frequencies: 0.000000 95500 -- [-6477.108] (-6478.882) (-6483.301) (-6482.561) * (-6478.993) (-6487.665) (-6482.593) [-6477.537] -- 0:11:40 96000 -- [-6474.744] (-6483.188) (-6487.107) (-6481.578) * (-6475.104) (-6488.683) (-6483.342) [-6486.591] -- 0:11:36 96500 -- (-6476.888) (-6496.039) [-6478.526] (-6477.848) * [-6485.718] (-6489.458) (-6477.179) (-6482.709) -- 0:11:32 97000 -- (-6479.027) (-6478.199) [-6476.229] (-6479.022) * [-6480.396] (-6484.379) (-6484.300) (-6487.012) -- 0:11:38 97500 -- (-6472.453) (-6479.262) (-6474.899) [-6476.986] * (-6478.410) [-6476.901] (-6482.324) (-6480.801) -- 0:11:34 98000 -- [-6480.060] (-6485.980) (-6485.646) (-6474.334) * (-6477.483) [-6476.601] (-6485.341) (-6482.213) -- 0:11:30 98500 -- (-6479.855) (-6481.836) [-6475.774] (-6474.456) * [-6475.864] (-6476.780) (-6485.169) (-6478.171) -- 0:11:35 99000 -- [-6475.882] (-6477.815) (-6482.020) (-6490.685) * (-6483.976) [-6482.172] (-6479.066) (-6479.419) -- 0:11:31 99500 -- (-6480.285) (-6482.621) (-6478.237) [-6477.676] * (-6479.557) (-6493.834) (-6484.398) [-6478.679] -- 0:11:36 100000 -- (-6487.171) (-6478.556) (-6485.365) [-6480.821] * [-6476.863] (-6486.029) (-6490.611) (-6482.952) -- 0:11:33 Average standard deviation of split frequencies: 0.000000 100500 -- (-6485.213) [-6478.502] (-6485.009) (-6479.065) * [-6480.162] (-6481.046) (-6484.171) (-6483.105) -- 0:11:29 101000 -- (-6481.964) [-6481.925] (-6483.123) (-6477.276) * (-6483.165) (-6484.723) [-6481.288] (-6478.967) -- 0:11:34 101500 -- [-6482.529] (-6481.250) (-6488.059) (-6479.330) * (-6484.543) (-6482.237) (-6479.332) [-6481.248] -- 0:11:30 102000 -- [-6480.707] (-6482.805) (-6479.294) (-6483.242) * (-6474.577) (-6490.130) (-6482.369) [-6482.986] -- 0:11:26 102500 -- (-6482.202) (-6480.275) [-6478.411] (-6478.482) * (-6481.877) [-6479.382] (-6476.947) (-6479.948) -- 0:11:31 103000 -- (-6479.056) [-6483.784] (-6476.126) (-6476.192) * (-6476.486) [-6481.877] (-6478.197) (-6480.249) -- 0:11:27 103500 -- [-6476.334] (-6480.487) (-6477.954) (-6483.409) * (-6473.185) [-6482.182] (-6482.181) (-6476.299) -- 0:11:32 104000 -- (-6484.056) (-6489.050) [-6477.233] (-6475.920) * (-6475.601) (-6481.913) [-6477.211] (-6480.584) -- 0:11:29 104500 -- [-6477.982] (-6485.242) (-6478.285) (-6476.614) * [-6480.723] (-6491.277) (-6480.085) (-6479.863) -- 0:11:25 105000 -- (-6480.089) (-6483.258) (-6486.476) [-6481.753] * (-6479.245) (-6480.092) (-6479.545) [-6478.984] -- 0:11:30 Average standard deviation of split frequencies: 0.000000 105500 -- (-6479.034) (-6479.232) (-6474.059) [-6479.651] * (-6479.537) (-6485.445) [-6485.523] (-6482.361) -- 0:11:26 106000 -- (-6477.958) (-6478.692) (-6476.298) [-6485.351] * (-6476.960) (-6486.997) (-6484.480) [-6477.643] -- 0:11:23 106500 -- (-6477.870) (-6487.991) [-6477.270] (-6477.260) * [-6480.913] (-6479.025) (-6479.409) (-6478.590) -- 0:11:27 107000 -- (-6473.720) [-6488.374] (-6483.962) (-6481.823) * (-6479.592) (-6484.601) [-6475.220] (-6474.628) -- 0:11:24 107500 -- (-6476.395) (-6488.482) (-6476.996) [-6482.764] * [-6480.291] (-6476.928) (-6478.853) (-6477.505) -- 0:11:29 108000 -- [-6475.976] (-6479.622) (-6475.578) (-6478.722) * [-6476.019] (-6478.219) (-6478.883) (-6477.399) -- 0:11:25 108500 -- (-6479.508) (-6476.104) (-6485.954) [-6476.390] * (-6485.575) (-6479.415) [-6476.163] (-6476.861) -- 0:11:21 109000 -- (-6478.910) (-6480.777) [-6475.580] (-6484.431) * (-6475.795) (-6482.766) (-6478.366) [-6475.587] -- 0:11:26 109500 -- (-6487.747) (-6482.675) [-6480.135] (-6482.393) * (-6489.896) (-6479.492) [-6479.551] (-6477.567) -- 0:11:23 110000 -- (-6475.133) (-6475.983) (-6477.523) [-6481.120] * [-6477.313] (-6480.162) (-6475.700) (-6476.437) -- 0:11:27 Average standard deviation of split frequencies: 0.000000 110500 -- (-6478.690) (-6473.427) [-6477.326] (-6485.608) * (-6474.072) [-6477.958] (-6478.669) (-6485.278) -- 0:11:24 111000 -- [-6479.652] (-6481.740) (-6479.505) (-6475.246) * (-6483.596) (-6485.906) (-6475.584) [-6479.245] -- 0:11:20 111500 -- (-6487.050) (-6479.506) [-6478.205] (-6479.006) * (-6479.438) (-6473.460) (-6477.550) [-6480.795] -- 0:11:25 112000 -- [-6478.779] (-6482.593) (-6479.234) (-6492.813) * (-6477.571) (-6484.449) (-6476.391) [-6479.149] -- 0:11:21 112500 -- [-6475.969] (-6484.740) (-6498.362) (-6492.613) * (-6477.631) (-6483.354) (-6483.796) [-6477.406] -- 0:11:18 113000 -- (-6482.761) [-6477.214] (-6483.703) (-6491.451) * (-6491.710) [-6479.287] (-6477.902) (-6493.017) -- 0:11:22 113500 -- (-6477.875) (-6476.691) [-6480.879] (-6486.519) * [-6479.861] (-6478.654) (-6480.198) (-6478.075) -- 0:11:19 114000 -- (-6479.984) (-6478.190) (-6477.004) [-6477.336] * (-6477.438) (-6482.985) [-6481.878] (-6480.272) -- 0:11:23 114500 -- (-6479.904) (-6474.988) (-6481.933) [-6480.309] * (-6474.750) (-6477.832) (-6478.176) [-6474.489] -- 0:11:20 115000 -- (-6480.758) (-6482.332) [-6481.859] (-6476.551) * (-6478.504) (-6483.618) (-6478.923) [-6475.872] -- 0:11:24 Average standard deviation of split frequencies: 0.000000 115500 -- (-6482.545) (-6482.925) [-6478.273] (-6479.387) * [-6478.793] (-6475.710) (-6481.135) (-6484.089) -- 0:11:29 116000 -- [-6477.744] (-6479.333) (-6480.069) (-6484.846) * (-6480.572) (-6476.772) [-6479.239] (-6481.010) -- 0:11:25 116500 -- (-6478.203) [-6484.505] (-6475.368) (-6477.829) * [-6481.235] (-6479.521) (-6481.200) (-6482.700) -- 0:11:30 117000 -- (-6481.385) (-6474.480) [-6473.724] (-6488.993) * (-6480.212) (-6478.808) [-6479.003] (-6484.913) -- 0:11:26 117500 -- (-6478.983) [-6476.591] (-6482.654) (-6479.440) * (-6482.084) (-6477.831) [-6482.437] (-6486.207) -- 0:11:23 118000 -- (-6479.107) [-6473.917] (-6477.278) (-6478.308) * [-6481.656] (-6472.664) (-6476.582) (-6483.529) -- 0:11:27 118500 -- [-6473.861] (-6475.130) (-6478.953) (-6479.212) * (-6479.246) [-6479.718] (-6482.568) (-6481.668) -- 0:11:24 119000 -- (-6479.894) (-6476.532) [-6476.167] (-6485.619) * (-6483.243) [-6474.556] (-6482.096) (-6481.139) -- 0:11:21 119500 -- (-6482.714) (-6476.901) [-6483.030] (-6480.622) * [-6481.169] (-6481.332) (-6484.717) (-6484.252) -- 0:11:25 120000 -- (-6479.133) (-6479.097) (-6482.159) [-6479.167] * (-6473.677) [-6473.890] (-6481.341) (-6474.301) -- 0:11:22 Average standard deviation of split frequencies: 0.000000 120500 -- (-6481.235) (-6487.603) [-6483.347] (-6479.754) * (-6485.469) (-6474.432) [-6480.331] (-6482.815) -- 0:11:26 121000 -- (-6474.814) (-6482.826) [-6481.358] (-6486.326) * (-6481.784) (-6480.414) [-6479.497] (-6481.611) -- 0:11:22 121500 -- (-6481.094) (-6492.598) [-6478.770] (-6481.070) * (-6482.299) (-6484.286) [-6474.306] (-6477.928) -- 0:11:19 122000 -- (-6477.485) (-6485.070) (-6486.566) [-6476.974] * (-6482.756) (-6476.539) [-6474.580] (-6476.230) -- 0:11:23 122500 -- (-6477.624) (-6479.379) (-6481.781) [-6475.236] * [-6484.151] (-6492.324) (-6473.402) (-6482.614) -- 0:11:20 123000 -- (-6487.568) (-6477.291) (-6485.842) [-6474.005] * [-6483.986] (-6483.636) (-6486.411) (-6482.154) -- 0:11:24 123500 -- (-6485.841) (-6474.072) [-6479.197] (-6477.219) * (-6480.387) (-6479.885) [-6477.031] (-6484.294) -- 0:11:21 124000 -- (-6476.644) [-6482.782] (-6479.557) (-6479.116) * (-6483.288) (-6482.135) [-6480.370] (-6478.439) -- 0:11:18 124500 -- [-6475.891] (-6474.440) (-6482.118) (-6486.345) * [-6478.121] (-6480.529) (-6490.365) (-6480.178) -- 0:11:22 125000 -- [-6479.306] (-6474.789) (-6487.152) (-6482.142) * [-6477.714] (-6476.038) (-6484.964) (-6478.883) -- 0:11:19 Average standard deviation of split frequencies: 0.000000 125500 -- (-6484.405) (-6472.443) (-6491.976) [-6480.064] * (-6478.236) (-6477.386) (-6483.426) [-6481.480] -- 0:11:15 126000 -- (-6475.562) [-6481.954] (-6478.931) (-6480.020) * [-6476.110] (-6477.065) (-6478.342) (-6489.383) -- 0:11:19 126500 -- [-6481.947] (-6477.681) (-6473.836) (-6478.292) * (-6481.369) (-6482.876) [-6472.754] (-6478.850) -- 0:11:16 127000 -- (-6479.660) (-6476.323) (-6484.620) [-6478.963] * (-6481.961) [-6477.836] (-6480.882) (-6477.611) -- 0:11:20 127500 -- (-6476.100) (-6473.703) (-6475.485) [-6474.828] * (-6474.241) (-6473.812) [-6477.484] (-6481.279) -- 0:11:17 128000 -- (-6480.452) (-6479.362) (-6479.678) [-6481.249] * [-6476.340] (-6485.222) (-6482.820) (-6477.049) -- 0:11:14 128500 -- (-6480.892) (-6483.517) [-6477.497] (-6475.421) * (-6475.580) (-6482.324) (-6480.897) [-6477.404] -- 0:11:18 129000 -- (-6485.467) [-6472.964] (-6480.307) (-6475.928) * (-6477.212) [-6478.402] (-6482.139) (-6484.016) -- 0:11:15 129500 -- (-6476.539) [-6475.463] (-6487.690) (-6476.625) * (-6485.733) (-6483.139) [-6478.286] (-6491.373) -- 0:11:12 130000 -- (-6475.905) [-6480.010] (-6483.343) (-6482.665) * (-6485.643) [-6484.125] (-6478.398) (-6482.699) -- 0:11:15 Average standard deviation of split frequencies: 0.000000 130500 -- [-6481.991] (-6476.607) (-6479.703) (-6478.329) * [-6482.655] (-6476.268) (-6480.066) (-6480.425) -- 0:11:12 131000 -- [-6478.407] (-6485.744) (-6481.146) (-6481.196) * (-6486.253) [-6478.076] (-6475.380) (-6482.447) -- 0:11:16 131500 -- (-6478.253) [-6474.528] (-6477.599) (-6479.019) * (-6482.315) (-6485.491) [-6479.190] (-6477.575) -- 0:11:13 132000 -- (-6482.732) (-6480.319) [-6481.370] (-6484.835) * [-6484.722] (-6489.461) (-6481.201) (-6478.249) -- 0:11:10 132500 -- (-6483.116) [-6474.263] (-6484.989) (-6474.167) * [-6487.236] (-6489.924) (-6486.074) (-6483.576) -- 0:11:14 133000 -- (-6481.574) (-6477.906) [-6475.705] (-6476.185) * (-6475.212) (-6480.691) (-6482.570) [-6484.265] -- 0:11:11 133500 -- (-6484.257) (-6474.681) (-6474.099) [-6480.823] * (-6484.931) (-6481.255) (-6488.183) [-6485.849] -- 0:11:15 134000 -- (-6473.514) [-6481.261] (-6476.845) (-6476.191) * [-6485.228] (-6477.105) (-6477.108) (-6478.821) -- 0:11:12 134500 -- (-6481.364) (-6476.028) (-6486.988) [-6476.543] * (-6481.050) (-6479.909) (-6477.508) [-6479.253] -- 0:11:09 135000 -- (-6482.956) [-6477.451] (-6479.790) (-6477.791) * (-6480.789) (-6476.043) [-6480.643] (-6491.876) -- 0:11:12 Average standard deviation of split frequencies: 0.000000 135500 -- (-6486.256) (-6478.659) [-6478.351] (-6481.534) * (-6491.983) (-6479.260) (-6474.722) [-6478.390] -- 0:11:09 136000 -- (-6480.717) (-6475.443) (-6480.692) [-6481.354] * (-6494.321) (-6480.937) [-6477.350] (-6474.710) -- 0:11:07 136500 -- (-6479.494) [-6477.592] (-6478.554) (-6479.334) * (-6480.383) [-6475.355] (-6479.869) (-6481.904) -- 0:11:10 137000 -- (-6478.799) (-6483.158) [-6482.385] (-6481.173) * (-6482.367) [-6477.950] (-6474.438) (-6485.299) -- 0:11:07 137500 -- (-6478.103) (-6478.780) [-6478.482] (-6482.712) * (-6473.161) (-6480.484) [-6481.395] (-6488.105) -- 0:11:11 138000 -- [-6475.793] (-6474.859) (-6484.251) (-6477.017) * [-6477.569] (-6472.942) (-6477.786) (-6480.076) -- 0:11:08 138500 -- (-6491.997) [-6480.894] (-6475.030) (-6477.083) * (-6478.782) (-6481.384) [-6474.701] (-6486.740) -- 0:11:05 139000 -- (-6481.738) (-6482.007) [-6477.889] (-6476.522) * (-6479.239) (-6475.224) [-6478.942] (-6481.190) -- 0:11:08 139500 -- (-6482.296) (-6477.516) (-6477.886) [-6479.838] * [-6477.872] (-6485.200) (-6474.020) (-6474.690) -- 0:11:06 140000 -- (-6480.653) (-6482.035) (-6478.889) [-6484.962] * (-6480.170) (-6487.454) (-6482.797) [-6473.758] -- 0:11:09 Average standard deviation of split frequencies: 0.000000 140500 -- (-6481.103) [-6481.277] (-6486.147) (-6482.800) * (-6475.932) [-6476.414] (-6484.770) (-6480.724) -- 0:11:06 141000 -- (-6483.435) (-6485.184) [-6485.355] (-6480.869) * [-6484.382] (-6479.697) (-6479.234) (-6482.945) -- 0:11:04 141500 -- (-6481.687) (-6483.100) (-6485.372) [-6479.384] * [-6483.317] (-6484.352) (-6482.682) (-6478.883) -- 0:11:07 142000 -- (-6485.114) [-6477.323] (-6488.518) (-6481.384) * (-6477.198) (-6485.431) (-6485.175) [-6478.133] -- 0:11:04 142500 -- (-6483.370) [-6483.567] (-6479.773) (-6480.920) * (-6483.772) (-6477.197) [-6476.069] (-6478.857) -- 0:11:01 143000 -- (-6480.258) (-6475.640) (-6476.632) [-6484.000] * (-6481.829) [-6482.191] (-6477.028) (-6481.265) -- 0:11:05 143500 -- [-6483.963] (-6478.206) (-6483.455) (-6485.785) * (-6475.776) (-6475.989) [-6481.287] (-6478.500) -- 0:11:02 144000 -- (-6482.951) [-6478.136] (-6477.173) (-6481.534) * (-6483.226) (-6477.024) [-6476.451] (-6484.057) -- 0:11:05 144500 -- [-6476.253] (-6483.169) (-6474.344) (-6485.269) * (-6480.360) [-6475.445] (-6480.745) (-6480.316) -- 0:11:03 145000 -- (-6480.430) [-6476.161] (-6484.196) (-6483.445) * [-6476.871] (-6479.362) (-6479.472) (-6478.025) -- 0:11:00 Average standard deviation of split frequencies: 0.000000 145500 -- (-6479.371) [-6477.952] (-6480.264) (-6486.023) * (-6480.761) (-6479.024) (-6475.978) [-6479.946] -- 0:11:03 146000 -- (-6489.022) (-6480.021) (-6482.635) [-6475.985] * (-6480.343) [-6480.698] (-6482.294) (-6472.965) -- 0:11:00 146500 -- (-6486.065) [-6484.281] (-6480.704) (-6484.560) * (-6484.936) (-6476.616) (-6482.450) [-6476.430] -- 0:11:04 147000 -- (-6484.090) (-6478.010) (-6482.240) [-6484.764] * (-6479.539) (-6483.569) [-6480.092] (-6481.598) -- 0:11:01 147500 -- (-6477.823) [-6478.438] (-6478.263) (-6489.206) * (-6481.792) [-6478.086] (-6481.264) (-6482.272) -- 0:10:58 148000 -- (-6476.532) [-6483.201] (-6476.961) (-6480.553) * (-6485.197) (-6479.911) (-6473.901) [-6485.267] -- 0:11:02 148500 -- [-6481.133] (-6478.815) (-6485.091) (-6480.090) * (-6482.398) (-6484.585) [-6473.040] (-6482.432) -- 0:10:59 149000 -- (-6483.033) [-6482.868] (-6481.703) (-6479.037) * (-6483.932) (-6480.705) (-6482.909) [-6480.282] -- 0:10:56 149500 -- (-6478.856) [-6476.442] (-6480.152) (-6478.569) * [-6475.192] (-6478.802) (-6475.377) (-6482.324) -- 0:10:59 150000 -- (-6482.856) (-6481.365) (-6476.688) [-6481.278] * (-6478.896) [-6479.256] (-6482.557) (-6478.557) -- 0:10:57 Average standard deviation of split frequencies: 0.000000 150500 -- (-6481.299) (-6478.419) (-6485.636) [-6480.020] * [-6473.221] (-6479.392) (-6477.852) (-6476.029) -- 0:11:00 151000 -- (-6482.809) [-6478.375] (-6481.523) (-6477.373) * [-6475.369] (-6494.316) (-6477.688) (-6476.594) -- 0:10:57 151500 -- [-6487.661] (-6484.247) (-6488.373) (-6483.924) * (-6483.397) [-6484.389] (-6485.374) (-6479.363) -- 0:10:55 152000 -- (-6477.873) (-6479.572) (-6477.773) [-6475.642] * (-6478.172) (-6476.701) (-6488.904) [-6482.038] -- 0:10:58 152500 -- [-6476.597] (-6488.020) (-6483.475) (-6477.916) * (-6478.001) [-6481.402] (-6484.453) (-6485.718) -- 0:10:55 153000 -- (-6476.039) (-6488.630) [-6480.248] (-6484.663) * (-6476.369) [-6482.975] (-6484.794) (-6485.300) -- 0:10:58 153500 -- (-6478.875) (-6479.273) (-6473.257) [-6479.023] * [-6478.961] (-6483.977) (-6478.162) (-6485.443) -- 0:10:56 154000 -- (-6492.321) (-6478.511) (-6481.249) [-6480.038] * (-6475.176) (-6482.004) [-6477.447] (-6483.051) -- 0:10:53 154500 -- [-6479.408] (-6476.778) (-6478.292) (-6476.253) * (-6480.180) (-6475.457) [-6482.849] (-6479.965) -- 0:10:56 155000 -- (-6476.860) [-6476.913] (-6479.509) (-6476.190) * (-6479.243) (-6477.755) [-6479.848] (-6480.068) -- 0:10:54 Average standard deviation of split frequencies: 0.000000 155500 -- (-6476.228) (-6479.574) [-6471.954] (-6473.935) * (-6484.164) (-6480.425) [-6473.100] (-6479.814) -- 0:10:51 156000 -- (-6473.056) (-6477.312) [-6478.870] (-6487.141) * (-6481.657) (-6485.879) (-6478.986) [-6477.345] -- 0:10:54 156500 -- (-6486.297) (-6482.113) (-6478.733) [-6479.215] * (-6478.737) (-6474.978) [-6480.211] (-6487.579) -- 0:10:52 157000 -- (-6478.320) (-6480.640) [-6474.068] (-6484.109) * (-6482.348) (-6477.205) (-6482.004) [-6478.715] -- 0:10:55 157500 -- (-6474.468) (-6481.784) [-6474.796] (-6488.817) * (-6483.013) [-6477.198] (-6483.103) (-6480.497) -- 0:10:52 158000 -- [-6477.784] (-6479.783) (-6482.962) (-6489.304) * [-6479.258] (-6482.774) (-6481.298) (-6478.467) -- 0:10:50 158500 -- (-6479.541) [-6477.655] (-6487.782) (-6483.087) * (-6487.522) (-6478.645) (-6481.360) [-6477.926] -- 0:10:53 159000 -- (-6488.193) (-6480.354) (-6482.696) [-6486.414] * (-6482.365) (-6482.890) (-6479.012) [-6478.968] -- 0:10:50 159500 -- (-6477.646) (-6476.118) (-6483.676) [-6475.305] * (-6479.470) (-6478.386) (-6483.290) [-6475.425] -- 0:10:53 160000 -- [-6478.058] (-6477.285) (-6490.136) (-6474.592) * (-6476.671) [-6477.842] (-6484.252) (-6476.472) -- 0:10:51 Average standard deviation of split frequencies: 0.000000 160500 -- [-6483.585] (-6483.304) (-6477.882) (-6484.854) * [-6478.752] (-6482.306) (-6481.765) (-6482.696) -- 0:10:48 161000 -- [-6473.647] (-6477.295) (-6478.156) (-6481.941) * [-6486.141] (-6481.677) (-6485.494) (-6485.337) -- 0:10:51 161500 -- (-6474.906) (-6485.137) [-6482.482] (-6486.436) * (-6482.124) [-6475.104] (-6493.228) (-6476.991) -- 0:10:48 162000 -- (-6484.518) (-6484.133) (-6486.266) [-6476.174] * (-6481.032) (-6489.734) (-6474.234) [-6480.016] -- 0:10:51 162500 -- (-6478.837) (-6477.719) [-6479.554] (-6483.205) * (-6481.072) (-6489.686) [-6480.634] (-6479.305) -- 0:10:49 163000 -- (-6483.093) [-6477.173] (-6475.321) (-6480.885) * (-6483.277) (-6487.235) [-6477.094] (-6476.925) -- 0:10:47 163500 -- (-6484.669) (-6481.097) [-6478.584] (-6480.064) * (-6482.316) (-6479.200) [-6477.781] (-6478.428) -- 0:10:49 164000 -- [-6480.448] (-6479.459) (-6472.531) (-6479.671) * (-6479.373) (-6475.956) (-6479.892) [-6473.372] -- 0:10:47 164500 -- [-6476.901] (-6485.537) (-6475.692) (-6482.785) * [-6479.368] (-6480.405) (-6477.922) (-6481.200) -- 0:10:45 165000 -- (-6476.151) (-6478.892) [-6480.949] (-6485.975) * (-6483.322) [-6480.853] (-6476.277) (-6484.953) -- 0:10:47 Average standard deviation of split frequencies: 0.000000 165500 -- (-6486.594) [-6478.606] (-6481.112) (-6487.068) * (-6476.481) [-6476.380] (-6482.559) (-6481.467) -- 0:10:45 166000 -- (-6478.678) (-6485.392) (-6481.035) [-6474.667] * [-6473.796] (-6483.726) (-6477.428) (-6488.602) -- 0:10:48 166500 -- [-6479.305] (-6478.876) (-6478.651) (-6481.325) * (-6480.740) [-6489.881] (-6478.609) (-6484.953) -- 0:10:45 167000 -- (-6477.390) (-6482.661) [-6482.883] (-6475.513) * (-6478.516) (-6481.784) (-6482.179) [-6480.665] -- 0:10:43 167500 -- (-6481.426) (-6479.620) (-6476.153) [-6481.299] * (-6484.010) [-6481.434] (-6477.255) (-6476.548) -- 0:10:46 168000 -- [-6478.330] (-6479.113) (-6478.737) (-6478.275) * (-6486.656) (-6481.295) (-6483.313) [-6476.466] -- 0:10:43 168500 -- [-6477.803] (-6478.973) (-6481.762) (-6480.159) * (-6480.922) (-6481.166) (-6488.141) [-6475.904] -- 0:10:46 169000 -- (-6479.038) (-6490.062) (-6487.605) [-6481.818] * (-6488.144) (-6479.975) (-6478.384) [-6479.064] -- 0:10:44 169500 -- (-6481.901) (-6481.381) (-6479.575) [-6478.817] * (-6479.046) (-6480.246) [-6477.738] (-6478.659) -- 0:10:41 170000 -- (-6481.928) [-6478.451] (-6477.487) (-6481.497) * (-6479.204) (-6490.974) (-6479.075) [-6480.222] -- 0:10:44 Average standard deviation of split frequencies: 0.000000 170500 -- (-6474.121) [-6483.349] (-6477.423) (-6489.653) * (-6472.489) (-6477.747) [-6475.268] (-6474.839) -- 0:10:42 171000 -- (-6479.368) (-6483.760) [-6476.972] (-6483.682) * (-6477.149) (-6473.870) [-6478.196] (-6472.953) -- 0:10:44 171500 -- (-6482.136) (-6479.447) [-6476.454] (-6486.247) * (-6475.576) (-6479.220) (-6476.962) [-6478.216] -- 0:10:42 172000 -- (-6484.296) (-6479.316) (-6477.205) [-6486.315] * (-6475.432) [-6483.074] (-6478.760) (-6476.677) -- 0:10:40 172500 -- (-6477.574) [-6479.999] (-6473.391) (-6486.715) * (-6483.051) [-6474.788] (-6480.525) (-6485.069) -- 0:10:42 173000 -- [-6478.245] (-6474.847) (-6475.007) (-6478.396) * (-6483.493) (-6479.314) [-6484.550] (-6481.299) -- 0:10:40 173500 -- (-6488.998) [-6478.391] (-6476.437) (-6476.288) * [-6477.570] (-6482.153) (-6481.796) (-6483.976) -- 0:10:38 174000 -- [-6484.989] (-6473.569) (-6481.249) (-6480.845) * [-6481.298] (-6476.976) (-6482.313) (-6480.468) -- 0:10:40 174500 -- (-6473.742) (-6480.747) [-6480.537] (-6481.788) * [-6480.769] (-6480.132) (-6476.974) (-6480.231) -- 0:10:38 175000 -- (-6474.694) [-6482.220] (-6478.193) (-6483.055) * (-6482.033) [-6478.881] (-6478.796) (-6482.829) -- 0:10:41 Average standard deviation of split frequencies: 0.000000 175500 -- (-6479.804) [-6480.948] (-6478.568) (-6481.015) * (-6485.573) (-6485.004) [-6479.939] (-6478.682) -- 0:10:38 176000 -- [-6475.665] (-6482.306) (-6485.668) (-6479.428) * (-6483.149) [-6479.730] (-6481.656) (-6481.006) -- 0:10:36 176500 -- (-6481.702) (-6483.034) [-6480.455] (-6478.093) * (-6478.507) [-6476.618] (-6476.439) (-6494.352) -- 0:10:39 177000 -- (-6481.591) [-6481.630] (-6481.007) (-6476.804) * (-6478.272) [-6476.139] (-6477.915) (-6482.864) -- 0:10:37 177500 -- (-6478.345) (-6484.623) [-6481.290] (-6484.499) * (-6486.745) (-6483.830) (-6482.115) [-6486.045] -- 0:10:34 178000 -- (-6483.188) (-6482.769) [-6478.447] (-6486.613) * (-6477.190) (-6478.952) (-6480.222) [-6478.770] -- 0:10:37 178500 -- (-6478.228) [-6478.750] (-6484.729) (-6480.056) * [-6479.508] (-6478.953) (-6477.354) (-6478.682) -- 0:10:35 179000 -- [-6485.969] (-6477.056) (-6476.815) (-6484.006) * [-6475.492] (-6478.777) (-6481.136) (-6474.874) -- 0:10:37 179500 -- (-6494.651) [-6477.720] (-6479.174) (-6483.070) * (-6480.144) (-6484.064) (-6479.825) [-6477.835] -- 0:10:35 180000 -- (-6478.253) [-6477.319] (-6484.243) (-6493.412) * (-6484.481) (-6484.783) (-6478.365) [-6481.101] -- 0:10:33 Average standard deviation of split frequencies: 0.000000 180500 -- (-6475.851) [-6477.256] (-6474.407) (-6493.452) * (-6478.389) (-6485.949) [-6483.325] (-6490.521) -- 0:10:35 181000 -- [-6474.424] (-6475.558) (-6479.329) (-6486.076) * [-6483.798] (-6475.213) (-6482.717) (-6483.039) -- 0:10:33 181500 -- (-6484.739) (-6476.772) [-6481.854] (-6485.394) * (-6476.031) [-6477.025] (-6480.151) (-6478.334) -- 0:10:35 182000 -- (-6485.595) [-6477.456] (-6479.126) (-6478.465) * (-6476.790) (-6482.573) [-6482.120] (-6486.461) -- 0:10:33 182500 -- (-6483.549) (-6480.045) (-6480.387) [-6475.638] * [-6475.088] (-6483.534) (-6481.441) (-6479.912) -- 0:10:31 183000 -- (-6480.302) (-6477.609) [-6478.667] (-6480.637) * (-6486.397) (-6483.828) [-6479.786] (-6477.651) -- 0:10:33 183500 -- [-6483.690] (-6483.607) (-6478.667) (-6480.697) * (-6483.065) [-6478.724] (-6477.876) (-6481.123) -- 0:10:31 184000 -- [-6477.329] (-6481.771) (-6483.274) (-6478.351) * [-6487.342] (-6482.776) (-6483.503) (-6481.881) -- 0:10:29 184500 -- [-6479.471] (-6478.258) (-6484.109) (-6478.714) * (-6482.216) [-6479.380] (-6485.104) (-6476.786) -- 0:10:32 185000 -- (-6476.816) (-6483.700) (-6491.107) [-6480.267] * [-6477.834] (-6477.681) (-6475.641) (-6476.320) -- 0:10:29 Average standard deviation of split frequencies: 0.000000 185500 -- (-6478.905) (-6485.974) (-6477.240) [-6481.827] * (-6477.325) [-6477.787] (-6487.954) (-6484.429) -- 0:10:32 186000 -- (-6477.069) (-6475.867) [-6486.228] (-6476.040) * [-6480.017] (-6478.233) (-6483.332) (-6481.975) -- 0:10:30 186500 -- (-6481.042) [-6487.096] (-6483.257) (-6477.172) * (-6482.448) (-6474.395) (-6476.467) [-6476.244] -- 0:10:28 187000 -- (-6480.150) [-6483.290] (-6487.816) (-6478.375) * (-6480.772) (-6479.963) [-6482.431] (-6485.046) -- 0:10:30 187500 -- (-6483.034) (-6480.513) [-6479.553] (-6479.801) * (-6479.850) (-6484.352) (-6479.540) [-6478.522] -- 0:10:28 188000 -- (-6484.943) (-6480.203) (-6482.884) [-6477.319] * (-6479.229) (-6480.140) (-6474.359) [-6478.715] -- 0:10:30 188500 -- (-6477.261) (-6477.365) (-6479.884) [-6479.875] * (-6474.998) (-6480.637) (-6490.912) [-6480.194] -- 0:10:28 189000 -- (-6476.652) (-6483.389) [-6478.913] (-6488.966) * (-6480.597) [-6475.702] (-6478.212) (-6480.031) -- 0:10:26 189500 -- (-6483.964) [-6481.052] (-6489.111) (-6480.056) * (-6475.929) (-6485.713) [-6479.352] (-6479.095) -- 0:10:28 190000 -- (-6478.919) (-6475.163) (-6491.436) [-6473.757] * (-6481.110) (-6483.944) (-6476.815) [-6481.441] -- 0:10:26 Average standard deviation of split frequencies: 0.000000 190500 -- (-6480.604) [-6478.910] (-6486.929) (-6484.298) * [-6476.975] (-6488.457) (-6477.588) (-6477.944) -- 0:10:28 191000 -- (-6478.478) (-6485.169) (-6478.156) [-6478.440] * [-6476.580] (-6479.127) (-6476.090) (-6479.389) -- 0:10:26 191500 -- (-6477.913) [-6482.609] (-6479.457) (-6478.592) * (-6480.638) (-6475.891) [-6476.365] (-6477.823) -- 0:10:29 192000 -- [-6477.704] (-6485.120) (-6479.803) (-6477.033) * [-6476.324] (-6477.487) (-6476.858) (-6476.440) -- 0:10:27 192500 -- (-6477.324) (-6474.887) (-6480.160) [-6484.165] * (-6474.970) [-6484.512] (-6474.987) (-6480.942) -- 0:10:29 193000 -- (-6485.227) [-6477.665] (-6485.526) (-6479.693) * [-6482.781] (-6474.363) (-6483.625) (-6473.983) -- 0:10:27 193500 -- [-6475.671] (-6476.739) (-6485.041) (-6480.685) * (-6481.417) (-6484.896) (-6475.828) [-6478.353] -- 0:10:25 194000 -- [-6481.638] (-6482.262) (-6477.287) (-6486.955) * (-6481.897) (-6480.060) (-6483.878) [-6478.423] -- 0:10:27 194500 -- (-6476.469) [-6483.760] (-6479.914) (-6489.589) * (-6482.637) (-6482.194) [-6474.281] (-6479.842) -- 0:10:25 195000 -- [-6483.767] (-6476.229) (-6473.723) (-6479.052) * (-6476.063) (-6484.697) [-6476.879] (-6478.857) -- 0:10:27 Average standard deviation of split frequencies: 0.000000 195500 -- (-6476.860) [-6476.954] (-6484.981) (-6480.615) * (-6478.308) [-6481.395] (-6476.614) (-6480.312) -- 0:10:25 196000 -- (-6479.695) (-6479.218) (-6488.031) [-6479.554] * (-6477.295) (-6479.673) (-6478.264) [-6476.022] -- 0:10:23 196500 -- (-6478.973) [-6473.846] (-6486.293) (-6477.893) * (-6488.877) [-6479.884] (-6479.040) (-6480.731) -- 0:10:25 197000 -- [-6483.365] (-6481.097) (-6480.053) (-6481.669) * (-6478.486) (-6482.117) (-6477.128) [-6482.674] -- 0:10:23 197500 -- [-6475.516] (-6480.552) (-6478.056) (-6490.472) * [-6482.216] (-6481.123) (-6482.122) (-6476.035) -- 0:10:25 198000 -- (-6479.087) (-6476.755) [-6480.729] (-6485.893) * (-6478.253) (-6486.042) [-6477.920] (-6477.984) -- 0:10:23 198500 -- (-6483.192) (-6486.550) [-6478.662] (-6480.936) * (-6479.211) (-6483.796) (-6483.801) [-6476.234] -- 0:10:21 199000 -- (-6475.908) [-6482.015] (-6478.715) (-6473.960) * (-6475.763) (-6484.108) [-6476.379] (-6485.195) -- 0:10:23 199500 -- (-6475.551) [-6476.871] (-6485.653) (-6479.835) * (-6484.985) [-6477.023] (-6479.061) (-6478.081) -- 0:10:21 200000 -- (-6477.513) (-6479.180) (-6479.059) [-6476.607] * (-6481.725) (-6481.062) [-6477.370] (-6478.990) -- 0:10:20 Average standard deviation of split frequencies: 0.000000 200500 -- (-6479.842) (-6480.035) (-6478.136) [-6476.197] * [-6478.505] (-6481.239) (-6481.162) (-6482.272) -- 0:10:22 201000 -- (-6480.258) (-6480.105) [-6482.679] (-6477.091) * (-6474.651) [-6476.750] (-6473.806) (-6484.079) -- 0:10:20 201500 -- (-6484.993) [-6474.071] (-6478.560) (-6481.203) * (-6480.183) [-6473.960] (-6478.772) (-6482.820) -- 0:10:22 202000 -- (-6474.854) [-6481.517] (-6479.976) (-6481.120) * [-6477.383] (-6477.509) (-6487.698) (-6480.044) -- 0:10:20 202500 -- (-6480.023) (-6482.604) (-6487.763) [-6484.167] * (-6474.238) [-6477.377] (-6482.247) (-6480.041) -- 0:10:18 203000 -- [-6476.468] (-6485.524) (-6480.470) (-6480.041) * (-6483.340) [-6482.571] (-6482.061) (-6476.056) -- 0:10:20 203500 -- (-6474.131) (-6476.294) (-6477.663) [-6481.973] * (-6476.828) (-6480.615) [-6478.922] (-6480.933) -- 0:10:18 204000 -- (-6480.875) (-6488.891) [-6485.864] (-6487.587) * (-6483.510) (-6485.474) (-6487.294) [-6481.009] -- 0:10:20 204500 -- (-6476.120) [-6479.614] (-6482.329) (-6483.241) * (-6478.136) [-6477.920] (-6481.698) (-6479.450) -- 0:10:18 205000 -- (-6484.468) (-6477.223) [-6488.527] (-6487.952) * (-6481.389) (-6482.809) (-6474.141) [-6478.042] -- 0:10:16 Average standard deviation of split frequencies: 0.000000 205500 -- (-6478.208) (-6474.471) (-6482.499) [-6480.685] * (-6477.053) (-6500.335) [-6474.649] (-6484.698) -- 0:10:18 206000 -- (-6480.419) [-6481.771] (-6481.873) (-6476.219) * (-6482.899) [-6482.660] (-6476.096) (-6485.024) -- 0:10:16 206500 -- (-6477.014) [-6476.476] (-6480.136) (-6481.958) * (-6482.817) (-6481.096) [-6474.519] (-6481.178) -- 0:10:18 207000 -- (-6485.078) (-6478.726) [-6478.087] (-6487.437) * (-6479.498) (-6487.105) [-6476.919] (-6480.139) -- 0:10:16 207500 -- (-6479.923) (-6478.461) (-6481.549) [-6476.119] * (-6482.606) [-6484.562] (-6482.888) (-6482.085) -- 0:10:18 208000 -- (-6479.041) (-6487.972) (-6482.752) [-6482.576] * [-6480.662] (-6482.152) (-6485.130) (-6478.669) -- 0:10:16 208500 -- (-6482.576) [-6483.030] (-6487.632) (-6486.204) * [-6478.450] (-6486.998) (-6479.359) (-6497.617) -- 0:10:14 209000 -- (-6486.968) (-6485.335) (-6486.892) [-6482.774] * (-6476.560) [-6479.187] (-6486.144) (-6483.572) -- 0:10:16 209500 -- (-6473.486) (-6484.629) (-6479.656) [-6477.739] * (-6476.383) (-6479.625) (-6483.897) [-6484.525] -- 0:10:15 210000 -- (-6478.730) [-6487.041] (-6482.133) (-6480.383) * [-6475.733] (-6473.124) (-6485.188) (-6486.234) -- 0:10:16 Average standard deviation of split frequencies: 0.000000 210500 -- (-6480.462) (-6475.876) [-6480.199] (-6487.055) * (-6474.929) (-6485.708) (-6478.005) [-6480.173] -- 0:10:15 211000 -- [-6477.570] (-6490.203) (-6483.184) (-6480.703) * (-6478.967) [-6477.972] (-6476.341) (-6475.812) -- 0:10:16 211500 -- [-6478.964] (-6487.484) (-6473.774) (-6476.300) * (-6478.976) (-6480.890) [-6472.855] (-6480.510) -- 0:10:15 212000 -- [-6479.640] (-6484.312) (-6481.304) (-6476.198) * [-6483.903] (-6480.473) (-6479.975) (-6482.892) -- 0:10:13 212500 -- (-6482.875) [-6473.253] (-6483.260) (-6478.598) * (-6479.518) (-6485.417) (-6481.957) [-6475.192] -- 0:10:15 213000 -- [-6484.172] (-6474.959) (-6480.378) (-6486.325) * [-6474.351] (-6481.069) (-6478.092) (-6485.534) -- 0:10:13 213500 -- [-6482.116] (-6479.011) (-6483.403) (-6482.995) * (-6477.046) [-6479.501] (-6477.192) (-6485.077) -- 0:10:15 214000 -- (-6490.406) (-6480.916) (-6478.958) [-6479.591] * (-6472.547) [-6479.481] (-6476.888) (-6475.794) -- 0:10:13 214500 -- (-6489.044) (-6485.623) (-6479.193) [-6484.187] * (-6475.064) [-6480.322] (-6475.110) (-6484.676) -- 0:10:15 215000 -- (-6491.243) (-6487.437) (-6486.955) [-6475.427] * [-6477.081] (-6481.539) (-6476.710) (-6479.839) -- 0:10:13 Average standard deviation of split frequencies: 0.000000 215500 -- (-6485.701) (-6482.144) [-6483.396] (-6478.690) * (-6477.970) (-6480.982) [-6479.861] (-6480.919) -- 0:10:15 216000 -- (-6482.067) (-6482.820) [-6477.439] (-6483.897) * [-6481.891] (-6496.161) (-6477.459) (-6480.609) -- 0:10:13 216500 -- (-6477.785) [-6481.101] (-6472.263) (-6482.898) * (-6476.131) [-6475.818] (-6479.594) (-6479.399) -- 0:10:15 217000 -- (-6477.143) [-6478.999] (-6480.743) (-6474.777) * (-6477.538) [-6481.281] (-6476.551) (-6478.910) -- 0:10:13 217500 -- [-6477.726] (-6476.684) (-6476.046) (-6480.179) * (-6484.470) [-6480.787] (-6487.393) (-6474.592) -- 0:10:15 218000 -- (-6481.182) (-6476.948) (-6479.247) [-6484.570] * [-6482.162] (-6480.751) (-6486.630) (-6478.360) -- 0:10:13 218500 -- (-6477.816) [-6475.613] (-6483.427) (-6477.419) * [-6474.239] (-6475.927) (-6481.903) (-6477.091) -- 0:10:15 219000 -- (-6479.497) (-6483.625) (-6482.358) [-6477.308] * [-6482.802] (-6479.743) (-6475.258) (-6478.899) -- 0:10:13 219500 -- (-6482.734) (-6476.431) (-6478.792) [-6484.380] * (-6482.676) [-6482.712] (-6477.497) (-6480.323) -- 0:10:11 220000 -- (-6483.518) (-6475.871) (-6479.765) [-6480.851] * (-6480.409) (-6482.988) (-6485.998) [-6478.601] -- 0:10:13 Average standard deviation of split frequencies: 0.000000 220500 -- (-6475.975) (-6476.766) (-6484.731) [-6477.709] * (-6480.545) (-6485.115) (-6477.589) [-6480.193] -- 0:10:11 221000 -- (-6475.979) [-6478.076] (-6489.041) (-6483.890) * (-6485.250) [-6482.572] (-6478.756) (-6480.350) -- 0:10:13 221500 -- (-6481.798) [-6473.217] (-6485.230) (-6476.981) * (-6481.669) (-6481.947) [-6481.788] (-6481.912) -- 0:10:11 222000 -- (-6477.606) (-6474.906) [-6478.079] (-6476.384) * (-6478.049) [-6478.583] (-6478.073) (-6478.260) -- 0:10:09 222500 -- (-6477.342) [-6479.527] (-6476.186) (-6480.398) * (-6485.565) (-6483.354) (-6481.400) [-6484.218] -- 0:10:11 223000 -- (-6482.518) (-6483.033) (-6484.083) [-6482.047] * (-6473.610) (-6478.059) (-6480.834) [-6480.312] -- 0:10:09 223500 -- (-6477.891) (-6477.013) (-6481.636) [-6475.309] * (-6483.297) (-6475.726) (-6483.231) [-6478.495] -- 0:10:11 224000 -- (-6477.374) (-6477.672) [-6480.750] (-6479.855) * (-6481.381) (-6490.285) (-6479.852) [-6476.816] -- 0:10:09 224500 -- (-6474.474) [-6476.808] (-6477.726) (-6482.261) * (-6484.663) (-6483.420) (-6479.220) [-6476.425] -- 0:10:07 225000 -- [-6482.392] (-6486.027) (-6477.586) (-6486.642) * [-6481.583] (-6481.932) (-6482.310) (-6487.648) -- 0:10:09 Average standard deviation of split frequencies: 0.000000 225500 -- (-6476.238) (-6479.041) (-6479.072) [-6479.799] * (-6479.796) [-6482.245] (-6482.218) (-6480.560) -- 0:10:07 226000 -- (-6487.538) (-6475.592) (-6477.611) [-6480.890] * (-6479.116) (-6481.605) [-6482.736] (-6480.799) -- 0:10:06 226500 -- (-6475.485) [-6483.279] (-6480.376) (-6481.633) * (-6483.201) [-6481.049] (-6473.906) (-6481.774) -- 0:10:07 227000 -- (-6478.191) (-6482.284) [-6477.345] (-6477.229) * (-6477.854) [-6476.240] (-6473.413) (-6477.146) -- 0:10:06 227500 -- (-6484.413) (-6482.456) (-6477.106) [-6480.720] * (-6482.928) [-6476.997] (-6480.172) (-6479.787) -- 0:10:07 228000 -- (-6482.516) (-6480.014) (-6484.301) [-6475.126] * [-6480.035] (-6477.625) (-6475.139) (-6482.348) -- 0:10:06 228500 -- (-6486.408) [-6477.348] (-6479.090) (-6476.269) * [-6476.086] (-6490.952) (-6485.986) (-6484.255) -- 0:10:04 229000 -- (-6482.231) (-6482.349) [-6485.517] (-6479.182) * [-6481.381] (-6478.793) (-6477.830) (-6480.886) -- 0:10:06 229500 -- (-6484.747) (-6487.379) (-6479.288) [-6478.084] * [-6474.439] (-6482.839) (-6481.131) (-6476.644) -- 0:10:04 230000 -- (-6482.453) (-6477.160) [-6478.844] (-6478.537) * (-6479.903) [-6490.877] (-6486.143) (-6477.171) -- 0:10:02 Average standard deviation of split frequencies: 0.000000 230500 -- (-6479.861) (-6478.695) (-6483.179) [-6488.043] * (-6480.154) (-6482.231) (-6476.613) [-6475.928] -- 0:10:04 231000 -- [-6480.615] (-6480.670) (-6481.710) (-6477.602) * (-6479.419) (-6476.519) [-6476.514] (-6475.810) -- 0:10:02 231500 -- (-6480.141) (-6480.750) [-6477.266] (-6485.142) * (-6476.890) [-6481.249] (-6481.852) (-6482.779) -- 0:10:04 232000 -- [-6478.632] (-6482.286) (-6478.161) (-6477.529) * (-6482.846) (-6476.506) [-6487.069] (-6485.550) -- 0:10:02 232500 -- [-6477.214] (-6479.726) (-6477.939) (-6480.774) * (-6475.184) (-6477.835) [-6474.505] (-6480.083) -- 0:10:00 233000 -- [-6480.219] (-6476.908) (-6483.500) (-6477.061) * (-6478.530) [-6475.187] (-6483.846) (-6479.251) -- 0:10:02 233500 -- (-6480.177) (-6477.661) [-6479.092] (-6476.034) * (-6478.092) [-6478.827] (-6485.275) (-6484.115) -- 0:10:00 234000 -- (-6485.641) (-6478.172) [-6477.145] (-6476.563) * (-6480.088) (-6475.808) (-6485.596) [-6474.252] -- 0:09:59 234500 -- (-6477.889) [-6480.443] (-6482.687) (-6480.912) * (-6476.502) (-6477.586) (-6494.325) [-6481.854] -- 0:10:00 235000 -- (-6476.818) [-6472.920] (-6479.921) (-6476.554) * (-6479.110) (-6480.748) [-6476.573] (-6487.210) -- 0:09:58 Average standard deviation of split frequencies: 0.000000 235500 -- (-6478.568) (-6476.347) [-6478.092] (-6480.477) * (-6482.748) [-6483.300] (-6486.541) (-6483.600) -- 0:10:00 236000 -- (-6477.921) (-6483.989) (-6478.674) [-6485.662] * [-6481.488] (-6479.487) (-6481.716) (-6483.301) -- 0:09:58 236500 -- (-6479.598) [-6481.736] (-6480.671) (-6478.022) * (-6484.696) (-6484.054) [-6480.980] (-6476.167) -- 0:09:57 237000 -- (-6478.920) (-6473.298) (-6478.512) [-6476.824] * [-6477.239] (-6482.151) (-6477.624) (-6476.540) -- 0:09:58 237500 -- [-6476.011] (-6484.540) (-6480.750) (-6473.270) * (-6484.225) [-6473.603] (-6480.202) (-6479.026) -- 0:09:57 238000 -- (-6481.211) [-6486.869] (-6474.300) (-6477.040) * (-6481.310) (-6480.987) [-6480.299] (-6477.075) -- 0:09:55 238500 -- (-6483.778) (-6479.478) (-6486.522) [-6479.260] * (-6483.863) (-6486.268) (-6476.113) [-6481.017] -- 0:09:57 239000 -- (-6479.328) (-6482.197) [-6480.716] (-6481.847) * [-6480.489] (-6479.026) (-6478.481) (-6482.548) -- 0:09:55 239500 -- [-6476.549] (-6483.168) (-6479.401) (-6485.953) * [-6480.698] (-6480.921) (-6475.715) (-6481.932) -- 0:09:56 240000 -- (-6478.483) (-6479.638) (-6478.504) [-6486.692] * (-6478.810) (-6490.210) (-6477.402) [-6485.163] -- 0:09:55 Average standard deviation of split frequencies: 0.000000 240500 -- [-6485.890] (-6479.806) (-6480.302) (-6489.263) * (-6477.181) (-6484.945) [-6476.511] (-6484.675) -- 0:09:53 241000 -- (-6480.295) (-6481.293) [-6474.451] (-6480.848) * (-6484.484) (-6483.480) (-6479.736) [-6479.152] -- 0:09:55 241500 -- (-6483.788) [-6475.368] (-6475.578) (-6481.270) * [-6478.079] (-6480.613) (-6480.500) (-6478.275) -- 0:09:53 242000 -- (-6480.768) (-6479.449) (-6480.209) [-6481.958] * (-6477.570) (-6479.357) (-6479.552) [-6482.049] -- 0:09:51 242500 -- (-6489.942) (-6481.098) [-6479.839] (-6479.688) * (-6476.103) (-6475.354) [-6485.164] (-6481.210) -- 0:09:53 243000 -- [-6480.670] (-6478.451) (-6476.306) (-6474.380) * (-6481.742) (-6479.931) (-6478.018) [-6477.006] -- 0:09:51 243500 -- [-6478.169] (-6477.493) (-6477.144) (-6481.148) * (-6480.669) (-6483.753) (-6481.032) [-6477.711] -- 0:09:53 244000 -- (-6493.067) [-6479.459] (-6475.524) (-6480.748) * (-6476.029) [-6477.768] (-6477.493) (-6474.371) -- 0:09:51 244500 -- [-6479.666] (-6479.569) (-6483.968) (-6484.800) * (-6474.613) [-6476.679] (-6481.798) (-6478.291) -- 0:09:50 245000 -- (-6485.058) [-6475.143] (-6481.861) (-6479.422) * (-6481.191) (-6476.020) [-6479.543] (-6482.025) -- 0:09:51 Average standard deviation of split frequencies: 0.000000 245500 -- (-6483.331) (-6474.313) [-6475.863] (-6486.229) * [-6483.712] (-6474.893) (-6478.374) (-6490.710) -- 0:09:50 246000 -- (-6482.964) (-6482.770) (-6476.643) [-6483.494] * (-6485.657) [-6476.807] (-6474.645) (-6482.999) -- 0:09:48 246500 -- [-6478.762] (-6479.947) (-6480.971) (-6479.141) * (-6489.823) (-6482.068) (-6482.379) [-6481.353] -- 0:09:49 247000 -- [-6478.001] (-6473.274) (-6480.890) (-6478.983) * (-6477.844) [-6480.674] (-6480.285) (-6481.482) -- 0:09:48 247500 -- [-6480.358] (-6478.459) (-6480.557) (-6477.285) * (-6478.268) (-6479.902) (-6480.200) [-6477.956] -- 0:09:46 248000 -- (-6477.073) (-6480.484) [-6487.473] (-6480.699) * [-6481.178] (-6482.254) (-6484.997) (-6482.184) -- 0:09:48 248500 -- (-6477.374) (-6479.392) [-6481.752] (-6480.469) * (-6477.193) (-6480.612) [-6477.763] (-6474.612) -- 0:09:46 249000 -- (-6483.045) (-6480.781) (-6481.747) [-6484.977] * (-6473.788) (-6483.227) [-6474.817] (-6482.441) -- 0:09:48 249500 -- (-6476.022) (-6474.581) [-6484.280] (-6482.726) * (-6475.166) (-6483.371) [-6480.493] (-6475.893) -- 0:09:46 250000 -- (-6478.180) [-6482.905] (-6481.398) (-6485.294) * (-6480.336) (-6489.378) [-6476.325] (-6475.112) -- 0:09:45 Average standard deviation of split frequencies: 0.000000 250500 -- [-6481.823] (-6481.469) (-6488.106) (-6479.058) * [-6477.921] (-6486.743) (-6486.914) (-6480.290) -- 0:09:46 251000 -- (-6475.051) (-6479.210) (-6480.992) [-6478.604] * [-6479.296] (-6477.461) (-6482.429) (-6478.735) -- 0:09:44 251500 -- (-6476.444) (-6478.828) (-6484.504) [-6475.651] * [-6478.033] (-6469.998) (-6492.801) (-6482.175) -- 0:09:43 252000 -- (-6490.625) (-6483.420) (-6483.727) [-6477.031] * (-6486.871) [-6479.363] (-6480.759) (-6477.291) -- 0:09:44 252500 -- [-6483.677] (-6479.082) (-6485.410) (-6480.523) * (-6477.271) (-6479.879) (-6483.326) [-6481.144] -- 0:09:43 253000 -- [-6479.431] (-6480.513) (-6485.120) (-6477.502) * (-6479.767) [-6482.535] (-6477.613) (-6478.282) -- 0:09:44 253500 -- [-6485.559] (-6480.036) (-6482.754) (-6475.821) * (-6478.686) (-6479.563) (-6475.626) [-6478.609] -- 0:09:43 254000 -- (-6479.950) (-6484.854) [-6476.782] (-6474.111) * (-6485.503) (-6480.243) [-6476.460] (-6482.384) -- 0:09:41 254500 -- [-6482.465] (-6484.368) (-6481.668) (-6481.018) * [-6476.420] (-6482.409) (-6477.735) (-6479.048) -- 0:09:42 255000 -- (-6487.562) (-6480.844) [-6483.377] (-6486.795) * (-6479.717) (-6480.289) (-6478.938) [-6479.753] -- 0:09:41 Average standard deviation of split frequencies: 0.000000 255500 -- (-6480.774) [-6482.493] (-6485.011) (-6482.296) * (-6475.938) [-6473.812] (-6482.970) (-6479.951) -- 0:09:39 256000 -- [-6478.077] (-6476.734) (-6478.759) (-6486.237) * (-6477.792) (-6484.399) (-6478.575) [-6477.950] -- 0:09:41 256500 -- [-6477.846] (-6481.484) (-6485.086) (-6486.874) * [-6480.666] (-6481.755) (-6478.981) (-6479.471) -- 0:09:39 257000 -- (-6475.888) [-6482.144] (-6476.701) (-6480.329) * [-6477.386] (-6483.437) (-6482.251) (-6481.442) -- 0:09:41 257500 -- (-6481.493) [-6482.386] (-6482.183) (-6475.893) * [-6479.121] (-6486.182) (-6477.904) (-6481.917) -- 0:09:39 258000 -- (-6478.014) (-6485.948) [-6477.245] (-6478.272) * (-6476.962) [-6481.865] (-6479.236) (-6479.176) -- 0:09:40 258500 -- [-6478.164] (-6483.462) (-6479.863) (-6482.363) * (-6479.131) (-6490.350) [-6479.500] (-6478.606) -- 0:09:39 259000 -- [-6474.557] (-6483.888) (-6476.064) (-6480.361) * [-6481.756] (-6482.113) (-6477.706) (-6479.738) -- 0:09:40 259500 -- (-6476.576) [-6477.340] (-6477.549) (-6478.512) * (-6481.794) [-6478.303] (-6482.844) (-6485.089) -- 0:09:39 260000 -- (-6477.542) [-6480.600] (-6483.701) (-6479.344) * (-6479.712) [-6476.276] (-6489.355) (-6484.904) -- 0:09:37 Average standard deviation of split frequencies: 0.000000 260500 -- (-6477.762) (-6482.625) [-6477.686] (-6476.620) * [-6480.370] (-6475.064) (-6481.782) (-6487.148) -- 0:09:39 261000 -- [-6479.741] (-6474.367) (-6480.475) (-6481.505) * (-6477.316) (-6475.756) (-6478.321) [-6476.985] -- 0:09:37 261500 -- (-6481.088) [-6478.729] (-6478.730) (-6477.710) * (-6484.999) (-6481.540) (-6477.626) [-6476.256] -- 0:09:38 262000 -- [-6477.641] (-6475.012) (-6485.130) (-6481.510) * (-6482.182) (-6478.351) [-6481.280] (-6477.465) -- 0:09:37 262500 -- (-6478.118) [-6480.109] (-6472.616) (-6476.731) * [-6480.828] (-6482.354) (-6481.027) (-6475.561) -- 0:09:38 263000 -- (-6476.127) [-6480.257] (-6473.932) (-6482.802) * [-6484.925] (-6480.761) (-6477.817) (-6483.604) -- 0:09:37 263500 -- [-6476.415] (-6479.811) (-6472.497) (-6488.591) * (-6477.690) (-6482.163) (-6482.327) [-6480.624] -- 0:09:35 264000 -- (-6477.021) (-6476.077) (-6481.739) [-6479.754] * (-6479.692) (-6480.470) (-6484.917) [-6474.678] -- 0:09:37 264500 -- [-6478.042] (-6475.691) (-6478.440) (-6482.530) * (-6475.532) (-6481.057) (-6480.031) [-6476.398] -- 0:09:35 265000 -- (-6476.478) (-6480.586) (-6479.260) [-6479.583] * [-6480.397] (-6476.099) (-6481.802) (-6481.803) -- 0:09:36 Average standard deviation of split frequencies: 0.000000 265500 -- (-6477.902) [-6479.660] (-6483.491) (-6476.486) * [-6484.002] (-6481.406) (-6485.635) (-6475.681) -- 0:09:35 266000 -- [-6477.455] (-6474.650) (-6484.567) (-6477.808) * (-6483.826) (-6475.994) (-6487.605) [-6485.422] -- 0:09:33 266500 -- (-6484.540) (-6482.526) [-6484.150] (-6487.435) * (-6486.433) (-6484.483) (-6481.471) [-6477.805] -- 0:09:35 267000 -- (-6482.896) (-6471.860) [-6489.602] (-6478.319) * [-6487.033] (-6474.096) (-6479.982) (-6474.177) -- 0:09:33 267500 -- (-6476.174) (-6478.662) [-6477.744] (-6485.247) * [-6483.284] (-6477.078) (-6478.596) (-6485.689) -- 0:09:32 268000 -- (-6478.990) [-6483.362] (-6478.865) (-6487.596) * [-6476.621] (-6491.763) (-6480.549) (-6486.021) -- 0:09:33 268500 -- (-6478.231) [-6477.973] (-6480.136) (-6483.392) * [-6478.448] (-6477.329) (-6476.208) (-6475.184) -- 0:09:32 269000 -- (-6475.354) [-6479.107] (-6476.910) (-6475.910) * [-6480.398] (-6484.188) (-6479.518) (-6484.324) -- 0:09:33 269500 -- (-6483.100) (-6478.941) [-6476.783] (-6475.095) * (-6490.724) [-6477.000] (-6478.943) (-6473.712) -- 0:09:31 270000 -- [-6475.564] (-6480.953) (-6489.147) (-6482.384) * [-6482.373] (-6482.637) (-6484.528) (-6482.236) -- 0:09:30 Average standard deviation of split frequencies: 0.000000 270500 -- (-6477.652) (-6476.841) [-6477.622] (-6475.987) * (-6476.709) (-6477.886) (-6486.388) [-6475.254] -- 0:09:31 271000 -- (-6479.798) (-6477.625) (-6482.282) [-6478.914] * [-6473.179] (-6481.657) (-6482.309) (-6481.817) -- 0:09:30 271500 -- (-6479.460) (-6484.291) (-6482.661) [-6481.490] * [-6481.336] (-6481.938) (-6480.847) (-6476.839) -- 0:09:28 272000 -- (-6478.073) (-6479.153) [-6482.310] (-6478.970) * (-6478.468) (-6480.474) (-6480.404) [-6477.823] -- 0:09:30 272500 -- (-6478.103) (-6474.874) (-6486.591) [-6475.933] * (-6482.287) (-6478.333) [-6480.482] (-6478.415) -- 0:09:28 273000 -- (-6480.960) (-6481.278) [-6478.968] (-6474.040) * [-6478.371] (-6479.678) (-6477.614) (-6479.583) -- 0:09:29 273500 -- [-6476.492] (-6480.377) (-6480.549) (-6477.887) * (-6493.137) (-6477.860) [-6479.305] (-6480.966) -- 0:09:28 274000 -- (-6485.225) [-6478.294] (-6483.460) (-6480.046) * (-6487.705) [-6480.158] (-6476.818) (-6482.016) -- 0:09:27 274500 -- (-6482.596) (-6476.380) (-6479.146) [-6473.493] * (-6480.736) (-6475.843) (-6477.059) [-6487.013] -- 0:09:28 275000 -- (-6484.507) [-6478.733] (-6481.736) (-6489.903) * (-6477.947) (-6485.775) (-6479.927) [-6479.046] -- 0:09:26 Average standard deviation of split frequencies: 0.000000 275500 -- (-6482.061) [-6479.674] (-6479.142) (-6481.505) * (-6477.690) (-6478.738) [-6479.671] (-6482.569) -- 0:09:25 276000 -- (-6490.227) [-6479.192] (-6479.871) (-6484.978) * (-6482.898) (-6478.248) [-6479.959] (-6482.642) -- 0:09:26 276500 -- [-6483.522] (-6477.457) (-6479.585) (-6482.951) * (-6484.756) (-6480.095) (-6480.431) [-6487.055] -- 0:09:25 277000 -- (-6482.505) [-6477.984] (-6477.084) (-6489.025) * [-6479.749] (-6477.648) (-6484.622) (-6486.113) -- 0:09:26 277500 -- (-6480.609) (-6485.501) (-6478.724) [-6482.676] * (-6483.327) [-6475.366] (-6481.116) (-6488.896) -- 0:09:24 278000 -- (-6482.884) [-6480.212] (-6481.751) (-6479.605) * [-6475.142] (-6480.315) (-6480.548) (-6485.274) -- 0:09:23 278500 -- (-6486.930) [-6479.240] (-6477.652) (-6494.056) * [-6480.060] (-6478.806) (-6484.611) (-6491.462) -- 0:09:24 279000 -- (-6479.664) [-6475.779] (-6484.938) (-6479.759) * (-6486.522) [-6477.320] (-6486.137) (-6482.726) -- 0:09:23 279500 -- (-6481.677) (-6483.356) (-6475.783) [-6479.411] * (-6489.403) (-6479.472) (-6478.216) [-6475.251] -- 0:09:21 280000 -- (-6481.344) [-6473.878] (-6477.425) (-6475.455) * (-6476.637) (-6477.394) [-6478.456] (-6473.898) -- 0:09:23 Average standard deviation of split frequencies: 0.000000 280500 -- (-6483.243) (-6476.333) (-6480.482) [-6479.578] * (-6479.897) [-6479.811] (-6485.919) (-6477.684) -- 0:09:21 281000 -- (-6489.261) (-6477.823) (-6476.508) [-6483.105] * [-6475.303] (-6476.051) (-6477.357) (-6480.377) -- 0:09:22 281500 -- (-6477.977) (-6473.964) (-6479.481) [-6477.588] * (-6477.540) (-6483.541) (-6478.071) [-6478.381] -- 0:09:21 282000 -- (-6478.737) (-6479.286) [-6477.476] (-6478.733) * [-6475.840] (-6479.744) (-6475.905) (-6473.629) -- 0:09:20 282500 -- (-6488.360) (-6474.614) (-6486.668) [-6480.770] * (-6483.927) (-6479.423) [-6472.196] (-6481.017) -- 0:09:21 283000 -- (-6483.309) (-6479.186) (-6480.258) [-6479.802] * (-6482.344) [-6476.556] (-6477.323) (-6482.114) -- 0:09:19 283500 -- (-6481.388) (-6478.985) [-6480.594] (-6481.942) * (-6488.446) (-6483.413) [-6478.420] (-6476.227) -- 0:09:21 284000 -- (-6491.859) (-6478.280) [-6475.557] (-6480.523) * [-6478.284] (-6479.800) (-6485.486) (-6483.267) -- 0:09:19 284500 -- (-6479.087) (-6481.316) [-6481.122] (-6484.781) * (-6483.186) (-6474.549) (-6486.156) [-6478.899] -- 0:09:18 285000 -- (-6479.890) (-6497.297) [-6490.152] (-6478.368) * (-6481.426) (-6481.734) [-6479.964] (-6480.491) -- 0:09:19 Average standard deviation of split frequencies: 0.000000 285500 -- (-6481.744) [-6482.038] (-6477.518) (-6482.521) * (-6480.876) (-6488.393) [-6485.801] (-6482.000) -- 0:09:18 286000 -- (-6489.048) [-6482.279] (-6480.219) (-6481.507) * (-6481.133) (-6482.857) [-6479.125] (-6477.268) -- 0:09:16 286500 -- (-6477.304) (-6478.337) (-6484.605) [-6475.912] * (-6480.386) (-6486.793) (-6483.685) [-6476.185] -- 0:09:17 287000 -- (-6482.649) (-6481.765) [-6483.215] (-6480.532) * [-6475.961] (-6482.620) (-6480.942) (-6484.592) -- 0:09:16 287500 -- [-6475.041] (-6485.298) (-6477.750) (-6482.462) * [-6477.656] (-6482.007) (-6485.498) (-6484.585) -- 0:09:17 288000 -- (-6480.681) (-6478.072) [-6479.636] (-6483.935) * (-6483.912) (-6484.820) [-6475.214] (-6484.010) -- 0:09:16 288500 -- [-6473.542] (-6481.325) (-6480.413) (-6482.294) * (-6478.746) (-6477.160) [-6483.152] (-6472.833) -- 0:09:14 289000 -- (-6484.090) (-6476.535) (-6483.157) [-6481.467] * (-6478.318) (-6485.224) (-6477.686) [-6479.260] -- 0:09:16 289500 -- (-6473.970) (-6477.968) [-6486.090] (-6487.226) * (-6479.566) [-6478.056] (-6477.969) (-6478.916) -- 0:09:14 290000 -- (-6477.324) [-6476.790] (-6477.500) (-6481.654) * (-6481.117) [-6483.109] (-6478.172) (-6474.626) -- 0:09:15 Average standard deviation of split frequencies: 0.000000 290500 -- (-6476.281) (-6475.401) (-6482.506) [-6481.971] * (-6483.876) (-6479.362) (-6478.177) [-6476.915] -- 0:09:14 291000 -- [-6479.972] (-6476.217) (-6478.122) (-6480.046) * (-6482.865) (-6476.897) (-6478.417) [-6484.153] -- 0:09:13 291500 -- (-6474.994) [-6479.293] (-6474.877) (-6483.092) * (-6481.007) (-6483.934) (-6484.662) [-6474.387] -- 0:09:14 292000 -- [-6476.670] (-6482.206) (-6480.908) (-6476.313) * (-6475.798) (-6485.695) [-6475.509] (-6473.949) -- 0:09:12 292500 -- (-6489.748) (-6480.519) [-6476.863] (-6479.837) * (-6479.149) (-6481.434) [-6479.700] (-6484.801) -- 0:09:13 293000 -- [-6483.023] (-6473.648) (-6479.245) (-6490.819) * (-6483.697) (-6484.168) [-6483.749] (-6488.460) -- 0:09:12 293500 -- [-6478.468] (-6487.638) (-6475.301) (-6483.394) * (-6483.539) [-6483.466] (-6478.827) (-6477.494) -- 0:09:11 294000 -- (-6482.934) (-6479.054) (-6479.836) [-6479.123] * (-6477.027) (-6479.563) (-6482.326) [-6477.656] -- 0:09:12 294500 -- (-6480.794) [-6480.123] (-6482.673) (-6478.951) * [-6481.392] (-6482.667) (-6478.494) (-6476.984) -- 0:09:10 295000 -- (-6473.066) [-6481.079] (-6483.311) (-6476.733) * (-6477.273) (-6481.784) (-6475.388) [-6480.845] -- 0:09:12 Average standard deviation of split frequencies: 0.000000 295500 -- (-6484.546) (-6490.619) (-6493.499) [-6478.249] * (-6483.227) (-6479.872) (-6482.417) [-6481.308] -- 0:09:10 296000 -- [-6476.348] (-6479.070) (-6474.882) (-6480.997) * (-6479.919) (-6478.237) [-6480.285] (-6478.506) -- 0:09:09 296500 -- [-6472.834] (-6481.493) (-6472.427) (-6480.270) * (-6476.054) (-6483.050) (-6481.805) [-6478.936] -- 0:09:10 297000 -- (-6475.393) (-6478.534) (-6479.088) [-6475.374] * [-6476.149] (-6481.952) (-6476.080) (-6473.270) -- 0:09:09 297500 -- [-6476.810] (-6474.387) (-6479.256) (-6473.438) * (-6484.185) (-6484.863) [-6478.715] (-6475.530) -- 0:09:10 298000 -- (-6475.536) [-6483.815] (-6482.241) (-6480.675) * (-6484.732) (-6476.109) [-6474.711] (-6475.833) -- 0:09:08 298500 -- (-6475.935) [-6478.079] (-6481.110) (-6484.749) * (-6492.328) [-6485.792] (-6473.838) (-6477.957) -- 0:09:07 299000 -- [-6474.360] (-6479.556) (-6482.224) (-6478.688) * (-6489.855) (-6483.466) [-6475.600] (-6479.691) -- 0:09:08 299500 -- [-6475.326] (-6483.946) (-6480.909) (-6485.277) * [-6482.424] (-6483.817) (-6486.301) (-6476.869) -- 0:09:07 300000 -- [-6476.011] (-6488.719) (-6477.815) (-6477.642) * (-6477.078) [-6482.580] (-6487.923) (-6476.715) -- 0:09:06 Average standard deviation of split frequencies: 0.000000 300500 -- (-6486.753) [-6478.327] (-6483.213) (-6476.929) * (-6483.117) [-6480.925] (-6482.829) (-6474.959) -- 0:09:07 301000 -- (-6484.539) (-6479.433) [-6482.682] (-6479.043) * [-6478.663] (-6485.363) (-6481.560) (-6483.852) -- 0:09:05 301500 -- [-6481.173] (-6478.650) (-6486.814) (-6485.920) * (-6475.453) [-6479.799] (-6483.069) (-6485.234) -- 0:09:06 302000 -- (-6485.565) [-6475.197] (-6475.890) (-6480.191) * [-6475.574] (-6480.871) (-6478.676) (-6485.762) -- 0:09:05 302500 -- (-6479.460) (-6481.346) [-6478.463] (-6488.644) * (-6475.786) (-6479.587) [-6476.440] (-6480.416) -- 0:09:04 303000 -- (-6486.619) (-6479.705) (-6481.188) [-6478.081] * [-6478.521] (-6482.454) (-6475.571) (-6482.989) -- 0:09:05 303500 -- [-6479.182] (-6481.350) (-6483.622) (-6481.157) * (-6480.026) (-6477.523) [-6480.980] (-6492.256) -- 0:09:03 304000 -- (-6478.923) (-6476.677) [-6474.277] (-6482.544) * (-6483.220) (-6482.716) (-6480.971) [-6484.769] -- 0:09:04 304500 -- (-6485.610) (-6480.861) [-6475.359] (-6490.402) * (-6479.838) (-6476.278) (-6481.297) [-6476.973] -- 0:09:03 305000 -- [-6480.413] (-6478.783) (-6481.270) (-6476.129) * [-6475.690] (-6480.143) (-6476.261) (-6476.128) -- 0:09:02 Average standard deviation of split frequencies: 0.000000 305500 -- (-6486.539) (-6478.397) [-6475.721] (-6483.528) * (-6475.558) [-6477.962] (-6476.689) (-6481.989) -- 0:09:03 306000 -- (-6479.499) (-6483.317) (-6473.026) [-6481.133] * (-6479.937) [-6477.440] (-6479.802) (-6482.880) -- 0:09:02 306500 -- [-6482.190] (-6481.535) (-6482.393) (-6484.666) * (-6479.186) (-6476.430) (-6480.956) [-6474.449] -- 0:09:00 307000 -- [-6478.869] (-6481.134) (-6478.741) (-6484.844) * [-6482.374] (-6479.873) (-6479.266) (-6479.313) -- 0:09:01 307500 -- (-6480.236) [-6478.204] (-6473.494) (-6478.513) * (-6478.795) (-6485.006) (-6488.816) [-6477.607] -- 0:09:00 308000 -- (-6484.706) (-6473.311) [-6479.291] (-6477.619) * (-6483.308) (-6487.774) [-6477.543] (-6486.516) -- 0:09:01 308500 -- (-6475.930) (-6475.889) [-6477.244] (-6476.424) * (-6478.519) (-6480.141) (-6482.043) [-6476.269] -- 0:09:00 309000 -- (-6484.148) (-6475.028) [-6477.272] (-6485.612) * [-6486.156] (-6479.689) (-6481.536) (-6482.419) -- 0:08:58 309500 -- (-6483.461) (-6493.668) (-6480.289) [-6475.947] * (-6481.795) (-6475.389) [-6479.503] (-6479.816) -- 0:08:59 310000 -- (-6477.175) (-6487.145) (-6484.407) [-6480.371] * (-6478.269) (-6476.833) (-6480.520) [-6479.007] -- 0:08:58 Average standard deviation of split frequencies: 0.000000 310500 -- [-6477.453] (-6483.516) (-6482.418) (-6479.257) * (-6478.636) (-6475.500) [-6479.777] (-6480.736) -- 0:08:59 311000 -- [-6476.959] (-6480.233) (-6490.217) (-6488.131) * (-6480.745) [-6476.265] (-6478.252) (-6476.636) -- 0:08:58 311500 -- (-6479.140) (-6487.483) (-6496.018) [-6477.938] * (-6487.429) (-6481.013) [-6478.713] (-6478.587) -- 0:08:57 312000 -- (-6476.553) (-6486.180) (-6481.196) [-6480.407] * (-6482.679) (-6479.323) (-6471.219) [-6479.530] -- 0:08:58 312500 -- [-6477.473] (-6479.766) (-6481.838) (-6484.363) * (-6483.204) (-6477.879) [-6481.902] (-6477.037) -- 0:08:56 313000 -- [-6484.651] (-6481.537) (-6488.095) (-6477.847) * (-6478.230) (-6486.118) (-6483.860) [-6476.064] -- 0:08:57 313500 -- (-6481.985) (-6483.644) [-6482.052] (-6475.220) * (-6475.192) (-6479.443) (-6483.307) [-6479.059] -- 0:08:56 314000 -- (-6479.290) [-6482.128] (-6484.636) (-6476.749) * [-6478.408] (-6480.621) (-6478.787) (-6480.671) -- 0:08:55 314500 -- (-6475.063) [-6472.805] (-6483.644) (-6478.047) * (-6483.193) [-6478.577] (-6479.784) (-6480.353) -- 0:08:56 315000 -- (-6481.476) [-6477.395] (-6477.125) (-6484.160) * (-6481.320) [-6482.487] (-6484.644) (-6477.662) -- 0:08:54 Average standard deviation of split frequencies: 0.000000 315500 -- (-6478.938) [-6476.355] (-6485.760) (-6478.710) * (-6491.543) [-6479.665] (-6479.262) (-6479.084) -- 0:08:53 316000 -- (-6479.400) [-6478.831] (-6481.900) (-6476.942) * (-6483.755) (-6477.460) (-6479.048) [-6489.485] -- 0:08:54 316500 -- [-6480.882] (-6476.457) (-6477.639) (-6481.495) * (-6480.055) (-6476.245) (-6482.348) [-6476.317] -- 0:08:53 317000 -- (-6477.210) (-6476.299) [-6480.469] (-6477.357) * (-6484.288) (-6474.457) [-6478.828] (-6480.050) -- 0:08:54 317500 -- (-6474.512) (-6477.789) (-6480.491) [-6476.705] * [-6474.598] (-6476.724) (-6476.738) (-6480.924) -- 0:08:53 318000 -- (-6480.656) [-6479.515] (-6476.759) (-6474.112) * [-6478.359] (-6484.220) (-6480.903) (-6476.590) -- 0:08:51 318500 -- (-6475.013) [-6484.480] (-6479.806) (-6481.496) * (-6474.260) (-6473.958) (-6480.132) [-6482.471] -- 0:08:52 319000 -- [-6477.759] (-6481.405) (-6482.435) (-6481.364) * (-6480.689) (-6475.876) [-6480.940] (-6484.263) -- 0:08:51 319500 -- [-6483.900] (-6485.498) (-6476.139) (-6484.305) * (-6481.946) (-6480.173) (-6477.250) [-6480.746] -- 0:08:52 320000 -- (-6494.727) (-6479.440) [-6475.997] (-6477.060) * (-6479.188) (-6480.724) [-6476.597] (-6487.967) -- 0:08:51 Average standard deviation of split frequencies: 0.000000 320500 -- (-6485.941) (-6487.056) [-6478.506] (-6476.517) * (-6479.603) (-6491.422) [-6474.109] (-6480.271) -- 0:08:50 321000 -- (-6491.124) (-6476.868) [-6483.175] (-6479.130) * [-6480.339] (-6474.145) (-6479.154) (-6483.618) -- 0:08:50 321500 -- (-6483.740) (-6485.277) (-6475.650) [-6474.549] * [-6480.558] (-6477.303) (-6482.958) (-6488.237) -- 0:08:49 322000 -- [-6479.580] (-6480.136) (-6482.216) (-6480.425) * (-6481.079) (-6482.386) [-6477.429] (-6483.473) -- 0:08:50 322500 -- (-6484.157) (-6479.483) (-6477.261) [-6478.276] * [-6487.049] (-6482.868) (-6475.757) (-6489.747) -- 0:08:49 323000 -- (-6481.341) (-6483.944) [-6474.672] (-6480.549) * [-6483.418] (-6481.316) (-6477.262) (-6485.823) -- 0:08:48 323500 -- [-6477.944] (-6483.172) (-6478.585) (-6480.430) * (-6480.185) (-6487.150) (-6479.651) [-6482.160] -- 0:08:49 324000 -- (-6486.389) (-6482.878) [-6477.044] (-6480.579) * [-6473.657] (-6492.660) (-6478.116) (-6478.502) -- 0:08:47 324500 -- [-6482.580] (-6479.480) (-6483.090) (-6481.880) * [-6478.511] (-6493.744) (-6480.299) (-6485.313) -- 0:08:46 325000 -- [-6477.776] (-6475.674) (-6485.336) (-6476.119) * (-6478.913) (-6489.373) [-6478.098] (-6475.765) -- 0:08:47 Average standard deviation of split frequencies: 0.000000 325500 -- [-6473.924] (-6477.657) (-6488.043) (-6478.123) * (-6486.073) (-6493.929) (-6478.690) [-6483.032] -- 0:08:46 326000 -- [-6478.789] (-6482.923) (-6487.685) (-6483.779) * (-6479.389) (-6478.382) (-6474.149) [-6473.869] -- 0:08:47 326500 -- (-6485.965) [-6486.869] (-6480.662) (-6479.140) * (-6482.354) [-6481.043] (-6476.245) (-6481.280) -- 0:08:46 327000 -- (-6484.456) (-6482.405) (-6475.235) [-6485.526] * (-6479.646) [-6475.783] (-6474.679) (-6474.908) -- 0:08:44 327500 -- (-6490.866) (-6480.742) (-6479.127) [-6484.239] * [-6480.177] (-6479.402) (-6477.798) (-6477.508) -- 0:08:45 328000 -- (-6475.358) (-6482.382) [-6474.898] (-6487.341) * [-6487.933] (-6477.658) (-6486.183) (-6481.209) -- 0:08:44 328500 -- [-6482.049] (-6474.092) (-6481.902) (-6485.012) * (-6485.237) [-6476.002] (-6481.835) (-6481.360) -- 0:08:43 329000 -- (-6476.229) [-6477.093] (-6475.961) (-6480.200) * (-6480.189) (-6480.809) (-6492.973) [-6475.584] -- 0:08:44 329500 -- (-6476.878) (-6478.103) (-6482.872) [-6476.851] * (-6483.324) (-6476.330) (-6487.817) [-6477.326] -- 0:08:42 330000 -- (-6476.933) (-6485.568) [-6477.849] (-6484.616) * (-6481.535) (-6476.044) [-6480.297] (-6485.145) -- 0:08:43 Average standard deviation of split frequencies: 0.000000 330500 -- [-6480.619] (-6479.110) (-6478.892) (-6485.798) * [-6481.429] (-6481.969) (-6477.809) (-6481.941) -- 0:08:42 331000 -- (-6488.596) (-6482.894) [-6478.011] (-6491.909) * [-6481.672] (-6482.180) (-6486.937) (-6479.787) -- 0:08:41 331500 -- (-6483.388) (-6485.728) [-6476.150] (-6483.074) * (-6473.636) [-6476.320] (-6481.336) (-6481.978) -- 0:08:42 332000 -- [-6473.978] (-6494.571) (-6481.348) (-6478.139) * (-6485.326) (-6483.038) [-6477.132] (-6479.614) -- 0:08:41 332500 -- (-6484.561) [-6475.164] (-6480.108) (-6483.001) * [-6476.409] (-6479.444) (-6477.420) (-6482.172) -- 0:08:41 333000 -- (-6484.271) (-6482.746) (-6478.293) [-6479.177] * (-6475.742) (-6480.393) (-6477.587) [-6474.359] -- 0:08:40 333500 -- [-6487.061] (-6479.870) (-6490.160) (-6475.492) * (-6484.306) (-6483.234) (-6479.465) [-6478.694] -- 0:08:39 334000 -- (-6492.111) (-6486.643) (-6481.185) [-6494.694] * (-6488.084) (-6478.027) (-6491.100) [-6477.129] -- 0:08:40 334500 -- (-6474.891) [-6482.103] (-6480.771) (-6485.808) * (-6483.714) (-6475.023) (-6484.259) [-6480.970] -- 0:08:39 335000 -- [-6473.411] (-6480.560) (-6478.858) (-6482.374) * [-6476.928] (-6489.643) (-6482.244) (-6476.910) -- 0:08:38 Average standard deviation of split frequencies: 0.000000 335500 -- (-6474.553) [-6480.554] (-6482.372) (-6478.919) * (-6475.208) [-6488.625] (-6478.892) (-6479.356) -- 0:08:38 336000 -- (-6480.306) (-6482.648) [-6485.087] (-6474.928) * (-6481.796) (-6490.298) (-6488.571) [-6483.619] -- 0:08:37 336500 -- (-6484.053) (-6476.599) (-6486.377) [-6475.023] * (-6487.311) (-6482.585) (-6480.690) [-6478.130] -- 0:08:38 337000 -- (-6480.729) [-6481.858] (-6482.819) (-6479.924) * (-6477.294) [-6481.695] (-6475.984) (-6480.450) -- 0:08:37 337500 -- (-6483.481) (-6493.116) (-6480.424) [-6481.115] * [-6479.042] (-6481.391) (-6478.860) (-6485.849) -- 0:08:36 338000 -- [-6484.166] (-6481.050) (-6476.370) (-6476.707) * (-6473.517) [-6480.287] (-6481.247) (-6478.438) -- 0:08:37 338500 -- (-6476.475) (-6479.720) (-6483.130) [-6481.281] * (-6479.063) [-6485.910] (-6480.998) (-6488.500) -- 0:08:35 339000 -- [-6473.836] (-6483.840) (-6490.078) (-6484.928) * (-6483.020) (-6481.020) (-6476.949) [-6477.105] -- 0:08:34 339500 -- (-6475.900) (-6476.771) [-6477.351] (-6474.490) * (-6476.694) (-6477.948) (-6476.015) [-6475.408] -- 0:08:35 340000 -- (-6481.354) [-6474.200] (-6474.303) (-6471.779) * (-6484.358) (-6479.619) (-6476.371) [-6478.382] -- 0:08:34 Average standard deviation of split frequencies: 0.000000 340500 -- (-6483.684) (-6477.716) [-6478.043] (-6479.050) * (-6491.642) (-6485.273) (-6477.474) [-6485.362] -- 0:08:35 341000 -- (-6477.082) (-6476.735) (-6481.756) [-6479.735] * (-6481.391) (-6480.088) (-6480.030) [-6478.890] -- 0:08:34 341500 -- [-6480.636] (-6481.368) (-6483.685) (-6483.349) * (-6482.904) [-6478.367] (-6476.536) (-6478.218) -- 0:08:32 342000 -- (-6479.124) (-6477.061) (-6481.166) [-6479.866] * (-6483.652) (-6475.547) [-6480.398] (-6478.471) -- 0:08:33 342500 -- (-6479.632) [-6478.264] (-6477.997) (-6485.186) * (-6481.225) (-6477.970) (-6490.201) [-6476.904] -- 0:08:32 343000 -- [-6481.664] (-6477.463) (-6482.325) (-6487.777) * (-6480.354) (-6479.469) [-6476.722] (-6486.210) -- 0:08:33 343500 -- (-6475.543) [-6481.690] (-6489.220) (-6474.974) * (-6482.046) (-6479.949) (-6477.872) [-6481.288] -- 0:08:32 344000 -- (-6486.710) (-6480.240) [-6486.058] (-6485.377) * (-6480.325) [-6476.961] (-6479.217) (-6483.417) -- 0:08:31 344500 -- (-6476.095) [-6478.141] (-6475.838) (-6486.317) * [-6476.227] (-6479.229) (-6479.930) (-6478.173) -- 0:08:31 345000 -- (-6479.867) (-6483.072) [-6485.453] (-6477.727) * [-6487.468] (-6477.865) (-6479.779) (-6487.582) -- 0:08:30 Average standard deviation of split frequencies: 0.000000 345500 -- (-6484.677) (-6480.245) [-6480.346] (-6490.600) * (-6477.065) (-6480.389) (-6477.305) [-6479.808] -- 0:08:31 346000 -- (-6477.199) [-6476.022] (-6486.431) (-6484.241) * [-6481.250] (-6476.421) (-6476.099) (-6477.705) -- 0:08:30 346500 -- [-6478.963] (-6478.011) (-6489.509) (-6490.184) * (-6482.175) (-6475.068) [-6478.158] (-6474.096) -- 0:08:29 347000 -- (-6488.889) (-6486.823) [-6481.132] (-6477.031) * [-6474.167] (-6476.274) (-6478.175) (-6480.207) -- 0:08:29 347500 -- (-6473.544) (-6483.331) (-6477.451) [-6477.449] * (-6479.581) (-6482.908) (-6482.847) [-6480.924] -- 0:08:28 348000 -- (-6478.933) (-6499.900) (-6478.075) [-6479.467] * (-6484.226) [-6476.451] (-6485.294) (-6477.704) -- 0:08:27 348500 -- (-6482.548) (-6480.004) (-6482.153) [-6475.402] * (-6487.419) (-6483.334) (-6480.361) [-6480.286] -- 0:08:28 349000 -- (-6481.780) (-6491.732) [-6481.057] (-6477.246) * (-6484.284) (-6487.354) [-6480.948] (-6476.700) -- 0:08:27 349500 -- (-6484.578) (-6474.086) [-6484.275] (-6479.317) * (-6476.255) [-6483.822] (-6480.271) (-6481.993) -- 0:08:28 350000 -- [-6476.158] (-6479.094) (-6476.396) (-6481.899) * (-6485.912) [-6476.540] (-6476.769) (-6479.336) -- 0:08:27 Average standard deviation of split frequencies: 0.000000 350500 -- (-6479.644) [-6477.644] (-6476.909) (-6482.433) * (-6484.523) (-6483.602) (-6485.384) [-6476.243] -- 0:08:25 351000 -- (-6476.426) (-6476.344) (-6482.803) [-6476.099] * (-6479.249) (-6476.688) [-6478.176] (-6482.169) -- 0:08:26 351500 -- (-6489.685) (-6475.978) [-6476.937] (-6480.381) * [-6479.911] (-6485.880) (-6474.519) (-6488.237) -- 0:08:25 352000 -- (-6479.483) [-6479.732] (-6479.255) (-6479.134) * (-6483.967) [-6474.646] (-6479.077) (-6482.998) -- 0:08:26 352500 -- [-6480.502] (-6477.011) (-6485.858) (-6483.705) * (-6481.536) (-6490.165) [-6483.180] (-6489.281) -- 0:08:25 353000 -- (-6480.828) [-6476.513] (-6487.783) (-6486.891) * [-6478.937] (-6480.389) (-6481.768) (-6483.819) -- 0:08:24 353500 -- (-6478.282) (-6476.617) (-6484.595) [-6481.285] * [-6473.810] (-6475.107) (-6484.489) (-6475.557) -- 0:08:24 354000 -- [-6479.522] (-6478.053) (-6492.922) (-6487.832) * (-6479.869) (-6478.592) (-6480.974) [-6479.331] -- 0:08:23 354500 -- (-6477.543) [-6477.466] (-6488.351) (-6476.969) * (-6480.415) [-6477.185] (-6479.251) (-6474.509) -- 0:08:24 355000 -- (-6478.365) (-6479.519) (-6485.942) [-6477.428] * (-6479.950) [-6473.278] (-6477.603) (-6474.801) -- 0:08:23 Average standard deviation of split frequencies: 0.000000 355500 -- (-6483.949) [-6477.771] (-6489.103) (-6477.606) * (-6483.070) [-6473.016] (-6478.300) (-6477.140) -- 0:08:22 356000 -- (-6482.238) (-6482.527) (-6482.501) [-6475.251] * (-6477.555) (-6477.140) (-6475.511) [-6476.359] -- 0:08:22 356500 -- (-6478.417) (-6483.064) [-6475.139] (-6472.391) * (-6477.157) [-6483.045] (-6480.862) (-6477.811) -- 0:08:21 357000 -- [-6478.852] (-6478.919) (-6482.434) (-6479.025) * [-6476.021] (-6481.079) (-6480.363) (-6478.180) -- 0:08:22 357500 -- (-6483.710) (-6484.264) (-6480.402) [-6473.820] * (-6483.852) (-6479.916) (-6480.522) [-6475.876] -- 0:08:21 358000 -- (-6480.446) [-6482.161] (-6489.195) (-6475.554) * [-6477.665] (-6482.641) (-6479.900) (-6478.174) -- 0:08:20 358500 -- (-6483.830) [-6476.032] (-6482.221) (-6472.292) * [-6478.906] (-6484.487) (-6483.073) (-6483.973) -- 0:08:21 359000 -- [-6479.559] (-6476.450) (-6481.643) (-6483.080) * (-6480.502) (-6489.714) (-6475.939) [-6481.037] -- 0:08:19 359500 -- (-6481.028) [-6477.595] (-6482.724) (-6480.490) * (-6479.767) [-6487.821] (-6490.218) (-6485.819) -- 0:08:18 360000 -- (-6487.108) (-6479.403) (-6481.578) [-6480.218] * (-6478.351) (-6482.289) [-6477.359] (-6484.817) -- 0:08:19 Average standard deviation of split frequencies: 0.000000 360500 -- (-6475.250) (-6482.271) (-6482.932) [-6476.845] * [-6479.973] (-6479.289) (-6484.435) (-6486.027) -- 0:08:18 361000 -- (-6478.119) (-6471.507) (-6477.456) [-6479.395] * [-6474.778] (-6475.621) (-6481.103) (-6481.732) -- 0:08:19 361500 -- (-6479.159) (-6485.852) (-6478.404) [-6480.658] * (-6483.237) (-6474.601) [-6481.882] (-6483.730) -- 0:08:18 362000 -- (-6476.769) (-6482.062) [-6474.552] (-6484.512) * [-6476.652] (-6476.905) (-6483.044) (-6478.368) -- 0:08:17 362500 -- (-6479.762) (-6487.519) [-6479.787] (-6478.937) * [-6476.583] (-6476.015) (-6475.362) (-6480.210) -- 0:08:17 363000 -- (-6476.957) [-6480.410] (-6482.057) (-6479.155) * (-6478.601) [-6477.766] (-6476.886) (-6476.239) -- 0:08:16 363500 -- (-6490.115) (-6480.204) [-6476.212] (-6478.361) * [-6486.647] (-6474.505) (-6482.288) (-6478.784) -- 0:08:17 364000 -- [-6483.613] (-6484.522) (-6481.975) (-6479.217) * (-6482.338) (-6477.106) (-6478.613) [-6479.211] -- 0:08:16 364500 -- (-6479.995) (-6478.523) [-6488.666] (-6477.204) * (-6474.855) (-6477.900) (-6481.326) [-6476.612] -- 0:08:15 365000 -- [-6480.213] (-6483.423) (-6478.768) (-6479.135) * (-6481.979) (-6480.780) [-6474.080] (-6477.009) -- 0:08:15 Average standard deviation of split frequencies: 0.000000 365500 -- (-6473.765) (-6479.331) (-6475.249) [-6476.497] * (-6476.382) (-6479.140) (-6481.663) [-6479.873] -- 0:08:14 366000 -- [-6473.345] (-6482.037) (-6477.198) (-6475.442) * [-6474.369] (-6477.551) (-6477.471) (-6476.424) -- 0:08:13 366500 -- (-6484.541) [-6477.591] (-6480.790) (-6477.327) * [-6473.074] (-6482.561) (-6485.490) (-6481.439) -- 0:08:14 367000 -- (-6477.606) (-6484.244) [-6481.285] (-6484.881) * (-6483.669) (-6482.570) (-6477.556) [-6479.374] -- 0:08:13 367500 -- (-6481.240) [-6475.203] (-6475.347) (-6477.252) * [-6478.747] (-6476.675) (-6478.960) (-6480.273) -- 0:08:12 368000 -- [-6478.813] (-6478.789) (-6482.087) (-6477.734) * (-6475.320) [-6482.066] (-6477.196) (-6478.535) -- 0:08:12 368500 -- (-6479.417) (-6480.401) [-6479.061] (-6484.758) * (-6475.572) (-6478.067) [-6480.727] (-6486.808) -- 0:08:11 369000 -- (-6482.943) (-6475.162) (-6479.967) [-6477.225] * (-6477.252) (-6478.794) (-6485.059) [-6477.029] -- 0:08:12 369500 -- [-6471.373] (-6477.504) (-6486.291) (-6486.594) * [-6475.830] (-6479.060) (-6480.553) (-6480.202) -- 0:08:11 370000 -- (-6476.553) [-6478.464] (-6478.083) (-6476.739) * [-6482.435] (-6478.209) (-6488.162) (-6481.398) -- 0:08:10 Average standard deviation of split frequencies: 0.000000 370500 -- (-6477.005) (-6481.253) [-6480.937] (-6476.107) * (-6479.968) (-6480.700) [-6482.908] (-6479.765) -- 0:08:11 371000 -- (-6473.269) (-6480.862) (-6484.854) [-6477.838] * (-6478.475) [-6477.313] (-6478.639) (-6479.994) -- 0:08:09 371500 -- (-6489.563) (-6480.252) (-6477.167) [-6479.182] * (-6479.738) [-6474.868] (-6481.341) (-6482.970) -- 0:08:08 372000 -- (-6489.928) [-6484.174] (-6480.791) (-6481.235) * (-6486.195) [-6481.325] (-6474.570) (-6483.458) -- 0:08:09 372500 -- (-6494.625) (-6477.411) [-6476.167] (-6486.527) * (-6478.503) [-6477.441] (-6474.914) (-6487.824) -- 0:08:08 373000 -- [-6479.023] (-6474.076) (-6479.233) (-6490.862) * (-6481.123) (-6478.579) [-6478.563] (-6479.840) -- 0:08:09 373500 -- (-6476.707) [-6476.717] (-6480.435) (-6476.499) * (-6479.459) (-6475.920) [-6471.795] (-6483.576) -- 0:08:08 374000 -- (-6483.240) (-6476.517) (-6482.832) [-6475.511] * (-6478.974) (-6479.935) [-6473.097] (-6474.576) -- 0:08:07 374500 -- (-6480.988) (-6477.204) (-6480.369) [-6480.415] * (-6477.689) [-6480.602] (-6478.654) (-6477.861) -- 0:08:07 375000 -- (-6482.508) [-6479.244] (-6476.868) (-6475.977) * (-6480.855) [-6479.227] (-6480.373) (-6477.207) -- 0:08:06 Average standard deviation of split frequencies: 0.000000 375500 -- (-6484.013) [-6476.118] (-6480.053) (-6476.495) * (-6472.394) [-6475.833] (-6475.409) (-6479.542) -- 0:08:07 376000 -- (-6483.059) [-6476.472] (-6478.514) (-6482.032) * (-6480.157) (-6480.535) [-6476.618] (-6475.629) -- 0:08:06 376500 -- [-6473.949] (-6480.271) (-6479.496) (-6480.642) * [-6472.733] (-6473.723) (-6481.091) (-6481.492) -- 0:08:05 377000 -- [-6480.773] (-6475.390) (-6476.881) (-6484.083) * (-6478.942) [-6477.061] (-6478.359) (-6472.450) -- 0:08:05 377500 -- (-6475.795) [-6476.859] (-6477.558) (-6479.478) * [-6479.910] (-6492.835) (-6479.030) (-6478.410) -- 0:08:04 378000 -- [-6482.599] (-6478.846) (-6481.256) (-6479.259) * (-6476.352) (-6485.907) (-6482.050) [-6476.475] -- 0:08:03 378500 -- (-6480.181) (-6484.137) [-6478.460] (-6486.830) * (-6472.852) (-6486.196) (-6475.705) [-6478.863] -- 0:08:04 379000 -- (-6483.340) (-6484.168) (-6483.190) [-6476.151] * [-6478.477] (-6478.244) (-6475.688) (-6476.351) -- 0:08:03 379500 -- (-6476.400) (-6484.571) (-6483.725) [-6475.759] * (-6480.647) [-6480.287] (-6487.940) (-6479.808) -- 0:08:03 380000 -- (-6482.440) (-6478.432) (-6482.217) [-6482.877] * [-6475.206] (-6477.132) (-6474.850) (-6486.143) -- 0:08:02 Average standard deviation of split frequencies: 0.000000 380500 -- [-6476.856] (-6477.117) (-6481.979) (-6474.877) * (-6481.047) (-6479.493) [-6481.040] (-6485.631) -- 0:08:01 381000 -- (-6489.053) [-6481.157] (-6478.564) (-6477.599) * (-6477.658) (-6478.984) [-6475.667] (-6485.765) -- 0:08:02 381500 -- [-6479.843] (-6491.090) (-6478.833) (-6485.607) * (-6486.029) (-6479.238) (-6479.569) [-6482.347] -- 0:08:01 382000 -- (-6486.013) (-6481.934) (-6488.341) [-6475.845] * [-6479.655] (-6479.314) (-6480.255) (-6479.312) -- 0:08:00 382500 -- (-6484.281) (-6484.110) (-6492.507) [-6479.839] * [-6474.414] (-6480.210) (-6481.816) (-6484.931) -- 0:08:01 383000 -- (-6473.708) (-6478.327) (-6490.300) [-6486.387] * (-6476.172) (-6482.346) [-6481.489] (-6482.832) -- 0:08:00 383500 -- (-6476.127) (-6480.527) [-6482.549] (-6480.007) * (-6478.664) [-6485.716] (-6483.590) (-6479.100) -- 0:08:00 384000 -- [-6480.312] (-6476.208) (-6481.746) (-6480.148) * (-6480.575) (-6480.091) [-6475.512] (-6479.034) -- 0:07:59 384500 -- (-6485.105) (-6489.193) [-6478.147] (-6482.478) * (-6480.996) (-6485.379) (-6491.627) [-6479.194] -- 0:07:58 385000 -- [-6486.384] (-6476.074) (-6481.005) (-6487.745) * (-6479.771) (-6477.492) (-6478.903) [-6476.197] -- 0:07:59 Average standard deviation of split frequencies: 0.000000 385500 -- (-6480.222) (-6486.275) [-6476.435] (-6483.381) * [-6478.536] (-6475.580) (-6483.044) (-6476.236) -- 0:07:58 386000 -- (-6483.704) (-6479.562) (-6488.325) [-6478.075] * (-6473.792) (-6481.927) [-6481.214] (-6480.418) -- 0:07:57 386500 -- (-6481.623) [-6482.363] (-6484.783) (-6478.188) * [-6483.440] (-6479.586) (-6482.140) (-6485.608) -- 0:07:57 387000 -- (-6488.266) (-6482.464) (-6477.197) [-6477.492] * [-6489.391] (-6480.219) (-6478.225) (-6479.499) -- 0:07:56 387500 -- (-6482.708) (-6483.036) (-6476.925) [-6477.509] * (-6487.798) (-6489.498) (-6485.765) [-6479.683] -- 0:07:57 388000 -- [-6477.402] (-6476.279) (-6473.891) (-6480.891) * (-6478.300) (-6476.489) (-6485.833) [-6476.241] -- 0:07:56 388500 -- (-6475.698) [-6486.134] (-6472.421) (-6479.263) * (-6475.692) (-6475.142) (-6480.999) [-6477.311] -- 0:07:55 389000 -- (-6477.382) [-6477.954] (-6475.819) (-6480.151) * (-6480.436) (-6474.819) (-6478.767) [-6477.917] -- 0:07:55 389500 -- (-6480.967) [-6474.234] (-6472.295) (-6477.043) * [-6476.397] (-6479.041) (-6489.181) (-6483.126) -- 0:07:54 390000 -- (-6478.460) (-6486.523) [-6473.543] (-6483.454) * (-6474.381) [-6478.549] (-6481.304) (-6482.541) -- 0:07:55 Average standard deviation of split frequencies: 0.000000 390500 -- (-6477.793) (-6476.417) (-6480.753) [-6484.042] * (-6479.294) (-6480.005) (-6477.647) [-6487.084] -- 0:07:54 391000 -- (-6477.763) (-6477.287) [-6475.073] (-6483.688) * (-6482.716) (-6478.061) (-6483.067) [-6475.944] -- 0:07:53 391500 -- (-6483.171) [-6478.069] (-6478.549) (-6484.015) * (-6478.549) [-6477.509] (-6473.462) (-6482.289) -- 0:07:54 392000 -- [-6480.954] (-6474.641) (-6479.372) (-6482.769) * (-6478.112) (-6473.711) [-6475.192] (-6474.149) -- 0:07:53 392500 -- [-6478.122] (-6476.003) (-6477.377) (-6476.006) * (-6479.368) (-6480.980) [-6475.827] (-6479.990) -- 0:07:53 393000 -- (-6479.857) (-6476.498) [-6479.928] (-6475.706) * (-6482.327) [-6478.479] (-6480.446) (-6476.401) -- 0:07:52 393500 -- (-6485.048) (-6480.524) [-6478.766] (-6478.929) * (-6480.475) (-6478.709) (-6481.151) [-6477.104] -- 0:07:51 394000 -- (-6477.993) (-6489.763) [-6473.346] (-6474.848) * (-6486.857) (-6479.802) (-6484.209) [-6479.458] -- 0:07:52 394500 -- (-6487.738) (-6486.034) (-6482.434) [-6477.570] * [-6478.161] (-6478.282) (-6485.866) (-6485.527) -- 0:07:51 395000 -- (-6479.861) [-6478.642] (-6480.151) (-6482.235) * (-6481.561) [-6479.557] (-6477.643) (-6475.000) -- 0:07:51 Average standard deviation of split frequencies: 0.000000 395500 -- (-6480.348) (-6487.004) [-6476.028] (-6481.341) * (-6473.867) (-6472.292) [-6478.100] (-6481.282) -- 0:07:50 396000 -- (-6473.099) (-6489.246) [-6480.672] (-6481.099) * (-6488.312) (-6482.146) [-6483.967] (-6477.431) -- 0:07:49 396500 -- (-6484.836) [-6486.236] (-6482.112) (-6477.332) * (-6480.248) (-6484.204) [-6479.790] (-6482.190) -- 0:07:50 397000 -- [-6483.706] (-6478.773) (-6481.305) (-6479.225) * (-6487.800) (-6478.019) (-6482.157) [-6479.124] -- 0:07:49 397500 -- (-6482.654) (-6476.853) (-6478.036) [-6475.962] * (-6482.102) (-6479.401) (-6480.347) [-6475.939] -- 0:07:49 398000 -- (-6484.496) (-6481.928) [-6476.789] (-6479.031) * (-6476.710) (-6476.996) [-6480.787] (-6473.882) -- 0:07:48 398500 -- [-6482.035] (-6486.367) (-6479.523) (-6474.562) * [-6473.691] (-6480.218) (-6491.598) (-6478.607) -- 0:07:47 399000 -- (-6481.525) (-6477.170) (-6487.429) [-6487.612] * (-6478.759) [-6485.108] (-6482.160) (-6483.889) -- 0:07:48 399500 -- (-6476.952) (-6481.396) (-6475.138) [-6476.346] * [-6480.513] (-6475.105) (-6483.740) (-6485.261) -- 0:07:47 400000 -- [-6474.187] (-6480.845) (-6480.823) (-6476.852) * (-6477.065) (-6478.077) [-6474.120] (-6488.566) -- 0:07:48 Average standard deviation of split frequencies: 0.000000 400500 -- (-6480.126) [-6480.932] (-6489.705) (-6484.257) * [-6477.767] (-6485.505) (-6482.575) (-6484.623) -- 0:07:47 401000 -- [-6479.579] (-6481.525) (-6476.184) (-6474.938) * (-6482.343) (-6479.446) [-6478.011] (-6482.279) -- 0:07:46 401500 -- (-6476.786) [-6481.910] (-6477.941) (-6481.034) * (-6485.877) (-6477.817) (-6481.510) [-6486.153] -- 0:07:46 402000 -- (-6484.968) [-6479.395] (-6478.952) (-6488.260) * (-6481.133) [-6481.558] (-6484.207) (-6490.550) -- 0:07:45 402500 -- (-6487.293) [-6477.789] (-6478.576) (-6480.534) * (-6481.539) (-6478.075) [-6480.967] (-6488.120) -- 0:07:44 403000 -- (-6479.148) [-6478.270] (-6486.031) (-6479.553) * (-6479.280) (-6481.058) [-6476.118] (-6480.186) -- 0:07:45 403500 -- [-6479.890] (-6480.199) (-6482.600) (-6484.014) * (-6486.394) [-6476.719] (-6479.605) (-6476.816) -- 0:07:44 404000 -- (-6479.556) (-6482.132) [-6482.047] (-6476.372) * (-6479.209) [-6474.502] (-6474.742) (-6479.166) -- 0:07:44 404500 -- (-6478.697) (-6485.207) (-6477.843) [-6482.292] * [-6482.625] (-6477.940) (-6480.541) (-6477.233) -- 0:07:43 405000 -- (-6478.750) (-6478.211) (-6478.318) [-6478.651] * (-6474.580) (-6487.022) (-6494.579) [-6483.404] -- 0:07:42 Average standard deviation of split frequencies: 0.000000 405500 -- (-6487.639) (-6478.323) (-6482.850) [-6476.885] * (-6481.237) (-6482.641) (-6486.158) [-6476.013] -- 0:07:43 406000 -- (-6486.741) (-6480.969) [-6479.572] (-6475.959) * (-6482.637) (-6482.821) (-6479.279) [-6475.712] -- 0:07:42 406500 -- (-6495.489) [-6483.152] (-6479.593) (-6472.020) * (-6481.045) [-6475.979] (-6481.963) (-6486.911) -- 0:07:42 407000 -- (-6479.650) (-6481.137) [-6476.520] (-6478.250) * (-6483.260) [-6477.471] (-6483.063) (-6481.143) -- 0:07:41 407500 -- (-6478.965) [-6479.312] (-6479.739) (-6484.581) * (-6482.309) [-6479.801] (-6473.437) (-6483.433) -- 0:07:40 408000 -- (-6482.423) (-6478.197) (-6480.407) [-6478.822] * (-6476.921) [-6475.239] (-6477.572) (-6477.674) -- 0:07:41 408500 -- (-6476.829) (-6483.375) [-6478.497] (-6484.833) * (-6492.767) (-6483.278) [-6476.329] (-6481.594) -- 0:07:40 409000 -- (-6481.516) (-6479.733) [-6475.135] (-6482.253) * (-6485.593) (-6485.165) [-6476.707] (-6480.909) -- 0:07:40 409500 -- [-6477.671] (-6478.998) (-6479.567) (-6477.760) * (-6480.296) (-6480.448) [-6478.988] (-6483.475) -- 0:07:39 410000 -- (-6477.582) (-6476.317) [-6475.516] (-6478.898) * (-6482.006) (-6478.433) (-6475.702) [-6487.315] -- 0:07:39 Average standard deviation of split frequencies: 0.000000 410500 -- (-6481.052) (-6476.090) [-6476.327] (-6477.027) * (-6485.256) (-6477.383) (-6483.306) [-6476.737] -- 0:07:39 411000 -- [-6481.285] (-6484.041) (-6480.365) (-6475.256) * (-6480.032) (-6480.653) (-6481.989) [-6475.297] -- 0:07:38 411500 -- (-6482.867) [-6479.850] (-6477.134) (-6481.490) * [-6480.502] (-6481.206) (-6484.638) (-6479.410) -- 0:07:37 412000 -- (-6480.629) (-6485.313) [-6481.820] (-6476.597) * (-6478.250) (-6480.516) (-6487.116) [-6481.325] -- 0:07:38 412500 -- [-6476.808] (-6482.745) (-6480.655) (-6481.542) * (-6475.507) (-6485.517) (-6476.461) [-6476.236] -- 0:07:37 413000 -- (-6484.137) [-6483.468] (-6479.779) (-6479.378) * (-6481.933) (-6486.377) [-6479.668] (-6476.821) -- 0:07:37 413500 -- [-6481.199] (-6474.225) (-6484.769) (-6476.350) * (-6479.076) [-6480.165] (-6488.911) (-6476.635) -- 0:07:36 414000 -- (-6485.789) (-6481.874) [-6477.385] (-6479.536) * (-6476.654) [-6479.501] (-6487.193) (-6478.168) -- 0:07:35 414500 -- (-6480.358) [-6481.789] (-6481.845) (-6484.189) * (-6479.310) (-6474.036) (-6482.381) [-6483.851] -- 0:07:36 415000 -- [-6474.273] (-6483.246) (-6473.119) (-6489.097) * (-6480.630) (-6482.485) [-6482.681] (-6480.470) -- 0:07:35 Average standard deviation of split frequencies: 0.000000 415500 -- [-6474.252] (-6482.447) (-6479.687) (-6478.782) * (-6478.307) [-6483.739] (-6484.479) (-6477.664) -- 0:07:34 416000 -- [-6478.234] (-6481.424) (-6479.954) (-6479.318) * (-6480.522) (-6483.722) [-6479.599] (-6477.870) -- 0:07:34 416500 -- (-6476.045) (-6483.940) [-6480.066] (-6486.665) * [-6475.918] (-6490.861) (-6478.889) (-6479.227) -- 0:07:33 417000 -- (-6477.576) (-6483.850) (-6475.813) [-6477.098] * [-6477.875] (-6477.290) (-6482.231) (-6478.787) -- 0:07:34 417500 -- [-6478.808] (-6479.165) (-6480.161) (-6476.491) * (-6481.460) (-6489.195) [-6478.881] (-6478.872) -- 0:07:33 418000 -- (-6483.037) [-6478.575] (-6476.233) (-6477.441) * (-6478.102) [-6484.055] (-6477.618) (-6481.450) -- 0:07:32 418500 -- (-6477.166) [-6474.396] (-6474.639) (-6481.571) * (-6480.363) (-6478.587) (-6483.053) [-6482.826] -- 0:07:32 419000 -- [-6483.333] (-6478.162) (-6478.603) (-6478.408) * (-6475.269) (-6480.832) (-6485.938) [-6479.067] -- 0:07:32 419500 -- (-6480.440) (-6483.327) [-6486.269] (-6478.026) * (-6477.792) (-6481.906) [-6478.747] (-6482.335) -- 0:07:31 420000 -- (-6487.303) [-6480.087] (-6481.098) (-6480.907) * (-6474.513) (-6484.902) (-6476.724) [-6478.082] -- 0:07:31 Average standard deviation of split frequencies: 0.000000 420500 -- (-6481.443) (-6479.282) (-6481.166) [-6477.023] * (-6482.859) [-6481.785] (-6484.399) (-6475.475) -- 0:07:30 421000 -- (-6474.708) [-6476.412] (-6481.740) (-6482.196) * (-6483.615) (-6478.109) [-6476.303] (-6480.378) -- 0:07:31 421500 -- (-6480.949) (-6484.915) (-6492.785) [-6478.039] * [-6476.212] (-6474.649) (-6479.584) (-6482.808) -- 0:07:30 422000 -- (-6485.739) (-6474.145) (-6482.065) [-6483.860] * (-6477.127) [-6474.445] (-6485.190) (-6481.344) -- 0:07:29 422500 -- (-6480.129) (-6482.269) [-6472.800] (-6485.303) * (-6477.180) (-6475.516) (-6482.279) [-6476.063] -- 0:07:29 423000 -- [-6475.489] (-6475.242) (-6476.098) (-6488.005) * (-6483.398) [-6476.329] (-6477.966) (-6479.361) -- 0:07:28 423500 -- [-6475.609] (-6484.713) (-6478.450) (-6484.342) * (-6478.110) (-6476.151) (-6482.240) [-6481.582] -- 0:07:27 424000 -- (-6477.238) (-6481.255) (-6479.985) [-6477.913] * [-6478.781] (-6478.485) (-6485.967) (-6481.684) -- 0:07:28 424500 -- [-6477.654] (-6477.094) (-6478.387) (-6480.337) * [-6476.454] (-6485.207) (-6485.372) (-6474.813) -- 0:07:27 425000 -- (-6477.973) [-6479.307] (-6475.080) (-6485.701) * [-6476.509] (-6483.174) (-6477.689) (-6482.686) -- 0:07:27 Average standard deviation of split frequencies: 0.000000 425500 -- (-6482.067) (-6477.829) (-6481.631) [-6479.252] * (-6477.886) (-6495.043) (-6480.711) [-6481.348] -- 0:07:26 426000 -- [-6476.471] (-6485.116) (-6477.456) (-6485.384) * [-6477.787] (-6480.084) (-6487.957) (-6480.859) -- 0:07:25 426500 -- (-6482.061) [-6477.818] (-6483.035) (-6476.421) * [-6475.326] (-6482.798) (-6488.223) (-6480.667) -- 0:07:26 427000 -- (-6481.615) (-6477.734) [-6471.684] (-6476.481) * [-6475.964] (-6481.050) (-6491.326) (-6482.015) -- 0:07:25 427500 -- (-6482.998) (-6473.352) [-6478.107] (-6478.073) * [-6472.255] (-6479.983) (-6490.013) (-6480.818) -- 0:07:24 428000 -- (-6481.219) [-6480.768] (-6484.039) (-6480.384) * (-6478.878) [-6473.923] (-6480.627) (-6483.006) -- 0:07:25 428500 -- (-6480.834) [-6475.393] (-6478.419) (-6476.257) * (-6476.272) (-6480.589) [-6473.705] (-6485.959) -- 0:07:24 429000 -- (-6476.158) [-6475.877] (-6477.338) (-6482.440) * (-6479.704) [-6480.028] (-6476.274) (-6489.118) -- 0:07:24 429500 -- (-6478.630) (-6481.732) [-6478.623] (-6482.986) * (-6480.640) (-6482.109) [-6480.832] (-6478.656) -- 0:07:23 430000 -- (-6482.831) [-6472.537] (-6479.832) (-6486.133) * (-6484.384) [-6480.703] (-6479.088) (-6479.392) -- 0:07:22 Average standard deviation of split frequencies: 0.000000 430500 -- (-6480.639) (-6476.602) [-6477.765] (-6487.381) * (-6477.957) [-6478.502] (-6482.403) (-6475.831) -- 0:07:23 431000 -- (-6480.523) (-6477.294) [-6478.349] (-6485.119) * (-6481.671) (-6479.131) [-6483.976] (-6484.984) -- 0:07:22 431500 -- [-6481.176] (-6486.657) (-6474.711) (-6483.520) * (-6477.894) [-6475.620] (-6483.295) (-6488.527) -- 0:07:21 432000 -- (-6477.171) (-6477.851) (-6479.623) [-6480.076] * (-6474.445) (-6481.176) [-6476.206] (-6476.281) -- 0:07:21 432500 -- [-6476.189] (-6480.551) (-6482.331) (-6490.474) * (-6478.915) (-6475.059) [-6473.533] (-6484.999) -- 0:07:20 433000 -- (-6485.889) [-6481.657] (-6477.293) (-6479.788) * [-6486.068] (-6475.870) (-6481.828) (-6477.769) -- 0:07:21 433500 -- [-6480.906] (-6480.364) (-6476.132) (-6484.507) * (-6477.636) (-6478.121) [-6479.092] (-6480.406) -- 0:07:20 434000 -- (-6474.892) (-6477.991) [-6477.643] (-6481.111) * (-6476.087) (-6483.823) (-6477.778) [-6484.868] -- 0:07:19 434500 -- [-6475.525] (-6482.053) (-6472.712) (-6485.011) * (-6488.521) [-6474.671] (-6475.111) (-6473.594) -- 0:07:19 435000 -- [-6477.495] (-6482.680) (-6478.609) (-6486.094) * [-6476.457] (-6485.838) (-6474.200) (-6477.973) -- 0:07:19 Average standard deviation of split frequencies: 0.000000 435500 -- (-6477.348) (-6477.815) (-6479.487) [-6476.939] * (-6482.819) [-6480.284] (-6481.513) (-6479.511) -- 0:07:18 436000 -- (-6484.836) (-6479.711) [-6480.478] (-6484.024) * [-6477.231] (-6485.903) (-6485.869) (-6485.074) -- 0:07:18 436500 -- (-6489.367) [-6483.634] (-6486.059) (-6481.541) * (-6475.701) (-6482.834) [-6479.494] (-6488.821) -- 0:07:17 437000 -- (-6476.918) [-6481.902] (-6481.838) (-6484.148) * (-6478.774) (-6477.974) [-6480.588] (-6478.076) -- 0:07:18 437500 -- [-6480.354] (-6478.053) (-6481.212) (-6485.151) * (-6481.601) (-6473.782) [-6477.431] (-6475.662) -- 0:07:17 438000 -- (-6479.289) (-6475.986) (-6478.191) [-6482.169] * [-6480.570] (-6481.867) (-6480.873) (-6474.636) -- 0:07:16 438500 -- (-6484.830) [-6473.940] (-6474.266) (-6480.240) * (-6485.183) (-6481.735) (-6479.779) [-6477.612] -- 0:07:16 439000 -- (-6484.185) (-6487.261) [-6477.638] (-6483.303) * (-6478.270) (-6477.135) [-6481.837] (-6480.976) -- 0:07:15 439500 -- (-6486.361) (-6480.550) (-6480.763) [-6480.789] * (-6479.007) [-6480.482] (-6475.342) (-6475.167) -- 0:07:14 440000 -- [-6482.083] (-6487.011) (-6485.154) (-6476.664) * (-6477.744) [-6479.219] (-6481.137) (-6478.313) -- 0:07:15 Average standard deviation of split frequencies: 0.000000 440500 -- (-6482.924) [-6481.638] (-6484.816) (-6485.092) * (-6478.068) (-6473.007) (-6480.543) [-6481.972] -- 0:07:14 441000 -- [-6480.592] (-6486.990) (-6483.893) (-6487.183) * (-6476.635) [-6473.888] (-6484.040) (-6481.839) -- 0:07:14 441500 -- (-6480.511) (-6487.507) [-6481.717] (-6478.301) * (-6481.031) (-6477.876) [-6485.979] (-6480.083) -- 0:07:13 442000 -- (-6481.500) (-6479.148) (-6480.284) [-6482.709] * (-6479.049) (-6481.032) (-6485.137) [-6477.753] -- 0:07:13 442500 -- (-6479.593) [-6473.201] (-6483.050) (-6481.153) * [-6476.839] (-6481.667) (-6479.498) (-6473.907) -- 0:07:13 443000 -- (-6483.302) [-6474.286] (-6479.066) (-6481.255) * (-6474.721) [-6480.532] (-6486.021) (-6473.757) -- 0:07:12 443500 -- [-6479.371] (-6480.459) (-6484.672) (-6482.669) * (-6476.992) (-6476.261) [-6479.298] (-6479.923) -- 0:07:12 444000 -- (-6479.906) [-6483.593] (-6491.312) (-6479.697) * (-6478.464) (-6475.418) (-6490.354) [-6477.488] -- 0:07:12 444500 -- (-6481.273) [-6479.795] (-6483.469) (-6476.778) * [-6483.130] (-6478.641) (-6491.862) (-6477.320) -- 0:07:11 445000 -- (-6482.792) [-6481.838] (-6476.435) (-6478.822) * [-6480.277] (-6483.883) (-6489.657) (-6477.447) -- 0:07:11 Average standard deviation of split frequencies: 0.000000 445500 -- (-6482.822) [-6476.654] (-6482.418) (-6484.569) * [-6477.217] (-6478.918) (-6487.131) (-6484.202) -- 0:07:10 446000 -- (-6482.920) (-6477.588) (-6478.256) [-6483.482] * (-6490.610) [-6480.554] (-6475.364) (-6481.389) -- 0:07:11 446500 -- (-6477.288) (-6476.944) [-6476.820] (-6479.609) * (-6476.138) (-6481.469) [-6479.395] (-6480.923) -- 0:07:10 447000 -- [-6479.387] (-6479.761) (-6483.339) (-6478.283) * (-6479.636) (-6485.002) (-6485.614) [-6477.623] -- 0:07:09 447500 -- (-6479.244) (-6488.933) (-6486.699) [-6478.008] * (-6477.274) (-6484.218) (-6478.267) [-6475.144] -- 0:07:09 448000 -- (-6479.671) (-6479.202) [-6472.135] (-6476.798) * (-6483.547) (-6482.780) [-6479.274] (-6475.741) -- 0:07:08 448500 -- (-6488.204) (-6472.493) (-6483.886) [-6478.960] * [-6479.812] (-6482.698) (-6476.575) (-6477.754) -- 0:07:07 449000 -- (-6480.748) [-6478.402] (-6478.486) (-6482.868) * (-6486.027) (-6477.729) (-6483.960) [-6479.746] -- 0:07:08 449500 -- [-6479.850] (-6474.407) (-6483.841) (-6477.828) * [-6478.868] (-6483.480) (-6481.014) (-6486.621) -- 0:07:07 450000 -- (-6485.189) (-6487.543) [-6486.301] (-6480.989) * (-6479.814) (-6483.461) (-6476.372) [-6478.257] -- 0:07:07 Average standard deviation of split frequencies: 0.000000 450500 -- (-6475.678) (-6485.657) (-6479.580) [-6473.413] * (-6490.376) (-6486.694) (-6484.159) [-6473.962] -- 0:07:06 451000 -- (-6485.169) (-6486.444) [-6477.959] (-6479.023) * (-6486.373) [-6477.090] (-6480.788) (-6478.815) -- 0:07:06 451500 -- (-6476.564) (-6485.331) [-6476.187] (-6479.324) * (-6479.009) [-6477.560] (-6476.679) (-6480.723) -- 0:07:06 452000 -- (-6478.613) (-6479.762) [-6472.434] (-6481.289) * (-6481.069) (-6480.465) [-6473.188] (-6482.869) -- 0:07:05 452500 -- [-6481.626] (-6482.981) (-6481.103) (-6482.774) * [-6478.638] (-6482.752) (-6479.371) (-6483.061) -- 0:07:05 453000 -- (-6482.772) (-6478.236) [-6479.002] (-6479.882) * (-6477.169) (-6475.825) (-6478.847) [-6481.902] -- 0:07:05 453500 -- (-6479.489) (-6481.676) [-6480.575] (-6475.091) * (-6478.671) (-6482.522) [-6482.366] (-6481.502) -- 0:07:04 454000 -- (-6476.341) (-6482.189) (-6476.951) [-6476.682] * [-6477.763] (-6475.244) (-6489.367) (-6476.685) -- 0:07:04 454500 -- (-6484.656) (-6483.091) (-6485.192) [-6480.722] * (-6479.836) (-6478.929) [-6476.524] (-6481.151) -- 0:07:03 455000 -- (-6474.353) (-6485.161) [-6478.211] (-6478.922) * (-6480.577) (-6491.637) (-6480.681) [-6476.923] -- 0:07:04 Average standard deviation of split frequencies: 0.000000 455500 -- (-6480.916) (-6482.354) [-6478.589] (-6478.193) * [-6476.114] (-6482.833) (-6477.018) (-6475.081) -- 0:07:03 456000 -- [-6475.494] (-6486.471) (-6478.586) (-6479.169) * (-6482.667) (-6483.808) (-6482.424) [-6476.354] -- 0:07:02 456500 -- (-6479.563) (-6482.724) (-6476.357) [-6479.777] * [-6476.535] (-6484.698) (-6481.518) (-6484.512) -- 0:07:02 457000 -- (-6479.831) [-6484.689] (-6479.393) (-6479.048) * (-6477.137) [-6481.346] (-6498.413) (-6475.361) -- 0:07:01 457500 -- (-6481.488) [-6485.564] (-6485.113) (-6476.357) * (-6479.017) [-6477.235] (-6479.409) (-6476.470) -- 0:07:00 458000 -- (-6477.005) (-6472.592) (-6481.311) [-6479.153] * (-6475.389) (-6477.732) [-6473.753] (-6482.273) -- 0:07:01 458500 -- (-6476.880) [-6475.142] (-6479.725) (-6473.968) * (-6483.059) (-6484.566) [-6487.118] (-6480.684) -- 0:07:00 459000 -- (-6487.666) [-6478.983] (-6474.305) (-6485.247) * (-6485.079) (-6474.680) [-6481.418] (-6479.134) -- 0:07:00 459500 -- (-6487.228) (-6476.907) [-6475.244] (-6480.499) * (-6482.897) (-6481.076) [-6474.017] (-6472.929) -- 0:06:59 460000 -- (-6490.515) (-6475.502) [-6474.483] (-6488.094) * (-6481.067) [-6480.929] (-6477.566) (-6474.561) -- 0:06:59 Average standard deviation of split frequencies: 0.000000 460500 -- [-6474.548] (-6474.404) (-6477.349) (-6485.927) * [-6484.474] (-6476.153) (-6483.530) (-6480.825) -- 0:06:59 461000 -- (-6476.821) (-6474.679) (-6478.555) [-6481.277] * (-6482.228) (-6482.773) [-6486.118] (-6484.476) -- 0:06:58 461500 -- (-6483.995) (-6486.109) [-6475.104] (-6479.550) * (-6478.256) (-6491.225) (-6481.101) [-6474.061] -- 0:06:58 462000 -- (-6481.907) (-6476.056) [-6477.434] (-6478.921) * [-6479.446] (-6485.892) (-6484.602) (-6476.447) -- 0:06:58 462500 -- (-6483.918) [-6477.792] (-6494.430) (-6481.220) * (-6475.171) (-6479.513) (-6473.104) [-6476.801] -- 0:06:57 463000 -- (-6486.698) (-6480.735) [-6485.688] (-6485.197) * (-6480.065) (-6487.732) [-6480.660] (-6474.450) -- 0:06:57 463500 -- (-6476.946) [-6475.727] (-6486.268) (-6492.490) * (-6478.425) [-6473.578] (-6483.102) (-6479.740) -- 0:06:56 464000 -- (-6476.543) (-6479.542) [-6482.971] (-6485.190) * (-6481.577) (-6481.067) (-6476.517) [-6474.150] -- 0:06:55 464500 -- (-6484.291) (-6480.862) [-6478.784] (-6475.178) * (-6480.117) (-6488.938) (-6481.565) [-6474.732] -- 0:06:56 465000 -- (-6479.551) (-6482.180) [-6479.860] (-6484.374) * [-6477.210] (-6479.156) (-6481.319) (-6482.306) -- 0:06:55 Average standard deviation of split frequencies: 0.000000 465500 -- [-6483.780] (-6478.062) (-6484.529) (-6487.891) * (-6479.743) [-6481.770] (-6482.779) (-6477.154) -- 0:06:55 466000 -- (-6477.350) (-6482.410) (-6478.058) [-6479.277] * (-6475.938) (-6481.816) [-6474.684] (-6482.553) -- 0:06:54 466500 -- (-6476.234) (-6482.171) (-6488.324) [-6485.619] * [-6484.989] (-6477.552) (-6482.806) (-6481.501) -- 0:06:53 467000 -- (-6476.100) [-6484.150] (-6481.839) (-6480.103) * (-6482.919) (-6484.071) [-6479.375] (-6480.990) -- 0:06:54 467500 -- [-6479.877] (-6484.374) (-6479.933) (-6478.292) * (-6486.412) (-6481.067) (-6478.232) [-6476.440] -- 0:06:53 468000 -- [-6478.668] (-6480.318) (-6482.848) (-6476.542) * [-6477.567] (-6484.702) (-6478.929) (-6481.309) -- 0:06:52 468500 -- (-6480.302) (-6486.758) (-6478.773) [-6477.475] * (-6478.321) (-6484.519) (-6483.654) [-6478.991] -- 0:06:52 469000 -- (-6479.694) (-6482.754) (-6482.050) [-6476.005] * (-6486.923) (-6483.710) [-6478.337] (-6476.713) -- 0:06:52 469500 -- (-6478.343) [-6480.447] (-6488.371) (-6482.478) * (-6474.845) (-6482.297) [-6476.392] (-6478.888) -- 0:06:52 470000 -- (-6479.361) (-6481.405) [-6473.910] (-6473.294) * (-6484.020) [-6479.771] (-6475.597) (-6483.303) -- 0:06:51 Average standard deviation of split frequencies: 0.000000 470500 -- (-6481.923) [-6479.038] (-6473.165) (-6478.453) * (-6490.121) (-6481.061) (-6482.103) [-6473.416] -- 0:06:50 471000 -- (-6487.528) (-6477.898) [-6478.498] (-6478.297) * (-6485.762) [-6473.554] (-6479.012) (-6479.148) -- 0:06:51 471500 -- [-6475.974] (-6481.553) (-6480.541) (-6478.846) * (-6484.272) [-6476.861] (-6480.664) (-6475.669) -- 0:06:50 472000 -- (-6479.179) [-6476.453] (-6478.681) (-6476.932) * (-6479.413) (-6483.518) (-6477.853) [-6481.767] -- 0:06:50 472500 -- [-6480.744] (-6478.130) (-6478.941) (-6486.197) * (-6476.778) [-6476.114] (-6477.345) (-6481.344) -- 0:06:49 473000 -- (-6479.917) [-6477.582] (-6474.954) (-6482.043) * [-6479.179] (-6482.067) (-6487.993) (-6482.670) -- 0:06:48 473500 -- (-6475.730) (-6475.539) (-6484.572) [-6481.132] * (-6485.241) [-6481.101] (-6479.281) (-6478.883) -- 0:06:49 474000 -- (-6486.123) (-6478.297) [-6476.732] (-6481.938) * (-6484.411) (-6484.404) (-6476.937) [-6475.271] -- 0:06:48 474500 -- (-6480.898) [-6482.081] (-6476.676) (-6480.232) * (-6477.488) (-6480.290) [-6477.543] (-6488.313) -- 0:06:47 475000 -- (-6483.392) [-6476.697] (-6478.900) (-6489.943) * [-6479.166] (-6479.118) (-6482.482) (-6480.564) -- 0:06:47 Average standard deviation of split frequencies: 0.000000 475500 -- (-6473.096) (-6475.709) [-6476.498] (-6481.116) * (-6480.125) [-6491.696] (-6479.075) (-6483.998) -- 0:06:47 476000 -- (-6480.579) (-6481.899) [-6475.532] (-6479.815) * (-6479.627) [-6482.651] (-6476.950) (-6478.537) -- 0:06:47 476500 -- (-6476.484) (-6476.692) [-6479.733] (-6482.426) * (-6477.145) (-6489.614) (-6482.911) [-6478.163] -- 0:06:46 477000 -- (-6478.598) (-6484.464) (-6478.328) [-6479.876] * (-6484.892) (-6478.576) (-6482.745) [-6475.522] -- 0:06:45 477500 -- [-6475.984] (-6479.793) (-6479.352) (-6479.576) * (-6482.140) [-6476.094] (-6476.044) (-6476.908) -- 0:06:45 478000 -- [-6477.301] (-6482.371) (-6482.903) (-6494.403) * (-6478.519) [-6477.974] (-6482.706) (-6480.229) -- 0:06:45 478500 -- (-6478.290) (-6482.325) (-6487.343) [-6481.696] * (-6484.441) [-6476.646] (-6479.314) (-6479.565) -- 0:06:44 479000 -- [-6476.794] (-6475.994) (-6481.192) (-6475.695) * (-6486.901) (-6485.593) [-6482.287] (-6484.384) -- 0:06:44 479500 -- (-6481.338) (-6477.347) [-6482.777] (-6483.437) * (-6476.994) (-6478.009) [-6477.316] (-6484.542) -- 0:06:43 480000 -- (-6480.068) [-6473.332] (-6475.108) (-6480.059) * (-6481.061) (-6486.686) (-6475.976) [-6473.566] -- 0:06:44 Average standard deviation of split frequencies: 0.000000 480500 -- (-6479.516) (-6480.762) (-6477.675) [-6477.171] * (-6490.003) (-6480.349) [-6475.109] (-6474.994) -- 0:06:43 481000 -- (-6475.966) [-6477.030] (-6476.005) (-6483.088) * (-6480.294) (-6486.817) (-6479.591) [-6479.651] -- 0:06:43 481500 -- (-6477.384) (-6485.384) [-6475.356] (-6483.629) * (-6489.670) (-6481.703) (-6478.822) [-6475.304] -- 0:06:42 482000 -- (-6478.134) [-6479.157] (-6484.312) (-6490.805) * (-6481.562) (-6480.849) [-6479.010] (-6484.966) -- 0:06:41 482500 -- (-6478.909) [-6478.532] (-6480.246) (-6481.881) * [-6479.307] (-6478.850) (-6478.612) (-6480.393) -- 0:06:42 483000 -- (-6480.528) (-6486.288) [-6480.550] (-6476.055) * (-6478.868) (-6480.856) [-6478.920] (-6484.256) -- 0:06:41 483500 -- (-6480.031) (-6480.508) (-6478.189) [-6475.983] * (-6481.210) [-6474.909] (-6484.508) (-6479.898) -- 0:06:41 484000 -- (-6478.808) [-6482.947] (-6478.183) (-6479.872) * (-6477.051) (-6481.234) (-6479.238) [-6473.195] -- 0:06:40 484500 -- [-6477.401] (-6480.340) (-6479.801) (-6476.863) * (-6477.602) [-6475.098] (-6480.049) (-6477.152) -- 0:06:41 485000 -- (-6481.408) [-6481.939] (-6490.800) (-6481.497) * (-6487.232) (-6475.629) [-6479.042] (-6477.370) -- 0:06:40 Average standard deviation of split frequencies: 0.000000 485500 -- (-6480.512) [-6480.752] (-6485.387) (-6478.907) * (-6482.434) (-6476.947) [-6484.338] (-6481.543) -- 0:06:40 486000 -- (-6476.414) [-6482.264] (-6477.653) (-6486.407) * [-6486.730] (-6481.882) (-6478.387) (-6476.814) -- 0:06:39 486500 -- (-6478.027) (-6477.421) [-6477.492] (-6483.820) * [-6486.010] (-6477.772) (-6473.483) (-6481.002) -- 0:06:38 487000 -- (-6484.627) (-6481.547) (-6474.145) [-6479.131] * (-6484.388) (-6481.186) [-6477.572] (-6478.957) -- 0:06:39 487500 -- (-6488.080) (-6477.580) [-6486.593] (-6480.773) * (-6490.708) [-6477.043] (-6480.946) (-6482.948) -- 0:06:38 488000 -- (-6481.111) (-6478.576) (-6477.969) [-6477.885] * (-6481.556) (-6474.358) (-6483.009) [-6486.022] -- 0:06:37 488500 -- (-6476.514) (-6479.082) [-6476.221] (-6478.269) * (-6484.323) (-6477.848) [-6475.506] (-6482.343) -- 0:06:37 489000 -- (-6477.678) (-6491.818) [-6486.698] (-6479.934) * (-6484.158) [-6481.602] (-6479.711) (-6486.141) -- 0:06:37 489500 -- (-6477.659) (-6481.847) (-6475.511) [-6489.487] * (-6483.767) (-6482.312) [-6477.864] (-6485.272) -- 0:06:37 490000 -- (-6475.601) [-6476.683] (-6476.710) (-6479.651) * (-6479.951) (-6485.263) (-6478.128) [-6476.251] -- 0:06:36 Average standard deviation of split frequencies: 0.000000 490500 -- (-6478.172) [-6478.746] (-6478.116) (-6487.235) * (-6487.947) (-6476.486) [-6480.832] (-6476.918) -- 0:06:35 491000 -- (-6480.884) [-6475.697] (-6477.442) (-6480.289) * (-6479.066) (-6483.660) (-6476.832) [-6478.826] -- 0:06:36 491500 -- (-6477.397) [-6476.905] (-6478.988) (-6477.790) * (-6477.655) (-6481.936) (-6483.085) [-6480.543] -- 0:06:35 492000 -- [-6480.734] (-6478.428) (-6476.013) (-6483.133) * (-6478.594) [-6479.079] (-6478.189) (-6485.084) -- 0:06:34 492500 -- (-6481.699) (-6481.098) (-6481.734) [-6475.390] * [-6475.006] (-6480.229) (-6480.637) (-6482.739) -- 0:06:34 493000 -- (-6486.673) [-6478.544] (-6477.425) (-6475.309) * [-6478.193] (-6473.560) (-6482.791) (-6485.359) -- 0:06:33 493500 -- (-6485.260) (-6476.126) (-6473.724) [-6477.888] * (-6475.959) (-6476.045) (-6480.838) [-6477.506] -- 0:06:34 494000 -- (-6484.202) [-6482.082] (-6481.321) (-6482.207) * (-6482.455) [-6480.543] (-6484.787) (-6486.381) -- 0:06:33 494500 -- [-6482.521] (-6477.931) (-6479.485) (-6482.966) * [-6481.936] (-6485.930) (-6480.497) (-6482.102) -- 0:06:32 495000 -- (-6478.142) (-6481.556) (-6475.993) [-6481.012] * [-6477.529] (-6479.844) (-6484.493) (-6484.330) -- 0:06:32 Average standard deviation of split frequencies: 0.000000 495500 -- (-6477.801) [-6475.108] (-6476.342) (-6476.395) * (-6476.399) (-6475.904) (-6478.134) [-6477.111] -- 0:06:31 496000 -- (-6478.817) [-6478.964] (-6483.704) (-6481.866) * (-6480.175) (-6479.819) (-6481.902) [-6480.782] -- 0:06:31 496500 -- (-6485.862) [-6477.052] (-6482.540) (-6481.218) * (-6487.302) (-6477.276) (-6479.026) [-6477.571] -- 0:06:31 497000 -- (-6478.792) (-6483.641) [-6482.806] (-6478.136) * (-6487.812) (-6474.411) (-6480.576) [-6477.321] -- 0:06:30 497500 -- (-6487.352) [-6474.782] (-6481.622) (-6476.651) * (-6483.594) (-6478.309) (-6481.722) [-6483.217] -- 0:06:30 498000 -- (-6475.583) [-6477.709] (-6477.973) (-6475.126) * (-6484.724) (-6487.038) [-6478.523] (-6478.266) -- 0:06:30 498500 -- (-6481.405) (-6491.765) [-6477.425] (-6482.688) * [-6485.051] (-6480.944) (-6483.420) (-6484.482) -- 0:06:29 499000 -- [-6485.297] (-6486.663) (-6485.523) (-6483.693) * (-6474.598) [-6473.214] (-6475.350) (-6482.362) -- 0:06:29 499500 -- (-6481.841) (-6488.530) [-6475.142] (-6476.800) * (-6485.214) [-6483.412] (-6477.030) (-6487.093) -- 0:06:28 500000 -- (-6476.706) [-6479.361] (-6474.359) (-6477.849) * (-6482.151) [-6482.271] (-6477.989) (-6486.338) -- 0:06:29 Average standard deviation of split frequencies: 0.000000 500500 -- (-6484.338) (-6477.415) [-6479.684] (-6477.112) * (-6476.933) (-6484.640) [-6478.739] (-6479.091) -- 0:06:28 501000 -- [-6478.291] (-6483.386) (-6478.081) (-6475.182) * [-6479.620] (-6484.762) (-6482.842) (-6481.043) -- 0:06:27 501500 -- [-6482.082] (-6481.318) (-6489.231) (-6483.415) * [-6476.329] (-6481.968) (-6482.680) (-6481.950) -- 0:06:27 502000 -- (-6483.192) [-6483.122] (-6479.363) (-6476.925) * [-6477.902] (-6479.602) (-6481.892) (-6480.685) -- 0:06:26 502500 -- (-6489.478) (-6484.897) [-6473.560] (-6478.643) * [-6476.338] (-6484.906) (-6485.146) (-6484.923) -- 0:06:26 503000 -- (-6485.014) (-6483.809) (-6476.691) [-6481.197] * [-6481.322] (-6480.940) (-6485.073) (-6477.273) -- 0:06:26 503500 -- (-6485.046) [-6478.513] (-6483.976) (-6479.279) * (-6478.104) (-6482.462) [-6478.127] (-6479.818) -- 0:06:25 504000 -- [-6478.238] (-6480.034) (-6482.525) (-6479.773) * (-6477.729) [-6474.633] (-6482.552) (-6479.294) -- 0:06:25 504500 -- (-6481.435) (-6475.869) (-6480.647) [-6481.174] * (-6478.102) (-6477.612) (-6483.922) [-6481.211] -- 0:06:25 505000 -- (-6474.139) [-6477.369] (-6482.152) (-6478.947) * [-6480.532] (-6478.430) (-6487.362) (-6485.381) -- 0:06:24 Average standard deviation of split frequencies: 0.000000 505500 -- (-6478.972) [-6486.107] (-6479.591) (-6484.154) * (-6474.773) (-6477.072) (-6487.483) [-6480.632] -- 0:06:24 506000 -- (-6477.817) (-6480.456) [-6480.903] (-6474.547) * [-6486.288] (-6485.254) (-6474.408) (-6482.845) -- 0:06:23 506500 -- [-6477.582] (-6484.283) (-6485.164) (-6474.086) * [-6478.806] (-6484.666) (-6483.140) (-6480.950) -- 0:06:22 507000 -- (-6480.755) (-6486.253) (-6479.014) [-6475.149] * (-6474.711) (-6485.020) (-6475.803) [-6479.857] -- 0:06:23 507500 -- (-6480.003) (-6487.392) (-6475.389) [-6475.881] * (-6476.549) (-6479.046) [-6476.722] (-6478.079) -- 0:06:22 508000 -- (-6480.357) (-6491.288) (-6489.439) [-6477.460] * (-6478.886) (-6483.702) (-6477.602) [-6479.942] -- 0:06:22 508500 -- (-6482.199) [-6478.340] (-6475.882) (-6477.935) * [-6480.990] (-6480.280) (-6480.557) (-6483.961) -- 0:06:21 509000 -- [-6487.452] (-6477.638) (-6485.197) (-6479.126) * [-6476.033] (-6479.775) (-6481.389) (-6486.265) -- 0:06:21 509500 -- (-6487.967) (-6482.454) (-6478.113) [-6475.306] * [-6478.166] (-6481.415) (-6477.679) (-6483.152) -- 0:06:21 510000 -- (-6481.611) [-6478.890] (-6476.459) (-6478.918) * (-6475.403) (-6485.023) (-6477.645) [-6480.311] -- 0:06:20 Average standard deviation of split frequencies: 0.000000 510500 -- (-6482.400) [-6478.022] (-6475.920) (-6480.586) * (-6475.833) (-6477.606) [-6479.150] (-6473.595) -- 0:06:19 511000 -- (-6477.405) (-6472.289) (-6478.396) [-6482.097] * [-6478.756] (-6477.945) (-6480.257) (-6479.892) -- 0:06:19 511500 -- (-6476.335) (-6473.297) [-6483.631] (-6477.875) * (-6483.764) [-6477.699] (-6481.982) (-6484.005) -- 0:06:19 512000 -- (-6477.899) (-6476.437) [-6483.047] (-6479.993) * (-6477.370) (-6480.253) (-6475.262) [-6479.092] -- 0:06:19 512500 -- (-6477.980) (-6481.098) [-6476.817] (-6476.324) * (-6477.686) (-6482.465) (-6484.150) [-6473.946] -- 0:06:18 513000 -- (-6481.544) (-6475.436) (-6483.899) [-6476.753] * (-6481.885) [-6483.608] (-6480.602) (-6482.143) -- 0:06:17 513500 -- (-6482.226) (-6478.137) (-6482.047) [-6474.603] * [-6479.591] (-6477.443) (-6481.525) (-6476.280) -- 0:06:18 514000 -- (-6479.047) [-6480.865] (-6487.400) (-6478.212) * [-6475.578] (-6480.530) (-6477.034) (-6474.577) -- 0:06:17 514500 -- (-6474.618) [-6483.000] (-6489.025) (-6482.116) * (-6473.525) (-6482.294) (-6479.664) [-6477.852] -- 0:06:16 515000 -- [-6473.990] (-6481.409) (-6482.480) (-6480.645) * [-6475.680] (-6484.216) (-6475.931) (-6479.009) -- 0:06:16 Average standard deviation of split frequencies: 0.000000 515500 -- [-6478.168] (-6479.773) (-6477.564) (-6479.292) * (-6481.662) (-6480.166) (-6477.285) [-6477.546] -- 0:06:15 516000 -- (-6482.710) (-6475.603) (-6479.430) [-6482.379] * (-6477.516) [-6480.288] (-6476.326) (-6478.634) -- 0:06:16 516500 -- [-6482.381] (-6475.986) (-6482.617) (-6473.431) * (-6481.590) [-6475.110] (-6479.366) (-6483.043) -- 0:06:15 517000 -- [-6480.678] (-6481.936) (-6483.762) (-6483.322) * (-6476.332) [-6476.868] (-6480.194) (-6488.596) -- 0:06:14 517500 -- (-6477.778) (-6476.850) (-6481.643) [-6477.867] * (-6480.310) (-6483.011) (-6481.084) [-6480.905] -- 0:06:14 518000 -- (-6481.722) [-6475.483] (-6476.521) (-6485.861) * [-6474.253] (-6478.375) (-6480.695) (-6482.216) -- 0:06:14 518500 -- (-6477.117) [-6482.286] (-6482.364) (-6484.829) * (-6479.314) (-6481.393) (-6473.325) [-6476.567] -- 0:06:14 519000 -- (-6479.953) (-6483.998) [-6480.076] (-6477.236) * (-6483.255) (-6484.606) [-6475.683] (-6479.308) -- 0:06:13 519500 -- (-6485.047) (-6475.871) [-6477.079] (-6479.641) * (-6476.939) (-6481.008) [-6472.422] (-6475.711) -- 0:06:12 520000 -- (-6482.100) [-6476.709] (-6477.106) (-6476.686) * (-6475.142) [-6477.987] (-6478.538) (-6481.315) -- 0:06:12 Average standard deviation of split frequencies: 0.000000 520500 -- (-6481.642) (-6479.229) (-6483.403) [-6477.982] * [-6479.807] (-6481.344) (-6487.106) (-6478.128) -- 0:06:12 521000 -- [-6483.068] (-6480.762) (-6482.081) (-6479.955) * [-6476.278] (-6486.558) (-6480.547) (-6482.603) -- 0:06:11 521500 -- [-6477.686] (-6484.538) (-6481.971) (-6479.577) * (-6484.005) [-6481.563] (-6481.882) (-6479.852) -- 0:06:11 522000 -- [-6479.308] (-6476.220) (-6486.942) (-6478.026) * [-6477.922] (-6482.226) (-6477.184) (-6475.895) -- 0:06:10 522500 -- (-6476.499) (-6478.463) [-6483.785] (-6474.524) * (-6477.112) (-6479.024) (-6477.172) [-6481.257] -- 0:06:11 523000 -- (-6475.427) (-6487.600) (-6478.728) [-6478.216] * (-6474.536) (-6482.376) (-6479.355) [-6481.751] -- 0:06:10 523500 -- (-6480.232) (-6482.087) (-6481.729) [-6479.409] * (-6487.527) [-6484.513] (-6475.212) (-6478.618) -- 0:06:09 524000 -- (-6476.239) [-6479.689] (-6482.319) (-6480.832) * (-6477.458) [-6482.110] (-6484.430) (-6477.010) -- 0:06:09 524500 -- (-6483.636) (-6478.958) (-6477.405) [-6476.435] * (-6479.070) [-6479.449] (-6497.929) (-6480.393) -- 0:06:08 525000 -- [-6484.391] (-6484.466) (-6477.814) (-6475.599) * (-6480.605) [-6482.731] (-6490.910) (-6475.941) -- 0:06:08 Average standard deviation of split frequencies: 0.000000 525500 -- (-6482.373) (-6479.861) (-6477.077) [-6484.980] * (-6487.650) (-6483.537) [-6490.627] (-6484.846) -- 0:06:08 526000 -- (-6473.191) [-6475.103] (-6484.152) (-6482.044) * [-6476.211] (-6487.955) (-6477.401) (-6474.996) -- 0:06:07 526500 -- (-6476.819) (-6483.598) [-6484.064] (-6480.961) * [-6477.139] (-6480.715) (-6484.522) (-6477.485) -- 0:06:07 527000 -- (-6475.360) (-6477.795) (-6481.036) [-6480.010] * (-6480.993) (-6480.974) [-6481.961] (-6481.583) -- 0:06:07 527500 -- (-6479.993) (-6481.164) [-6479.760] (-6483.474) * (-6475.724) [-6479.743] (-6492.702) (-6478.767) -- 0:06:06 528000 -- (-6479.176) (-6486.734) (-6479.401) [-6484.529] * (-6480.497) [-6478.345] (-6480.992) (-6482.370) -- 0:06:06 528500 -- (-6485.299) (-6478.759) [-6477.228] (-6477.438) * (-6476.292) (-6476.779) [-6482.421] (-6482.393) -- 0:06:05 529000 -- (-6486.551) (-6483.905) (-6477.696) [-6482.675] * [-6476.536] (-6484.206) (-6476.293) (-6476.090) -- 0:06:05 529500 -- (-6480.739) (-6480.013) [-6474.821] (-6479.861) * (-6479.887) [-6484.702] (-6481.870) (-6478.693) -- 0:06:05 530000 -- [-6479.017] (-6482.871) (-6483.655) (-6482.867) * (-6479.879) [-6476.461] (-6483.397) (-6485.976) -- 0:06:04 Average standard deviation of split frequencies: 0.000000 530500 -- (-6483.932) [-6479.009] (-6483.325) (-6488.218) * (-6483.603) (-6477.122) (-6483.557) [-6478.348] -- 0:06:04 531000 -- (-6488.159) (-6475.798) (-6488.025) [-6483.631] * (-6478.697) (-6481.262) (-6490.722) [-6475.569] -- 0:06:03 531500 -- (-6475.756) [-6480.837] (-6481.004) (-6482.098) * [-6479.134] (-6477.448) (-6485.938) (-6473.114) -- 0:06:03 532000 -- (-6479.666) (-6482.217) (-6482.243) [-6484.319] * (-6481.556) (-6478.650) (-6485.027) [-6476.347] -- 0:06:03 532500 -- (-6482.607) [-6484.486] (-6475.405) (-6485.285) * (-6482.563) (-6480.382) (-6481.864) [-6480.647] -- 0:06:02 533000 -- [-6487.371] (-6484.206) (-6474.905) (-6483.731) * (-6487.921) (-6476.702) (-6484.539) [-6481.809] -- 0:06:01 533500 -- (-6479.769) (-6487.805) [-6474.400] (-6478.969) * (-6475.924) (-6476.681) [-6478.537] (-6478.987) -- 0:06:02 534000 -- (-6482.265) [-6474.257] (-6475.456) (-6480.005) * (-6478.232) (-6478.477) (-6481.369) [-6479.745] -- 0:06:01 534500 -- [-6477.695] (-6481.439) (-6477.702) (-6480.454) * (-6479.326) [-6484.875] (-6485.043) (-6477.992) -- 0:06:01 535000 -- [-6476.557] (-6483.076) (-6484.205) (-6484.176) * [-6480.228] (-6475.135) (-6482.833) (-6479.158) -- 0:06:00 Average standard deviation of split frequencies: 0.000000 535500 -- (-6485.365) [-6481.686] (-6484.135) (-6484.086) * (-6480.603) [-6478.566] (-6486.365) (-6482.071) -- 0:05:59 536000 -- (-6481.417) [-6481.387] (-6479.885) (-6476.353) * [-6483.661] (-6476.644) (-6476.496) (-6478.263) -- 0:06:00 536500 -- (-6481.102) [-6478.854] (-6477.922) (-6477.282) * (-6476.470) [-6478.400] (-6479.900) (-6481.836) -- 0:05:59 537000 -- [-6478.904] (-6486.054) (-6481.005) (-6478.963) * [-6478.585] (-6479.488) (-6487.867) (-6475.057) -- 0:05:58 537500 -- (-6478.046) (-6475.937) (-6476.977) [-6480.453] * (-6476.076) (-6484.716) [-6481.247] (-6479.531) -- 0:05:58 538000 -- [-6477.326] (-6477.187) (-6489.603) (-6482.473) * (-6476.411) (-6491.744) [-6479.938] (-6481.230) -- 0:05:58 538500 -- (-6480.463) [-6484.286] (-6490.270) (-6478.529) * (-6477.031) (-6484.236) [-6480.637] (-6477.164) -- 0:05:58 539000 -- (-6484.825) (-6484.138) (-6481.091) [-6477.697] * [-6479.712] (-6476.584) (-6475.814) (-6475.704) -- 0:05:57 539500 -- [-6482.558] (-6486.218) (-6477.137) (-6480.975) * (-6484.931) (-6477.704) (-6484.005) [-6475.369] -- 0:05:56 540000 -- (-6483.533) [-6480.383] (-6482.624) (-6481.592) * [-6486.273] (-6479.862) (-6483.660) (-6473.221) -- 0:05:56 Average standard deviation of split frequencies: 0.000000 540500 -- (-6480.451) [-6475.460] (-6482.353) (-6474.565) * [-6482.442] (-6478.609) (-6487.138) (-6479.091) -- 0:05:56 541000 -- [-6480.689] (-6477.356) (-6479.006) (-6481.321) * (-6486.522) (-6477.908) (-6484.271) [-6474.519] -- 0:05:55 541500 -- (-6472.378) (-6478.203) [-6482.538] (-6481.181) * (-6484.633) [-6474.369] (-6475.130) (-6478.847) -- 0:05:55 542000 -- (-6479.030) (-6483.839) [-6481.210] (-6477.414) * (-6486.646) (-6475.964) [-6475.993] (-6480.475) -- 0:05:54 542500 -- [-6476.348] (-6480.928) (-6475.902) (-6477.572) * (-6487.871) [-6477.316] (-6476.554) (-6482.416) -- 0:05:55 543000 -- (-6480.006) [-6483.539] (-6475.146) (-6479.670) * (-6488.875) (-6477.402) (-6480.290) [-6477.642] -- 0:05:54 543500 -- (-6475.837) (-6479.958) [-6476.949] (-6470.938) * (-6475.941) (-6486.520) [-6475.503] (-6477.256) -- 0:05:53 544000 -- [-6475.974] (-6477.981) (-6487.494) (-6472.017) * [-6476.992] (-6485.065) (-6480.613) (-6479.373) -- 0:05:53 544500 -- (-6477.702) (-6477.015) (-6489.665) [-6479.276] * [-6474.078] (-6482.619) (-6477.690) (-6480.017) -- 0:05:53 545000 -- (-6485.569) (-6483.628) [-6486.031] (-6476.479) * [-6474.979] (-6482.068) (-6482.762) (-6477.029) -- 0:05:52 Average standard deviation of split frequencies: 0.000000 545500 -- (-6476.682) (-6478.446) [-6482.416] (-6486.249) * (-6480.141) (-6479.559) [-6476.415] (-6474.268) -- 0:05:52 546000 -- [-6477.266] (-6477.725) (-6487.211) (-6480.200) * (-6485.173) [-6478.107] (-6477.621) (-6476.136) -- 0:05:51 546500 -- (-6479.776) (-6477.775) (-6485.392) [-6477.957] * (-6486.281) (-6489.253) (-6479.603) [-6477.738] -- 0:05:51 547000 -- (-6477.435) (-6476.944) (-6482.587) [-6479.018] * (-6478.338) (-6480.341) (-6480.010) [-6474.435] -- 0:05:51 547500 -- (-6474.370) (-6477.760) [-6484.011] (-6479.329) * (-6477.109) [-6474.053] (-6480.091) (-6476.245) -- 0:05:50 548000 -- (-6479.231) (-6475.583) (-6481.187) [-6479.340] * [-6486.450] (-6475.222) (-6480.781) (-6482.749) -- 0:05:50 548500 -- (-6475.839) (-6482.620) [-6484.972] (-6479.831) * (-6478.775) [-6478.071] (-6477.183) (-6477.020) -- 0:05:49 549000 -- (-6487.207) [-6480.304] (-6485.402) (-6476.489) * (-6477.891) [-6477.593] (-6476.848) (-6480.359) -- 0:05:49 549500 -- (-6480.266) (-6482.325) (-6481.804) [-6478.329] * (-6480.831) [-6476.395] (-6477.233) (-6491.077) -- 0:05:49 550000 -- (-6483.509) (-6475.865) (-6478.577) [-6472.543] * (-6482.125) (-6477.318) [-6475.029] (-6482.602) -- 0:05:48 Average standard deviation of split frequencies: 0.000000 550500 -- (-6481.740) [-6483.074] (-6483.675) (-6475.637) * [-6485.944] (-6474.740) (-6481.409) (-6489.683) -- 0:05:48 551000 -- (-6481.039) [-6474.332] (-6476.246) (-6480.176) * [-6476.230] (-6480.938) (-6480.560) (-6476.310) -- 0:05:47 551500 -- [-6473.556] (-6485.536) (-6482.937) (-6490.666) * (-6483.167) [-6474.043] (-6477.121) (-6475.896) -- 0:05:47 552000 -- (-6477.754) (-6481.943) (-6480.385) [-6486.631] * (-6476.398) (-6482.947) [-6484.037] (-6476.755) -- 0:05:47 552500 -- (-6485.074) (-6480.090) [-6481.264] (-6480.701) * [-6483.757] (-6476.510) (-6482.445) (-6479.531) -- 0:05:46 553000 -- [-6480.956] (-6486.266) (-6474.314) (-6480.773) * (-6484.328) [-6480.562] (-6478.441) (-6482.004) -- 0:05:45 553500 -- [-6478.708] (-6479.413) (-6471.026) (-6485.760) * (-6478.222) (-6475.359) (-6477.971) [-6475.621] -- 0:05:46 554000 -- (-6479.240) (-6481.518) [-6479.240] (-6483.935) * [-6477.505] (-6482.382) (-6482.229) (-6479.722) -- 0:05:45 554500 -- [-6476.359] (-6482.426) (-6479.110) (-6483.366) * (-6478.042) (-6473.862) [-6482.455] (-6476.905) -- 0:05:45 555000 -- (-6483.627) (-6477.746) [-6479.143] (-6484.700) * (-6481.858) (-6478.944) (-6477.594) [-6475.924] -- 0:05:44 Average standard deviation of split frequencies: 0.000000 555500 -- (-6480.356) (-6478.084) [-6480.348] (-6481.467) * (-6476.855) [-6479.935] (-6481.252) (-6476.678) -- 0:05:44 556000 -- (-6478.427) (-6479.396) (-6480.536) [-6476.060] * (-6476.840) (-6476.818) [-6478.271] (-6478.270) -- 0:05:44 556500 -- (-6482.872) (-6481.308) [-6474.190] (-6482.151) * (-6476.993) (-6479.141) (-6477.439) [-6483.817] -- 0:05:43 557000 -- (-6482.944) (-6476.538) [-6475.710] (-6487.670) * (-6482.270) (-6481.175) [-6475.934] (-6476.833) -- 0:05:43 557500 -- (-6477.082) (-6478.742) [-6478.698] (-6487.530) * (-6479.353) (-6483.054) [-6480.878] (-6476.070) -- 0:05:42 558000 -- (-6487.535) [-6477.110] (-6486.485) (-6482.244) * (-6479.642) [-6476.361] (-6480.988) (-6480.987) -- 0:05:42 558500 -- (-6487.209) (-6480.855) [-6476.057] (-6499.685) * (-6482.676) (-6480.139) [-6480.939] (-6477.475) -- 0:05:42 559000 -- (-6481.438) (-6477.293) [-6477.078] (-6488.343) * (-6478.093) [-6481.436] (-6479.885) (-6480.853) -- 0:05:41 559500 -- (-6489.005) (-6473.366) [-6484.580] (-6482.127) * (-6483.783) [-6479.769] (-6480.182) (-6480.460) -- 0:05:41 560000 -- (-6479.940) [-6475.903] (-6479.734) (-6477.284) * [-6477.518] (-6476.259) (-6473.059) (-6480.619) -- 0:05:41 Average standard deviation of split frequencies: 0.000000 560500 -- (-6480.404) (-6476.706) [-6475.134] (-6484.494) * (-6478.247) (-6480.232) [-6471.973] (-6481.009) -- 0:05:40 561000 -- [-6477.942] (-6482.092) (-6477.375) (-6486.633) * (-6474.971) (-6482.820) [-6477.785] (-6484.406) -- 0:05:40 561500 -- [-6478.781] (-6482.016) (-6484.585) (-6481.672) * [-6483.339] (-6483.580) (-6482.010) (-6479.016) -- 0:05:39 562000 -- (-6485.639) [-6473.407] (-6478.928) (-6481.852) * (-6479.527) (-6479.389) (-6483.587) [-6473.508] -- 0:05:39 562500 -- (-6482.815) (-6476.392) [-6476.182] (-6483.481) * (-6490.774) (-6483.671) [-6481.362] (-6475.158) -- 0:05:39 563000 -- (-6473.791) (-6476.119) (-6476.429) [-6476.890] * [-6477.907] (-6477.513) (-6483.066) (-6474.845) -- 0:05:38 563500 -- (-6485.947) [-6475.245] (-6480.175) (-6484.658) * [-6483.116] (-6484.249) (-6483.385) (-6477.855) -- 0:05:38 564000 -- [-6475.396] (-6481.149) (-6484.196) (-6479.992) * (-6482.652) [-6482.988] (-6483.187) (-6478.939) -- 0:05:37 564500 -- [-6475.034] (-6483.699) (-6479.034) (-6483.156) * (-6476.528) (-6474.628) [-6482.736] (-6485.322) -- 0:05:37 565000 -- [-6477.524] (-6478.832) (-6477.278) (-6486.341) * [-6477.228] (-6477.263) (-6479.727) (-6477.745) -- 0:05:37 Average standard deviation of split frequencies: 0.000000 565500 -- (-6481.193) (-6477.445) (-6480.982) [-6483.212] * [-6478.866] (-6477.803) (-6490.548) (-6481.557) -- 0:05:36 566000 -- (-6474.503) (-6479.935) (-6478.403) [-6479.971] * (-6480.123) (-6478.296) (-6489.373) [-6485.724] -- 0:05:35 566500 -- [-6476.727] (-6487.617) (-6485.545) (-6487.529) * [-6477.652] (-6480.953) (-6477.420) (-6477.590) -- 0:05:35 567000 -- [-6476.569] (-6480.316) (-6483.298) (-6486.719) * (-6477.942) (-6484.971) [-6477.882] (-6477.131) -- 0:05:35 567500 -- [-6478.499] (-6481.781) (-6478.165) (-6483.365) * (-6479.141) (-6479.505) (-6477.037) [-6473.801] -- 0:05:35 568000 -- (-6480.817) [-6474.748] (-6480.567) (-6492.002) * (-6474.982) [-6478.495] (-6479.783) (-6477.164) -- 0:05:34 568500 -- (-6476.255) [-6479.196] (-6490.554) (-6484.526) * (-6479.399) (-6478.182) [-6475.991] (-6484.543) -- 0:05:33 569000 -- (-6479.899) (-6480.506) [-6485.170] (-6477.808) * (-6479.510) (-6480.459) [-6477.701] (-6484.677) -- 0:05:34 569500 -- (-6481.754) (-6477.836) [-6479.764] (-6477.963) * (-6482.522) (-6483.609) [-6476.333] (-6488.285) -- 0:05:33 570000 -- (-6483.220) [-6476.877] (-6475.718) (-6484.122) * (-6485.360) [-6478.617] (-6476.716) (-6478.076) -- 0:05:32 Average standard deviation of split frequencies: 0.000000 570500 -- [-6480.171] (-6482.625) (-6474.127) (-6480.114) * [-6478.602] (-6481.590) (-6473.838) (-6480.606) -- 0:05:32 571000 -- (-6482.644) [-6473.463] (-6474.012) (-6491.016) * (-6478.236) (-6476.317) (-6477.142) [-6474.543] -- 0:05:32 571500 -- (-6473.742) [-6477.450] (-6474.940) (-6483.091) * (-6480.665) (-6484.869) [-6478.577] (-6474.581) -- 0:05:32 572000 -- [-6474.534] (-6487.377) (-6477.077) (-6483.330) * (-6481.292) (-6479.145) (-6476.266) [-6478.197] -- 0:05:31 572500 -- (-6476.073) [-6475.456] (-6475.461) (-6475.712) * [-6476.508] (-6484.936) (-6479.408) (-6483.403) -- 0:05:30 573000 -- [-6474.187] (-6479.190) (-6479.475) (-6481.440) * (-6477.718) (-6486.572) (-6481.451) [-6478.571] -- 0:05:30 573500 -- (-6475.787) (-6488.184) (-6479.295) [-6485.212] * [-6481.849] (-6483.987) (-6477.173) (-6481.951) -- 0:05:30 574000 -- [-6478.894] (-6481.133) (-6485.889) (-6480.302) * [-6478.884] (-6481.095) (-6476.535) (-6476.925) -- 0:05:29 574500 -- (-6474.715) (-6479.340) (-6483.607) [-6476.644] * [-6477.979] (-6477.803) (-6476.108) (-6476.959) -- 0:05:29 575000 -- (-6479.505) (-6482.026) (-6484.263) [-6476.255] * [-6483.804] (-6476.011) (-6481.770) (-6482.072) -- 0:05:28 Average standard deviation of split frequencies: 0.000000 575500 -- (-6474.729) [-6485.062] (-6479.604) (-6483.539) * (-6483.121) [-6474.687] (-6481.480) (-6481.925) -- 0:05:28 576000 -- [-6474.379] (-6486.413) (-6482.027) (-6476.759) * (-6477.812) [-6479.829] (-6484.744) (-6477.163) -- 0:05:28 576500 -- (-6480.760) (-6488.818) (-6477.769) [-6480.123] * [-6481.203] (-6483.592) (-6478.323) (-6474.961) -- 0:05:27 577000 -- [-6481.162] (-6483.091) (-6483.208) (-6484.146) * (-6486.759) [-6473.034] (-6474.268) (-6487.710) -- 0:05:27 577500 -- (-6479.327) [-6487.001] (-6482.049) (-6482.658) * (-6472.668) (-6476.582) [-6480.476] (-6477.936) -- 0:05:27 578000 -- (-6492.761) (-6484.382) [-6483.439] (-6480.409) * (-6480.012) (-6476.514) [-6475.727] (-6475.160) -- 0:05:26 578500 -- (-6476.231) (-6484.809) (-6477.476) [-6485.359] * (-6476.913) (-6479.449) (-6482.239) [-6483.173] -- 0:05:26 579000 -- (-6476.410) (-6480.281) [-6478.643] (-6490.813) * [-6479.749] (-6489.734) (-6480.790) (-6489.306) -- 0:05:25 579500 -- (-6479.023) [-6475.189] (-6482.880) (-6477.028) * (-6482.882) (-6488.385) (-6480.589) [-6489.146] -- 0:05:25 580000 -- (-6488.318) [-6477.706] (-6482.811) (-6479.335) * [-6477.057] (-6479.769) (-6477.247) (-6490.700) -- 0:05:25 Average standard deviation of split frequencies: 0.000000 580500 -- (-6476.839) (-6479.448) (-6486.061) [-6485.656] * [-6472.630] (-6477.866) (-6490.112) (-6486.607) -- 0:05:24 581000 -- (-6478.969) [-6482.273] (-6485.730) (-6481.168) * (-6482.268) (-6479.631) [-6484.628] (-6483.318) -- 0:05:24 581500 -- [-6479.364] (-6477.080) (-6479.452) (-6477.628) * (-6476.819) (-6475.491) [-6474.360] (-6481.466) -- 0:05:23 582000 -- (-6480.743) (-6480.288) (-6480.475) [-6477.177] * (-6477.739) (-6481.935) [-6483.346] (-6477.194) -- 0:05:23 582500 -- (-6489.109) [-6477.726] (-6485.631) (-6484.434) * [-6478.219] (-6481.861) (-6477.262) (-6480.321) -- 0:05:23 583000 -- (-6477.260) [-6486.448] (-6480.985) (-6483.818) * (-6476.933) (-6476.860) (-6478.724) [-6482.190] -- 0:05:22 583500 -- (-6481.776) (-6486.126) (-6479.013) [-6481.131] * (-6473.859) (-6478.887) [-6479.744] (-6491.427) -- 0:05:22 584000 -- (-6477.030) (-6478.275) (-6481.908) [-6478.856] * [-6479.692] (-6482.799) (-6477.672) (-6479.603) -- 0:05:21 584500 -- [-6478.669] (-6480.341) (-6476.262) (-6480.047) * (-6477.055) (-6492.855) (-6482.067) [-6475.467] -- 0:05:22 585000 -- [-6484.867] (-6486.439) (-6478.788) (-6477.738) * (-6481.784) (-6480.388) [-6472.634] (-6478.419) -- 0:05:21 Average standard deviation of split frequencies: 0.000000 585500 -- [-6477.090] (-6485.251) (-6484.367) (-6485.294) * (-6489.906) (-6482.547) (-6476.326) [-6476.192] -- 0:05:20 586000 -- (-6479.949) [-6484.457] (-6477.053) (-6483.071) * [-6478.920] (-6495.316) (-6473.887) (-6486.372) -- 0:05:20 586500 -- (-6475.170) (-6485.525) (-6477.633) [-6481.396] * (-6472.845) [-6479.471] (-6481.801) (-6481.185) -- 0:05:20 587000 -- (-6479.093) [-6480.880] (-6481.678) (-6478.945) * (-6477.329) (-6479.214) (-6481.050) [-6476.662] -- 0:05:19 587500 -- [-6473.812] (-6485.211) (-6481.185) (-6474.944) * (-6473.539) [-6477.405] (-6480.421) (-6478.512) -- 0:05:19 588000 -- [-6478.472] (-6485.472) (-6477.838) (-6481.751) * (-6481.858) [-6474.293] (-6481.067) (-6487.620) -- 0:05:18 588500 -- (-6479.630) (-6478.801) [-6481.727] (-6478.489) * (-6484.335) [-6476.945] (-6484.796) (-6488.650) -- 0:05:18 589000 -- (-6473.706) [-6477.967] (-6482.375) (-6477.990) * (-6485.956) (-6478.300) [-6478.444] (-6482.517) -- 0:05:18 589500 -- (-6479.019) (-6476.938) [-6482.894] (-6480.468) * (-6483.783) (-6485.841) [-6474.818] (-6481.233) -- 0:05:17 590000 -- (-6488.426) [-6471.547] (-6481.623) (-6487.101) * [-6474.144] (-6480.219) (-6474.357) (-6481.765) -- 0:05:17 Average standard deviation of split frequencies: 0.000000 590500 -- (-6478.721) [-6478.417] (-6479.727) (-6484.588) * [-6474.368] (-6478.342) (-6475.778) (-6483.030) -- 0:05:16 591000 -- (-6490.380) (-6478.223) (-6481.907) [-6483.248] * (-6481.486) [-6477.090] (-6475.313) (-6475.132) -- 0:05:16 591500 -- (-6481.631) (-6477.264) [-6474.882] (-6480.996) * [-6477.588] (-6492.201) (-6477.235) (-6489.625) -- 0:05:16 592000 -- [-6476.906] (-6476.380) (-6482.993) (-6482.414) * (-6481.550) [-6476.922] (-6484.493) (-6479.641) -- 0:05:15 592500 -- [-6481.323] (-6482.551) (-6481.689) (-6477.109) * (-6480.577) [-6478.966] (-6482.307) (-6483.620) -- 0:05:15 593000 -- (-6478.874) (-6482.159) [-6476.560] (-6480.141) * (-6479.980) [-6476.596] (-6483.285) (-6483.373) -- 0:05:15 593500 -- (-6476.763) (-6486.617) [-6475.862] (-6479.848) * (-6479.501) (-6485.508) (-6481.720) [-6480.107] -- 0:05:14 594000 -- (-6480.961) [-6475.907] (-6480.365) (-6476.803) * (-6479.967) (-6488.499) (-6483.540) [-6477.822] -- 0:05:14 594500 -- (-6481.729) [-6475.264] (-6480.711) (-6476.879) * (-6477.423) (-6481.514) (-6475.096) [-6482.888] -- 0:05:13 595000 -- (-6481.287) [-6476.117] (-6476.031) (-6473.198) * (-6474.296) (-6480.731) [-6475.237] (-6478.078) -- 0:05:13 Average standard deviation of split frequencies: 0.000000 595500 -- (-6476.919) (-6477.542) (-6480.837) [-6480.507] * (-6477.901) (-6484.828) [-6477.653] (-6474.051) -- 0:05:13 596000 -- (-6477.267) [-6473.502] (-6483.918) (-6479.409) * (-6479.773) (-6480.152) (-6474.677) [-6478.764] -- 0:05:12 596500 -- (-6477.129) (-6475.346) (-6482.154) [-6476.295] * (-6487.208) (-6480.660) [-6480.245] (-6478.152) -- 0:05:12 597000 -- (-6482.905) (-6476.782) [-6481.003] (-6486.203) * (-6480.510) (-6477.011) (-6478.713) [-6483.485] -- 0:05:11 597500 -- (-6477.631) [-6479.148] (-6481.788) (-6479.353) * (-6484.423) [-6478.112] (-6481.898) (-6485.288) -- 0:05:11 598000 -- (-6485.710) (-6477.207) (-6488.725) [-6482.788] * (-6481.410) (-6479.746) [-6472.606] (-6485.021) -- 0:05:11 598500 -- (-6479.417) [-6474.761] (-6477.405) (-6476.855) * (-6476.673) (-6485.507) (-6481.996) [-6486.494] -- 0:05:10 599000 -- (-6477.557) [-6474.754] (-6486.857) (-6479.013) * (-6484.530) [-6477.655] (-6475.278) (-6481.019) -- 0:05:10 599500 -- (-6474.044) (-6484.084) (-6481.960) [-6478.250] * [-6480.510] (-6479.401) (-6475.397) (-6480.231) -- 0:05:09 600000 -- [-6476.287] (-6476.540) (-6479.168) (-6477.684) * (-6482.915) (-6480.283) [-6476.379] (-6483.338) -- 0:05:10 Average standard deviation of split frequencies: 0.000000 600500 -- (-6484.980) (-6485.162) (-6484.492) [-6475.310] * (-6478.683) [-6480.132] (-6473.507) (-6481.530) -- 0:05:09 601000 -- (-6477.757) (-6482.608) (-6481.891) [-6481.961] * (-6478.319) (-6479.423) [-6477.676] (-6478.142) -- 0:05:08 601500 -- (-6479.334) (-6479.063) [-6474.578] (-6482.331) * (-6480.555) [-6474.457] (-6480.439) (-6482.426) -- 0:05:08 602000 -- [-6478.017] (-6480.302) (-6481.616) (-6481.221) * (-6475.988) [-6481.090] (-6476.565) (-6486.418) -- 0:05:08 602500 -- (-6485.718) (-6479.612) (-6479.047) [-6477.601] * (-6482.657) (-6478.420) (-6483.752) [-6475.655] -- 0:05:08 603000 -- (-6484.041) (-6480.283) (-6471.229) [-6476.420] * (-6480.973) (-6479.248) [-6483.728] (-6479.144) -- 0:05:07 603500 -- (-6478.946) (-6482.928) [-6475.840] (-6483.323) * [-6478.594] (-6477.728) (-6480.277) (-6475.971) -- 0:05:06 604000 -- (-6477.531) (-6479.750) [-6480.626] (-6478.627) * (-6478.837) (-6488.809) [-6475.304] (-6480.860) -- 0:05:06 604500 -- (-6480.034) [-6480.547] (-6479.096) (-6484.585) * (-6481.041) [-6474.030] (-6483.270) (-6482.232) -- 0:05:06 605000 -- [-6481.143] (-6479.024) (-6484.549) (-6483.317) * [-6475.333] (-6490.947) (-6489.092) (-6488.109) -- 0:05:06 Average standard deviation of split frequencies: 0.000000 605500 -- (-6476.668) [-6476.647] (-6483.602) (-6478.090) * (-6488.826) (-6477.670) [-6476.426] (-6479.123) -- 0:05:05 606000 -- (-6480.913) [-6476.032] (-6480.299) (-6474.842) * [-6483.683] (-6476.286) (-6481.536) (-6481.857) -- 0:05:04 606500 -- (-6488.403) (-6475.065) [-6479.164] (-6482.089) * (-6477.551) [-6477.592] (-6482.758) (-6492.209) -- 0:05:04 607000 -- (-6480.066) (-6484.734) [-6476.962] (-6487.550) * (-6477.900) (-6475.212) [-6474.195] (-6483.521) -- 0:05:04 607500 -- (-6480.550) [-6478.999] (-6480.514) (-6490.172) * (-6480.232) [-6473.844] (-6475.247) (-6484.906) -- 0:05:04 608000 -- (-6474.404) (-6474.233) [-6482.694] (-6487.868) * (-6479.950) (-6475.821) (-6475.688) [-6482.459] -- 0:05:03 608500 -- (-6479.292) [-6474.584] (-6485.194) (-6485.942) * (-6477.161) (-6475.465) (-6482.482) [-6483.796] -- 0:05:03 609000 -- [-6473.421] (-6488.349) (-6481.108) (-6490.671) * (-6486.406) [-6481.094] (-6479.393) (-6479.084) -- 0:05:03 609500 -- (-6479.677) (-6490.447) [-6480.595] (-6489.908) * (-6481.959) (-6475.966) (-6486.028) [-6479.201] -- 0:05:02 610000 -- [-6475.073] (-6483.810) (-6477.216) (-6485.284) * (-6482.328) (-6476.675) (-6482.876) [-6481.942] -- 0:05:01 Average standard deviation of split frequencies: 0.000000 610500 -- (-6478.668) (-6478.915) [-6476.938] (-6483.716) * [-6487.909] (-6484.564) (-6486.949) (-6482.207) -- 0:05:01 611000 -- [-6483.040] (-6480.492) (-6478.463) (-6483.482) * (-6482.932) (-6484.150) (-6490.591) [-6479.337] -- 0:05:01 611500 -- (-6483.590) (-6483.513) [-6484.452] (-6480.404) * (-6477.057) [-6488.810] (-6481.299) (-6481.805) -- 0:05:01 612000 -- (-6480.067) [-6478.770] (-6486.775) (-6476.521) * (-6480.350) (-6489.382) [-6476.157] (-6488.226) -- 0:05:00 612500 -- (-6478.969) (-6478.553) (-6477.935) [-6476.323] * [-6477.703] (-6480.135) (-6476.954) (-6477.440) -- 0:04:59 613000 -- [-6481.632] (-6486.870) (-6472.351) (-6478.073) * (-6479.619) [-6479.403] (-6477.794) (-6478.869) -- 0:04:59 613500 -- (-6479.196) (-6488.512) [-6478.259] (-6481.345) * (-6479.827) (-6482.820) (-6487.875) [-6478.520] -- 0:04:59 614000 -- (-6480.576) (-6490.881) (-6478.329) [-6474.736] * [-6474.772] (-6475.011) (-6477.027) (-6483.760) -- 0:04:59 614500 -- (-6476.961) (-6488.796) [-6482.889] (-6473.772) * [-6475.296] (-6484.944) (-6473.328) (-6483.138) -- 0:04:58 615000 -- (-6480.313) (-6479.670) (-6480.707) [-6487.019] * [-6478.444] (-6481.027) (-6474.775) (-6476.807) -- 0:04:57 Average standard deviation of split frequencies: 0.000000 615500 -- (-6478.143) (-6481.816) (-6482.084) [-6476.572] * (-6481.040) (-6475.785) [-6474.878] (-6479.110) -- 0:04:57 616000 -- [-6476.400] (-6480.863) (-6478.413) (-6482.923) * [-6476.004] (-6481.108) (-6477.564) (-6484.371) -- 0:04:57 616500 -- (-6481.661) [-6473.536] (-6480.949) (-6485.072) * (-6480.886) (-6480.145) (-6483.324) [-6473.898] -- 0:04:57 617000 -- (-6481.729) [-6475.596] (-6482.059) (-6488.852) * (-6481.691) [-6476.772] (-6474.433) (-6481.697) -- 0:04:56 617500 -- (-6477.587) (-6483.320) [-6481.774] (-6485.420) * (-6487.994) [-6479.023] (-6483.188) (-6475.752) -- 0:04:56 618000 -- (-6482.146) (-6483.600) (-6478.652) [-6488.976] * (-6479.741) (-6476.537) (-6478.279) [-6475.776] -- 0:04:56 618500 -- [-6481.342] (-6477.856) (-6479.383) (-6477.814) * (-6484.323) [-6478.701] (-6478.938) (-6476.085) -- 0:04:55 619000 -- (-6484.401) (-6477.787) [-6488.276] (-6485.067) * (-6473.832) [-6480.392] (-6478.828) (-6496.264) -- 0:04:55 619500 -- (-6479.347) [-6475.235] (-6477.647) (-6480.911) * (-6472.918) [-6478.244] (-6480.040) (-6486.902) -- 0:04:54 620000 -- (-6484.883) (-6480.256) [-6484.326] (-6478.994) * (-6472.405) (-6479.653) (-6478.810) [-6480.314] -- 0:04:54 Average standard deviation of split frequencies: 0.000000 620500 -- (-6480.467) (-6482.904) (-6488.635) [-6478.118] * (-6483.928) (-6479.037) (-6473.513) [-6480.886] -- 0:04:54 621000 -- (-6480.853) [-6478.520] (-6480.205) (-6476.010) * (-6480.178) [-6482.115] (-6477.200) (-6480.904) -- 0:04:53 621500 -- (-6477.076) (-6477.588) [-6479.615] (-6482.216) * (-6477.898) (-6483.190) [-6479.902] (-6483.716) -- 0:04:53 622000 -- (-6481.158) (-6480.627) [-6474.058] (-6481.811) * (-6487.272) (-6480.449) [-6484.164] (-6478.131) -- 0:04:52 622500 -- [-6475.064] (-6481.319) (-6479.245) (-6478.789) * [-6491.587] (-6480.421) (-6477.967) (-6480.925) -- 0:04:52 623000 -- (-6474.337) (-6484.352) (-6482.950) [-6475.001] * (-6480.351) (-6475.590) (-6479.699) [-6480.979] -- 0:04:52 623500 -- (-6483.245) [-6483.005] (-6489.691) (-6482.389) * (-6483.633) (-6478.505) [-6477.213] (-6476.221) -- 0:04:51 624000 -- (-6481.014) (-6479.260) [-6475.339] (-6482.568) * [-6479.657] (-6476.946) (-6485.716) (-6475.899) -- 0:04:51 624500 -- [-6482.727] (-6483.637) (-6476.058) (-6478.071) * [-6479.248] (-6476.897) (-6474.090) (-6474.808) -- 0:04:51 625000 -- (-6481.327) (-6474.998) (-6479.016) [-6477.471] * (-6478.319) [-6482.567] (-6481.359) (-6476.533) -- 0:04:50 Average standard deviation of split frequencies: 0.000000 625500 -- [-6478.075] (-6486.589) (-6478.798) (-6477.043) * (-6477.448) (-6486.281) [-6474.386] (-6481.699) -- 0:04:50 626000 -- (-6478.404) (-6480.403) [-6477.194] (-6478.851) * (-6479.548) [-6478.147] (-6479.647) (-6479.440) -- 0:04:49 626500 -- (-6474.583) [-6475.166] (-6478.808) (-6473.149) * (-6479.360) (-6477.957) [-6479.661] (-6483.737) -- 0:04:49 627000 -- (-6480.249) [-6473.289] (-6485.360) (-6477.987) * (-6482.061) (-6478.959) [-6481.368] (-6477.407) -- 0:04:49 627500 -- (-6477.670) [-6479.077] (-6488.250) (-6479.839) * (-6486.395) [-6477.826] (-6473.784) (-6482.735) -- 0:04:48 628000 -- (-6483.563) [-6478.165] (-6482.259) (-6475.589) * (-6486.421) [-6478.188] (-6477.112) (-6479.734) -- 0:04:48 628500 -- (-6484.424) (-6477.962) [-6480.580] (-6481.147) * [-6482.322] (-6475.498) (-6481.915) (-6474.469) -- 0:04:47 629000 -- [-6475.771] (-6478.146) (-6483.750) (-6480.212) * (-6485.012) (-6480.818) [-6473.595] (-6486.172) -- 0:04:47 629500 -- (-6479.486) (-6475.281) (-6489.721) [-6480.510] * (-6482.130) (-6481.011) [-6479.050] (-6486.059) -- 0:04:47 630000 -- (-6479.253) [-6481.110] (-6481.579) (-6477.166) * (-6472.910) (-6476.405) (-6480.556) [-6477.161] -- 0:04:46 Average standard deviation of split frequencies: 0.000000 630500 -- (-6473.628) [-6478.499] (-6484.202) (-6478.024) * [-6478.446] (-6477.400) (-6480.291) (-6479.601) -- 0:04:46 631000 -- (-6476.257) [-6477.928] (-6487.422) (-6480.584) * (-6476.712) (-6474.622) [-6475.603] (-6478.840) -- 0:04:45 631500 -- [-6477.550] (-6483.210) (-6475.946) (-6484.427) * (-6480.535) [-6476.214] (-6477.133) (-6472.193) -- 0:04:45 632000 -- (-6477.235) (-6478.649) [-6482.333] (-6482.508) * [-6481.353] (-6477.232) (-6481.494) (-6480.418) -- 0:04:45 632500 -- (-6488.392) (-6486.138) (-6480.816) [-6481.812] * (-6483.512) (-6473.244) (-6484.128) [-6477.029] -- 0:04:44 633000 -- (-6484.803) (-6480.501) [-6480.683] (-6474.830) * (-6481.738) (-6484.745) (-6483.504) [-6475.043] -- 0:04:44 633500 -- (-6496.962) (-6482.655) (-6481.324) [-6485.869] * (-6473.722) [-6476.253] (-6479.821) (-6479.844) -- 0:04:44 634000 -- (-6485.458) (-6481.881) (-6481.391) [-6480.215] * (-6479.316) (-6480.888) [-6476.458] (-6482.052) -- 0:04:43 634500 -- (-6479.090) (-6484.738) [-6482.154] (-6489.234) * (-6477.221) [-6483.888] (-6481.650) (-6479.384) -- 0:04:43 635000 -- (-6480.092) (-6481.495) [-6477.422] (-6484.209) * (-6476.970) [-6477.050] (-6479.641) (-6472.774) -- 0:04:42 Average standard deviation of split frequencies: 0.000000 635500 -- (-6475.319) (-6484.266) (-6483.186) [-6478.392] * (-6474.741) (-6475.669) (-6479.343) [-6478.824] -- 0:04:42 636000 -- (-6476.578) (-6477.564) (-6474.949) [-6475.413] * (-6479.352) [-6473.127] (-6479.058) (-6499.434) -- 0:04:42 636500 -- [-6481.044] (-6479.669) (-6475.067) (-6479.231) * (-6474.737) (-6481.553) (-6479.458) [-6479.072] -- 0:04:41 637000 -- (-6480.693) (-6476.961) [-6474.531] (-6480.458) * (-6479.417) (-6487.290) [-6475.525] (-6478.278) -- 0:04:41 637500 -- [-6478.172] (-6478.861) (-6478.387) (-6478.901) * [-6475.668] (-6481.048) (-6478.138) (-6484.738) -- 0:04:40 638000 -- [-6482.058] (-6479.384) (-6482.287) (-6477.713) * (-6479.797) (-6473.058) (-6476.418) [-6483.418] -- 0:04:40 638500 -- [-6479.070] (-6477.721) (-6477.038) (-6480.081) * (-6474.716) [-6475.078] (-6477.051) (-6480.628) -- 0:04:40 639000 -- (-6480.677) (-6479.732) (-6480.753) [-6474.593] * (-6476.761) (-6475.922) (-6479.128) [-6480.523] -- 0:04:39 639500 -- (-6480.202) (-6482.501) (-6482.737) [-6480.992] * (-6489.531) (-6486.771) (-6474.651) [-6477.853] -- 0:04:39 640000 -- (-6477.131) (-6480.131) [-6485.201] (-6485.095) * (-6477.915) (-6483.302) [-6477.773] (-6480.654) -- 0:04:39 Average standard deviation of split frequencies: 0.000000 640500 -- (-6483.583) (-6479.845) (-6481.262) [-6474.639] * (-6475.384) (-6479.483) [-6484.677] (-6483.724) -- 0:04:38 641000 -- (-6480.327) (-6477.957) [-6478.228] (-6482.441) * [-6480.504] (-6477.948) (-6481.834) (-6480.534) -- 0:04:38 641500 -- (-6475.259) (-6478.687) (-6482.295) [-6482.284] * [-6479.977] (-6482.284) (-6480.591) (-6481.590) -- 0:04:37 642000 -- (-6484.491) (-6481.931) [-6475.859] (-6487.307) * (-6484.763) (-6483.857) (-6474.505) [-6476.073] -- 0:04:37 642500 -- (-6479.509) [-6479.315] (-6477.008) (-6480.660) * (-6480.244) (-6485.286) [-6475.588] (-6478.039) -- 0:04:37 643000 -- (-6480.251) (-6481.883) (-6485.867) [-6474.914] * (-6474.646) (-6479.653) (-6474.740) [-6487.123] -- 0:04:36 643500 -- (-6480.273) [-6485.901] (-6478.441) (-6483.020) * (-6473.188) [-6477.241] (-6480.204) (-6485.765) -- 0:04:36 644000 -- (-6491.718) (-6480.343) (-6481.173) [-6479.214] * (-6479.858) [-6476.247] (-6483.201) (-6480.300) -- 0:04:35 644500 -- (-6492.506) (-6483.113) [-6485.518] (-6475.027) * [-6477.238] (-6477.407) (-6478.814) (-6479.387) -- 0:04:35 645000 -- (-6476.846) (-6484.028) [-6476.703] (-6474.394) * (-6475.465) [-6474.859] (-6478.911) (-6482.835) -- 0:04:35 Average standard deviation of split frequencies: 0.000000 645500 -- (-6475.607) (-6479.549) [-6485.049] (-6485.276) * (-6475.076) [-6479.180] (-6487.597) (-6483.927) -- 0:04:34 646000 -- (-6477.465) (-6483.231) (-6484.224) [-6481.423] * (-6482.503) [-6481.237] (-6481.947) (-6483.452) -- 0:04:34 646500 -- (-6477.236) (-6478.305) (-6477.483) [-6476.808] * (-6492.981) (-6482.118) (-6482.187) [-6477.735] -- 0:04:33 647000 -- (-6478.400) (-6480.922) (-6478.200) [-6476.506] * (-6482.101) [-6474.299] (-6473.585) (-6484.625) -- 0:04:33 647500 -- (-6481.015) (-6485.098) (-6478.746) [-6478.174] * (-6477.886) [-6475.123] (-6476.154) (-6478.138) -- 0:04:33 648000 -- (-6483.814) (-6478.448) [-6486.070] (-6480.662) * [-6475.721] (-6479.838) (-6487.572) (-6478.447) -- 0:04:32 648500 -- (-6483.989) [-6472.483] (-6475.514) (-6478.540) * [-6478.506] (-6484.878) (-6481.655) (-6479.691) -- 0:04:32 649000 -- (-6481.018) [-6482.048] (-6489.795) (-6478.245) * [-6476.045] (-6483.620) (-6479.465) (-6483.689) -- 0:04:32 649500 -- (-6476.160) (-6477.158) (-6480.932) [-6475.325] * [-6478.459] (-6476.262) (-6482.604) (-6476.835) -- 0:04:31 650000 -- [-6477.563] (-6484.141) (-6480.030) (-6479.971) * (-6478.744) (-6477.374) (-6481.104) [-6478.319] -- 0:04:31 Average standard deviation of split frequencies: 0.000000 650500 -- (-6486.340) (-6490.927) (-6481.260) [-6477.138] * (-6484.400) (-6475.201) (-6486.674) [-6476.255] -- 0:04:30 651000 -- (-6477.115) (-6485.905) (-6480.433) [-6476.214] * (-6478.861) (-6481.711) (-6492.114) [-6491.003] -- 0:04:30 651500 -- (-6482.804) [-6480.524] (-6479.281) (-6478.683) * (-6477.401) [-6485.109] (-6488.946) (-6481.764) -- 0:04:30 652000 -- (-6483.190) [-6477.653] (-6488.879) (-6477.917) * (-6485.072) (-6483.520) (-6473.862) [-6480.204] -- 0:04:29 652500 -- [-6486.602] (-6486.315) (-6477.558) (-6481.635) * (-6476.532) (-6475.391) [-6478.995] (-6476.604) -- 0:04:29 653000 -- (-6483.752) (-6480.046) (-6476.426) [-6473.289] * (-6474.525) (-6482.471) [-6485.733] (-6474.937) -- 0:04:28 653500 -- (-6488.108) [-6473.374] (-6476.229) (-6476.883) * [-6482.327] (-6479.600) (-6479.738) (-6478.898) -- 0:04:28 654000 -- (-6478.811) (-6483.885) (-6481.398) [-6480.188] * (-6476.382) (-6475.343) (-6479.249) [-6477.456] -- 0:04:28 654500 -- (-6480.677) (-6478.578) (-6480.626) [-6480.358] * (-6479.210) (-6482.808) (-6483.105) [-6482.881] -- 0:04:27 655000 -- (-6484.566) (-6477.668) (-6478.847) [-6475.810] * (-6480.905) (-6477.565) [-6485.889] (-6486.623) -- 0:04:27 Average standard deviation of split frequencies: 0.000000 655500 -- (-6484.244) [-6484.993] (-6485.831) (-6473.164) * (-6483.065) [-6486.755] (-6480.542) (-6490.461) -- 0:04:26 656000 -- (-6479.594) [-6477.794] (-6481.151) (-6482.142) * [-6476.591] (-6478.869) (-6479.613) (-6483.340) -- 0:04:26 656500 -- (-6479.291) (-6481.824) (-6482.654) [-6476.801] * (-6480.122) (-6488.748) [-6483.701] (-6485.063) -- 0:04:26 657000 -- [-6486.604] (-6481.430) (-6488.655) (-6480.488) * [-6484.458] (-6488.252) (-6475.308) (-6482.055) -- 0:04:25 657500 -- (-6479.681) (-6483.433) (-6485.586) [-6480.162] * [-6486.629] (-6481.019) (-6485.109) (-6480.825) -- 0:04:25 658000 -- (-6478.026) [-6474.453] (-6486.149) (-6475.462) * (-6486.832) (-6481.629) (-6477.688) [-6479.344] -- 0:04:25 658500 -- [-6480.082] (-6480.293) (-6480.089) (-6474.361) * (-6480.845) [-6477.585] (-6486.175) (-6480.899) -- 0:04:25 659000 -- (-6483.895) (-6477.062) (-6476.474) [-6473.900] * [-6483.877] (-6481.976) (-6481.125) (-6483.074) -- 0:04:24 659500 -- (-6481.655) (-6476.002) (-6479.332) [-6474.848] * (-6477.420) (-6485.258) (-6472.631) [-6475.195] -- 0:04:23 660000 -- (-6478.032) [-6476.763] (-6477.548) (-6474.048) * (-6474.586) (-6479.537) (-6477.656) [-6472.512] -- 0:04:23 Average standard deviation of split frequencies: 0.000000 660500 -- [-6482.538] (-6480.144) (-6481.835) (-6480.049) * (-6482.343) (-6481.481) (-6481.198) [-6474.578] -- 0:04:23 661000 -- (-6481.786) (-6478.843) [-6477.479] (-6484.418) * (-6483.845) [-6475.712] (-6485.044) (-6479.187) -- 0:04:22 661500 -- (-6481.541) (-6480.035) (-6489.385) [-6479.788] * (-6489.173) (-6476.872) (-6480.756) [-6477.028] -- 0:04:22 662000 -- (-6484.424) [-6482.074] (-6477.905) (-6482.531) * (-6477.474) (-6480.314) [-6478.460] (-6480.401) -- 0:04:21 662500 -- (-6478.558) [-6476.706] (-6482.961) (-6485.446) * (-6478.517) (-6480.441) [-6478.123] (-6479.199) -- 0:04:21 663000 -- [-6474.297] (-6479.300) (-6476.548) (-6483.451) * (-6486.203) (-6481.689) (-6480.500) [-6480.768] -- 0:04:21 663500 -- (-6481.288) (-6477.286) [-6477.460] (-6488.403) * (-6482.797) (-6481.652) [-6482.815] (-6476.665) -- 0:04:21 664000 -- [-6475.784] (-6493.085) (-6480.967) (-6482.414) * [-6480.947] (-6477.467) (-6481.259) (-6474.048) -- 0:04:20 664500 -- (-6476.729) [-6478.396] (-6486.495) (-6485.592) * [-6474.283] (-6476.727) (-6473.681) (-6479.147) -- 0:04:20 665000 -- (-6482.057) (-6475.602) [-6486.550] (-6481.951) * (-6477.275) (-6480.234) [-6475.813] (-6480.849) -- 0:04:19 Average standard deviation of split frequencies: 0.000000 665500 -- (-6482.205) [-6479.584] (-6475.028) (-6478.412) * (-6477.096) (-6480.147) (-6477.066) [-6476.099] -- 0:04:19 666000 -- (-6476.811) (-6482.784) (-6478.167) [-6480.043] * [-6484.262] (-6474.052) (-6475.554) (-6486.504) -- 0:04:18 666500 -- [-6483.569] (-6478.710) (-6479.139) (-6485.397) * (-6481.549) (-6479.627) [-6479.733] (-6487.866) -- 0:04:18 667000 -- (-6482.958) (-6480.279) [-6485.022] (-6490.971) * (-6488.590) [-6475.280] (-6480.044) (-6481.418) -- 0:04:18 667500 -- (-6478.528) [-6479.183] (-6486.259) (-6479.515) * (-6481.944) [-6479.932] (-6473.784) (-6480.807) -- 0:04:18 668000 -- (-6479.144) [-6479.182] (-6485.160) (-6478.192) * (-6475.930) (-6481.196) [-6479.520] (-6480.363) -- 0:04:17 668500 -- (-6484.867) [-6483.975] (-6478.050) (-6478.933) * (-6484.186) [-6478.925] (-6477.589) (-6482.440) -- 0:04:16 669000 -- (-6479.994) (-6477.925) (-6475.242) [-6477.042] * (-6481.132) [-6483.125] (-6484.218) (-6476.650) -- 0:04:16 669500 -- (-6480.401) (-6480.528) (-6476.810) [-6480.436] * (-6481.209) (-6480.948) [-6473.648] (-6480.236) -- 0:04:16 670000 -- (-6481.219) (-6483.041) [-6476.933] (-6482.352) * (-6480.163) (-6476.229) [-6480.236] (-6478.529) -- 0:04:16 Average standard deviation of split frequencies: 0.000000 670500 -- [-6475.987] (-6480.789) (-6481.677) (-6483.042) * (-6477.579) [-6476.796] (-6475.479) (-6477.460) -- 0:04:15 671000 -- (-6485.272) (-6482.981) [-6478.202] (-6476.629) * (-6479.005) (-6490.541) (-6477.097) [-6483.055] -- 0:04:14 671500 -- (-6486.123) (-6486.004) [-6479.713] (-6489.760) * (-6480.044) (-6481.619) (-6476.665) [-6478.665] -- 0:04:14 672000 -- (-6482.749) (-6483.970) [-6480.787] (-6488.179) * (-6483.200) (-6484.643) [-6484.111] (-6479.233) -- 0:04:14 672500 -- [-6480.036] (-6482.719) (-6480.657) (-6480.497) * (-6483.452) [-6481.360] (-6479.944) (-6484.766) -- 0:04:13 673000 -- [-6488.441] (-6478.983) (-6480.161) (-6482.121) * [-6484.564] (-6483.472) (-6482.316) (-6481.054) -- 0:04:13 673500 -- (-6478.374) (-6482.590) (-6476.582) [-6482.204] * (-6485.209) [-6475.370] (-6488.495) (-6481.664) -- 0:04:13 674000 -- (-6490.778) [-6476.144] (-6481.405) (-6482.396) * [-6483.349] (-6481.663) (-6488.528) (-6481.434) -- 0:04:12 674500 -- (-6494.672) (-6478.007) (-6482.242) [-6477.382] * [-6478.035] (-6477.121) (-6475.019) (-6482.397) -- 0:04:12 675000 -- (-6483.936) (-6480.945) [-6478.103] (-6477.205) * (-6475.651) (-6483.423) [-6477.798] (-6481.172) -- 0:04:11 Average standard deviation of split frequencies: 0.000000 675500 -- (-6488.746) (-6475.168) [-6480.730] (-6478.227) * (-6477.265) (-6476.036) [-6475.554] (-6485.277) -- 0:04:11 676000 -- [-6492.664] (-6476.974) (-6478.079) (-6477.230) * (-6481.814) [-6478.021] (-6471.909) (-6475.849) -- 0:04:11 676500 -- (-6475.210) (-6480.319) (-6478.073) [-6476.588] * [-6477.713] (-6478.756) (-6480.673) (-6478.177) -- 0:04:11 677000 -- (-6484.932) (-6478.005) [-6474.892] (-6477.963) * [-6472.782] (-6481.820) (-6482.855) (-6475.433) -- 0:04:10 677500 -- (-6479.313) (-6485.053) [-6475.320] (-6484.369) * (-6479.579) (-6484.340) [-6474.169] (-6484.050) -- 0:04:09 678000 -- (-6481.481) [-6478.385] (-6477.194) (-6481.138) * (-6481.408) (-6479.681) (-6482.508) [-6476.441] -- 0:04:09 678500 -- [-6475.918] (-6482.245) (-6481.182) (-6490.619) * (-6481.487) (-6478.449) [-6475.885] (-6477.713) -- 0:04:09 679000 -- (-6481.782) (-6478.418) [-6473.593] (-6490.366) * (-6478.015) (-6476.170) (-6474.909) [-6477.897] -- 0:04:09 679500 -- (-6480.583) [-6479.767] (-6476.727) (-6480.760) * (-6480.880) (-6483.171) (-6479.079) [-6478.536] -- 0:04:08 680000 -- (-6475.906) (-6475.207) (-6476.252) [-6480.245] * (-6479.689) [-6475.813] (-6476.358) (-6488.368) -- 0:04:08 Average standard deviation of split frequencies: 0.000000 680500 -- (-6480.361) [-6481.742] (-6476.173) (-6486.696) * (-6479.001) [-6477.858] (-6482.693) (-6481.946) -- 0:04:07 681000 -- (-6473.941) (-6495.617) [-6487.631] (-6479.999) * [-6475.753] (-6481.170) (-6486.393) (-6476.195) -- 0:04:07 681500 -- [-6478.771] (-6481.932) (-6483.610) (-6485.464) * [-6488.227] (-6481.356) (-6479.626) (-6474.699) -- 0:04:07 682000 -- (-6475.397) [-6481.137] (-6480.778) (-6485.235) * (-6485.763) (-6483.228) [-6481.459] (-6480.786) -- 0:04:06 682500 -- (-6480.725) (-6478.257) [-6478.915] (-6487.022) * (-6475.683) (-6490.402) [-6478.260] (-6482.448) -- 0:04:06 683000 -- (-6475.975) [-6478.805] (-6479.419) (-6488.022) * (-6478.001) (-6486.833) (-6486.339) [-6483.000] -- 0:04:05 683500 -- [-6479.374] (-6477.839) (-6482.029) (-6482.632) * (-6477.277) [-6482.084] (-6477.415) (-6484.207) -- 0:04:05 684000 -- (-6477.535) [-6480.057] (-6476.617) (-6480.366) * (-6476.636) (-6486.607) [-6478.425] (-6476.182) -- 0:04:04 684500 -- (-6480.555) [-6480.083] (-6475.698) (-6485.703) * [-6481.963] (-6474.173) (-6483.709) (-6480.339) -- 0:04:04 685000 -- (-6477.987) (-6478.876) (-6476.694) [-6476.991] * (-6477.047) (-6479.516) (-6475.396) [-6477.907] -- 0:04:04 Average standard deviation of split frequencies: 0.000000 685500 -- [-6477.401] (-6491.485) (-6479.447) (-6473.456) * [-6481.003] (-6476.649) (-6477.194) (-6476.445) -- 0:04:04 686000 -- (-6477.542) (-6479.022) [-6474.662] (-6483.027) * (-6481.496) [-6479.665] (-6478.182) (-6476.720) -- 0:04:03 686500 -- [-6476.169] (-6479.933) (-6481.230) (-6479.387) * (-6474.408) (-6476.119) (-6483.592) [-6477.015] -- 0:04:02 687000 -- (-6479.212) [-6478.927] (-6475.200) (-6475.687) * (-6481.919) [-6476.301] (-6478.731) (-6481.607) -- 0:04:02 687500 -- [-6479.333] (-6485.407) (-6483.312) (-6479.938) * (-6481.153) (-6486.482) (-6477.365) [-6477.023] -- 0:04:02 688000 -- (-6486.038) (-6479.972) (-6479.026) [-6478.982] * (-6484.841) [-6478.627] (-6476.818) (-6481.398) -- 0:04:02 688500 -- (-6479.115) (-6484.006) [-6481.507] (-6479.622) * (-6477.193) (-6480.798) (-6479.572) [-6479.515] -- 0:04:01 689000 -- (-6479.371) (-6485.296) [-6474.043] (-6475.110) * [-6479.283] (-6478.352) (-6475.439) (-6477.523) -- 0:04:01 689500 -- (-6480.660) (-6483.324) [-6484.893] (-6480.872) * [-6479.983] (-6483.352) (-6476.409) (-6478.782) -- 0:04:00 690000 -- (-6487.245) (-6483.958) (-6490.110) [-6478.363] * (-6477.623) (-6479.042) (-6477.806) [-6476.425] -- 0:04:00 Average standard deviation of split frequencies: 0.000000 690500 -- (-6482.547) (-6490.851) [-6484.926] (-6477.277) * [-6481.502] (-6474.305) (-6477.036) (-6482.901) -- 0:03:59 691000 -- (-6477.499) (-6478.327) [-6478.364] (-6483.215) * [-6474.109] (-6481.753) (-6479.403) (-6479.255) -- 0:03:59 691500 -- (-6476.485) [-6480.264] (-6479.178) (-6479.483) * (-6483.880) (-6481.808) [-6480.170] (-6483.796) -- 0:03:59 692000 -- (-6488.310) (-6475.255) (-6478.886) [-6475.616] * (-6478.561) [-6473.644] (-6485.471) (-6483.019) -- 0:03:59 692500 -- (-6478.750) [-6476.607] (-6478.259) (-6486.967) * (-6476.716) (-6480.065) [-6482.407] (-6481.071) -- 0:03:58 693000 -- (-6481.921) (-6481.466) (-6483.167) [-6475.907] * (-6482.253) (-6476.958) (-6479.102) [-6476.413] -- 0:03:57 693500 -- (-6480.124) (-6476.721) [-6477.259] (-6482.385) * (-6483.389) (-6479.474) (-6484.788) [-6478.504] -- 0:03:57 694000 -- (-6486.440) (-6478.924) (-6475.714) [-6480.577] * (-6485.783) (-6481.767) (-6482.211) [-6482.887] -- 0:03:57 694500 -- (-6477.593) (-6478.090) (-6478.480) [-6478.537] * (-6484.550) (-6478.987) [-6479.672] (-6485.377) -- 0:03:57 695000 -- (-6477.479) [-6480.641] (-6477.570) (-6484.775) * (-6483.213) [-6480.888] (-6479.075) (-6478.568) -- 0:03:56 Average standard deviation of split frequencies: 0.000000 695500 -- (-6487.283) (-6489.124) [-6481.799] (-6480.202) * (-6472.937) (-6476.375) [-6477.856] (-6479.430) -- 0:03:55 696000 -- (-6479.830) (-6487.023) (-6481.724) [-6482.972] * (-6481.293) [-6476.558] (-6482.034) (-6479.970) -- 0:03:55 696500 -- (-6482.634) (-6484.675) [-6483.531] (-6485.191) * (-6483.154) (-6478.913) (-6478.171) [-6479.121] -- 0:03:55 697000 -- (-6476.342) (-6485.250) (-6480.602) [-6479.497] * (-6484.304) (-6479.468) (-6477.300) [-6481.261] -- 0:03:54 697500 -- [-6476.020] (-6489.076) (-6477.102) (-6475.369) * (-6476.566) (-6477.833) [-6477.806] (-6487.106) -- 0:03:54 698000 -- (-6477.885) (-6482.944) (-6476.330) [-6477.458] * (-6482.785) [-6478.438] (-6481.011) (-6474.678) -- 0:03:54 698500 -- [-6478.198] (-6474.550) (-6483.014) (-6482.253) * (-6475.363) (-6492.820) (-6480.862) [-6475.831] -- 0:03:53 699000 -- (-6475.857) [-6475.023] (-6477.476) (-6484.037) * (-6480.430) (-6480.451) [-6479.158] (-6485.824) -- 0:03:53 699500 -- [-6478.430] (-6476.948) (-6478.946) (-6479.666) * (-6480.313) [-6475.351] (-6483.669) (-6477.026) -- 0:03:52 700000 -- [-6477.138] (-6478.243) (-6482.616) (-6475.772) * [-6478.259] (-6483.336) (-6476.837) (-6482.103) -- 0:03:52 Average standard deviation of split frequencies: 0.000000 700500 -- (-6477.288) (-6473.724) [-6480.589] (-6486.976) * [-6478.920] (-6483.990) (-6479.896) (-6479.800) -- 0:03:52 701000 -- (-6482.152) (-6473.623) [-6476.432] (-6487.786) * [-6481.635] (-6481.294) (-6483.832) (-6479.500) -- 0:03:52 701500 -- (-6479.375) (-6474.291) [-6481.299] (-6476.553) * (-6476.962) (-6477.922) (-6482.245) [-6474.720] -- 0:03:51 702000 -- (-6476.380) (-6482.845) (-6478.641) [-6477.049] * (-6486.111) (-6476.466) [-6479.722] (-6477.333) -- 0:03:50 702500 -- (-6481.117) (-6475.643) [-6479.783] (-6480.651) * (-6474.583) (-6479.278) [-6485.268] (-6475.118) -- 0:03:50 703000 -- [-6478.571] (-6482.501) (-6480.266) (-6479.213) * [-6474.649] (-6481.048) (-6483.172) (-6479.885) -- 0:03:50 703500 -- (-6480.644) [-6478.865] (-6483.040) (-6481.354) * (-6478.504) [-6482.488] (-6491.762) (-6477.363) -- 0:03:49 704000 -- (-6479.809) [-6477.530] (-6478.533) (-6476.168) * (-6483.899) [-6478.435] (-6485.536) (-6476.385) -- 0:03:49 704500 -- (-6491.525) [-6481.603] (-6483.326) (-6479.119) * [-6484.209] (-6480.725) (-6479.559) (-6478.867) -- 0:03:49 705000 -- (-6480.076) [-6482.898] (-6485.605) (-6482.985) * (-6480.567) (-6477.310) [-6477.780] (-6480.318) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 705500 -- (-6479.580) (-6482.071) (-6477.939) [-6479.687] * [-6479.768] (-6484.207) (-6485.774) (-6476.996) -- 0:03:48 706000 -- (-6489.263) (-6481.963) [-6482.387] (-6476.639) * (-6478.196) (-6483.610) [-6478.183] (-6483.042) -- 0:03:47 706500 -- (-6487.125) (-6477.865) (-6481.707) [-6480.491] * (-6484.642) (-6480.471) [-6475.704] (-6477.007) -- 0:03:47 707000 -- [-6478.099] (-6471.518) (-6485.099) (-6476.584) * (-6476.646) (-6481.708) [-6478.530] (-6479.022) -- 0:03:47 707500 -- (-6483.938) [-6475.301] (-6477.232) (-6478.894) * (-6485.173) (-6480.607) [-6478.879] (-6479.243) -- 0:03:46 708000 -- (-6477.766) (-6486.703) (-6483.124) [-6479.248] * [-6482.279] (-6483.511) (-6478.277) (-6476.437) -- 0:03:46 708500 -- [-6486.357] (-6476.559) (-6480.809) (-6483.116) * (-6476.919) (-6478.141) (-6480.113) [-6482.717] -- 0:03:45 709000 -- [-6480.522] (-6483.938) (-6487.924) (-6481.037) * (-6490.438) (-6483.652) [-6475.633] (-6482.435) -- 0:03:45 709500 -- (-6481.231) [-6481.785] (-6483.311) (-6486.459) * (-6481.616) [-6477.375] (-6481.726) (-6481.522) -- 0:03:45 710000 -- (-6482.252) (-6487.715) (-6479.722) [-6478.414] * (-6475.486) [-6487.029] (-6484.700) (-6491.349) -- 0:03:44 Average standard deviation of split frequencies: 0.000000 710500 -- (-6474.278) (-6474.154) [-6479.144] (-6483.358) * (-6482.959) (-6477.281) [-6481.391] (-6477.623) -- 0:03:44 711000 -- (-6477.190) [-6477.289] (-6475.291) (-6475.968) * [-6476.351] (-6476.051) (-6476.608) (-6474.847) -- 0:03:43 711500 -- (-6482.327) [-6478.783] (-6486.323) (-6475.645) * (-6485.457) (-6475.305) (-6475.209) [-6475.364] -- 0:03:43 712000 -- (-6484.806) (-6481.205) [-6474.970] (-6484.042) * (-6481.648) (-6475.448) (-6477.094) [-6485.240] -- 0:03:43 712500 -- (-6480.374) [-6476.887] (-6477.256) (-6479.883) * (-6477.266) (-6484.977) [-6477.169] (-6478.401) -- 0:03:42 713000 -- (-6484.333) (-6476.613) [-6480.147] (-6484.845) * [-6480.557] (-6477.585) (-6476.960) (-6487.787) -- 0:03:42 713500 -- [-6479.674] (-6477.989) (-6485.388) (-6479.438) * (-6487.084) (-6476.574) [-6484.185] (-6478.444) -- 0:03:42 714000 -- (-6480.818) (-6477.277) [-6480.030] (-6476.547) * [-6479.530] (-6481.054) (-6488.124) (-6481.643) -- 0:03:41 714500 -- (-6479.950) [-6477.151] (-6473.418) (-6487.916) * (-6481.912) (-6479.592) (-6482.988) [-6481.704] -- 0:03:41 715000 -- [-6479.201] (-6477.715) (-6478.974) (-6480.711) * (-6482.380) (-6478.687) (-6492.818) [-6480.712] -- 0:03:40 Average standard deviation of split frequencies: 0.000000 715500 -- (-6483.604) (-6482.308) (-6483.386) [-6475.549] * (-6484.716) [-6473.850] (-6476.066) (-6488.520) -- 0:03:40 716000 -- [-6476.639] (-6485.101) (-6478.932) (-6477.162) * (-6481.441) [-6483.518] (-6478.601) (-6479.827) -- 0:03:40 716500 -- [-6482.495] (-6475.037) (-6480.128) (-6477.112) * (-6477.266) (-6472.713) [-6487.854] (-6483.614) -- 0:03:39 717000 -- (-6482.508) (-6479.173) (-6476.373) [-6474.283] * (-6477.766) [-6481.094] (-6478.600) (-6481.463) -- 0:03:39 717500 -- (-6481.248) [-6475.565] (-6474.555) (-6479.827) * [-6476.178] (-6482.642) (-6476.460) (-6482.447) -- 0:03:38 718000 -- (-6479.190) (-6476.962) [-6475.428] (-6475.100) * (-6475.309) [-6481.712] (-6483.601) (-6481.621) -- 0:03:38 718500 -- (-6489.489) [-6479.457] (-6484.710) (-6480.798) * (-6479.214) (-6478.261) [-6476.387] (-6479.108) -- 0:03:38 719000 -- (-6481.385) (-6480.541) (-6480.904) [-6477.510] * (-6482.160) [-6479.280] (-6475.844) (-6481.549) -- 0:03:37 719500 -- (-6477.377) (-6483.445) [-6480.295] (-6479.365) * [-6479.077] (-6477.593) (-6477.983) (-6480.107) -- 0:03:37 720000 -- [-6478.962] (-6481.759) (-6482.627) (-6481.281) * (-6474.486) (-6473.048) [-6481.414] (-6473.783) -- 0:03:37 Average standard deviation of split frequencies: 0.000000 720500 -- (-6486.565) (-6476.907) (-6480.678) [-6478.931] * (-6476.348) (-6477.206) (-6477.706) [-6482.035] -- 0:03:36 721000 -- (-6481.127) (-6481.562) [-6479.517] (-6480.443) * (-6478.582) [-6478.454] (-6477.964) (-6480.629) -- 0:03:36 721500 -- (-6479.623) (-6480.332) (-6475.557) [-6483.487] * (-6479.706) (-6477.415) [-6485.878] (-6482.197) -- 0:03:35 722000 -- (-6476.216) (-6481.869) [-6480.978] (-6484.109) * (-6480.392) [-6475.917] (-6487.927) (-6487.499) -- 0:03:35 722500 -- (-6479.588) (-6484.302) (-6474.545) [-6479.068] * (-6484.995) (-6480.400) (-6477.623) [-6474.607] -- 0:03:35 723000 -- (-6481.124) (-6480.289) (-6485.562) [-6478.479] * (-6486.652) [-6480.739] (-6476.259) (-6475.373) -- 0:03:34 723500 -- (-6475.334) (-6486.001) [-6483.578] (-6479.397) * (-6479.853) (-6484.265) [-6474.577] (-6483.551) -- 0:03:34 724000 -- (-6481.270) (-6481.647) (-6487.013) [-6479.571] * (-6481.388) [-6475.402] (-6478.023) (-6485.635) -- 0:03:33 724500 -- (-6478.208) [-6477.413] (-6489.584) (-6480.621) * (-6478.740) (-6487.808) (-6477.554) [-6473.744] -- 0:03:33 725000 -- (-6484.221) (-6479.873) (-6479.347) [-6474.315] * (-6479.784) (-6480.274) [-6478.889] (-6481.355) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 725500 -- (-6481.200) (-6480.473) [-6475.196] (-6479.362) * (-6488.214) (-6479.017) [-6475.762] (-6485.009) -- 0:03:32 726000 -- (-6482.485) (-6482.963) (-6475.291) [-6476.243] * (-6477.811) (-6478.958) [-6485.218] (-6480.629) -- 0:03:32 726500 -- (-6480.744) (-6484.827) [-6481.992] (-6484.223) * [-6483.485] (-6481.534) (-6475.282) (-6480.732) -- 0:03:31 727000 -- (-6486.922) [-6475.496] (-6488.735) (-6475.464) * (-6484.418) (-6476.845) [-6478.472] (-6478.867) -- 0:03:31 727500 -- (-6478.222) [-6483.508] (-6484.767) (-6475.621) * (-6479.326) (-6481.969) [-6478.280] (-6482.452) -- 0:03:31 728000 -- [-6475.336] (-6475.992) (-6477.005) (-6477.857) * [-6482.165] (-6479.402) (-6478.937) (-6478.953) -- 0:03:30 728500 -- (-6479.253) (-6485.192) (-6480.233) [-6479.043] * (-6485.159) (-6478.256) (-6482.302) [-6476.828] -- 0:03:30 729000 -- (-6483.722) (-6486.326) (-6481.135) [-6475.091] * (-6477.397) [-6483.949] (-6480.956) (-6479.489) -- 0:03:30 729500 -- (-6480.958) (-6487.677) [-6480.161] (-6481.720) * (-6482.466) (-6490.467) [-6483.485] (-6483.671) -- 0:03:29 730000 -- [-6475.820] (-6484.039) (-6475.727) (-6480.946) * (-6482.421) (-6482.180) [-6482.876] (-6481.973) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 730500 -- (-6476.919) (-6479.792) [-6477.212] (-6488.209) * [-6482.660] (-6484.964) (-6475.675) (-6486.609) -- 0:03:28 731000 -- (-6484.506) (-6477.692) [-6479.839] (-6488.844) * (-6480.572) (-6477.267) (-6490.241) [-6477.715] -- 0:03:28 731500 -- (-6483.599) [-6479.626] (-6481.159) (-6480.388) * (-6478.672) (-6475.626) [-6474.600] (-6474.130) -- 0:03:28 732000 -- [-6476.894] (-6481.146) (-6477.240) (-6483.303) * [-6476.763] (-6479.862) (-6483.741) (-6479.746) -- 0:03:27 732500 -- (-6477.056) (-6485.021) [-6478.860] (-6476.411) * [-6481.766] (-6483.050) (-6479.658) (-6483.074) -- 0:03:27 733000 -- (-6480.886) [-6484.878] (-6483.383) (-6485.283) * (-6480.656) [-6483.249] (-6482.038) (-6479.738) -- 0:03:26 733500 -- (-6478.504) [-6478.828] (-6476.397) (-6475.940) * (-6479.473) [-6479.848] (-6481.291) (-6476.067) -- 0:03:26 734000 -- (-6478.263) [-6476.309] (-6479.542) (-6486.285) * (-6480.407) (-6479.201) [-6471.715] (-6480.489) -- 0:03:25 734500 -- (-6480.464) [-6483.475] (-6485.190) (-6483.696) * (-6479.993) (-6477.692) (-6474.669) [-6475.465] -- 0:03:25 735000 -- (-6485.500) (-6477.102) (-6491.624) [-6472.785] * (-6481.917) (-6478.827) [-6479.634] (-6476.068) -- 0:03:25 Average standard deviation of split frequencies: 0.000000 735500 -- [-6473.029] (-6479.084) (-6490.544) (-6475.503) * (-6477.945) (-6479.849) (-6482.577) [-6474.768] -- 0:03:24 736000 -- (-6483.367) (-6475.691) [-6488.855] (-6479.651) * [-6474.965] (-6484.491) (-6481.203) (-6474.836) -- 0:03:24 736500 -- (-6479.612) (-6479.767) [-6481.489] (-6475.681) * (-6483.293) (-6479.710) (-6487.938) [-6475.661] -- 0:03:23 737000 -- (-6478.046) [-6476.105] (-6482.331) (-6482.131) * (-6478.222) [-6484.799] (-6486.021) (-6488.344) -- 0:03:23 737500 -- (-6477.145) [-6476.311] (-6481.416) (-6480.148) * (-6481.843) (-6476.796) (-6482.346) [-6480.484] -- 0:03:23 738000 -- (-6481.438) (-6484.038) (-6475.585) [-6474.888] * (-6477.831) [-6479.375] (-6483.149) (-6484.863) -- 0:03:22 738500 -- (-6481.425) (-6491.556) [-6479.312] (-6482.345) * (-6477.731) (-6484.427) (-6489.039) [-6478.469] -- 0:03:22 739000 -- (-6479.108) (-6489.670) [-6474.368] (-6478.902) * (-6476.197) (-6483.729) (-6482.126) [-6476.610] -- 0:03:22 739500 -- (-6488.631) (-6487.191) (-6478.773) [-6477.576] * (-6483.551) (-6489.618) (-6476.296) [-6479.476] -- 0:03:21 740000 -- [-6476.988] (-6485.415) (-6481.545) (-6482.107) * [-6478.330] (-6483.114) (-6477.838) (-6486.742) -- 0:03:21 Average standard deviation of split frequencies: 0.000000 740500 -- (-6480.435) (-6482.634) [-6478.669] (-6478.151) * [-6482.152] (-6482.460) (-6474.204) (-6478.865) -- 0:03:20 741000 -- [-6483.219] (-6489.075) (-6479.289) (-6483.429) * (-6480.088) [-6484.854] (-6481.251) (-6481.754) -- 0:03:20 741500 -- (-6493.471) [-6476.351] (-6479.295) (-6482.479) * [-6477.023] (-6482.495) (-6477.209) (-6487.122) -- 0:03:20 742000 -- [-6483.545] (-6479.594) (-6476.356) (-6486.903) * (-6475.160) (-6486.734) [-6474.158] (-6478.840) -- 0:03:19 742500 -- (-6480.954) (-6484.878) [-6475.008] (-6486.225) * (-6479.236) (-6488.803) (-6474.031) [-6476.042] -- 0:03:19 743000 -- (-6479.422) (-6489.583) (-6478.238) [-6490.181] * (-6475.895) (-6482.704) (-6477.919) [-6484.485] -- 0:03:18 743500 -- [-6476.752] (-6476.390) (-6481.961) (-6480.915) * (-6485.425) (-6477.902) (-6484.018) [-6476.094] -- 0:03:18 744000 -- (-6480.705) (-6483.105) [-6477.016] (-6478.715) * (-6478.998) [-6482.349] (-6490.597) (-6475.514) -- 0:03:18 744500 -- (-6472.507) [-6481.703] (-6484.480) (-6482.523) * [-6479.082] (-6478.513) (-6481.519) (-6476.867) -- 0:03:17 745000 -- (-6480.442) [-6485.284] (-6481.761) (-6482.688) * (-6489.115) (-6481.567) [-6475.605] (-6480.842) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 745500 -- (-6483.593) (-6485.689) (-6475.846) [-6482.710] * [-6479.092] (-6477.760) (-6485.233) (-6478.986) -- 0:03:16 746000 -- (-6475.982) (-6481.453) [-6474.831] (-6484.661) * (-6480.855) [-6478.071] (-6479.977) (-6480.024) -- 0:03:16 746500 -- (-6479.033) (-6480.264) [-6481.705] (-6477.926) * (-6477.976) (-6480.638) [-6481.985] (-6478.913) -- 0:03:16 747000 -- (-6478.431) (-6489.371) [-6486.942] (-6481.044) * (-6475.187) (-6477.346) (-6481.561) [-6478.992] -- 0:03:15 747500 -- [-6478.937] (-6483.249) (-6479.158) (-6484.964) * (-6477.225) [-6471.271] (-6482.310) (-6489.952) -- 0:03:15 748000 -- (-6479.876) (-6481.545) [-6483.794] (-6481.223) * (-6475.099) (-6482.238) [-6479.968] (-6475.643) -- 0:03:15 748500 -- [-6473.607] (-6481.005) (-6474.747) (-6484.990) * [-6477.882] (-6481.162) (-6478.103) (-6480.293) -- 0:03:14 749000 -- [-6474.405] (-6479.615) (-6478.348) (-6483.023) * (-6480.496) (-6472.939) [-6480.048] (-6482.661) -- 0:03:14 749500 -- [-6480.889] (-6479.228) (-6484.400) (-6484.720) * (-6479.443) (-6483.599) (-6475.713) [-6481.413] -- 0:03:13 750000 -- (-6485.644) (-6481.426) (-6487.384) [-6478.693] * [-6480.688] (-6483.002) (-6483.616) (-6482.495) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 750500 -- (-6478.138) (-6492.166) (-6490.672) [-6479.987] * (-6481.058) [-6483.147] (-6483.545) (-6480.500) -- 0:03:13 751000 -- [-6474.541] (-6488.846) (-6479.693) (-6481.505) * (-6482.521) (-6474.842) [-6479.632] (-6483.479) -- 0:03:12 751500 -- (-6477.189) (-6482.669) (-6479.622) [-6475.348] * [-6479.382] (-6482.133) (-6482.968) (-6485.368) -- 0:03:12 752000 -- (-6488.912) (-6477.123) (-6480.132) [-6484.668] * [-6480.338] (-6478.019) (-6477.728) (-6472.672) -- 0:03:11 752500 -- (-6481.972) (-6478.370) (-6477.984) [-6476.720] * (-6481.424) (-6477.871) (-6479.404) [-6474.008] -- 0:03:11 753000 -- (-6476.050) [-6477.109] (-6483.177) (-6478.689) * (-6483.152) [-6479.034] (-6476.233) (-6479.218) -- 0:03:11 753500 -- (-6484.882) (-6490.409) (-6485.759) [-6482.684] * (-6483.688) (-6480.896) [-6475.388] (-6479.119) -- 0:03:10 754000 -- [-6477.620] (-6484.538) (-6482.821) (-6483.917) * (-6482.884) [-6475.763] (-6479.229) (-6484.081) -- 0:03:10 754500 -- (-6483.259) (-6485.656) [-6478.623] (-6474.953) * (-6489.859) (-6479.568) [-6478.131] (-6487.305) -- 0:03:10 755000 -- [-6478.539] (-6480.206) (-6484.094) (-6492.933) * (-6487.264) [-6473.159] (-6481.078) (-6478.277) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 755500 -- (-6478.096) (-6477.848) (-6484.518) [-6483.530] * (-6478.904) [-6480.641] (-6484.128) (-6477.909) -- 0:03:08 756000 -- (-6486.924) (-6486.245) [-6479.185] (-6488.465) * (-6478.796) (-6488.818) [-6476.354] (-6488.889) -- 0:03:08 756500 -- (-6478.873) [-6481.937] (-6480.958) (-6488.543) * (-6483.725) (-6478.358) [-6477.952] (-6481.092) -- 0:03:08 757000 -- (-6483.053) (-6480.675) [-6477.632] (-6488.668) * (-6482.986) [-6477.875] (-6482.807) (-6482.717) -- 0:03:08 757500 -- [-6479.612] (-6477.695) (-6480.231) (-6481.089) * (-6476.929) [-6477.946] (-6478.826) (-6482.602) -- 0:03:07 758000 -- (-6477.299) (-6475.267) [-6483.682] (-6475.157) * (-6472.528) [-6475.895] (-6477.182) (-6480.689) -- 0:03:07 758500 -- (-6480.078) (-6481.281) [-6483.212] (-6484.506) * (-6478.268) [-6473.882] (-6482.128) (-6480.153) -- 0:03:06 759000 -- [-6487.234] (-6488.512) (-6483.144) (-6480.617) * (-6477.464) (-6481.713) (-6480.087) [-6482.080] -- 0:03:06 759500 -- (-6482.564) (-6481.424) [-6479.151] (-6482.144) * (-6479.529) (-6490.867) (-6483.357) [-6476.132] -- 0:03:05 760000 -- (-6483.177) [-6482.025] (-6491.462) (-6489.516) * (-6483.804) [-6480.900] (-6475.749) (-6484.083) -- 0:03:05 Average standard deviation of split frequencies: 0.000000 760500 -- (-6487.013) (-6483.082) [-6478.982] (-6487.926) * (-6486.113) (-6480.649) [-6476.031] (-6477.033) -- 0:03:05 761000 -- [-6478.717] (-6486.365) (-6474.270) (-6482.477) * (-6480.288) (-6474.000) (-6479.137) [-6480.166] -- 0:03:04 761500 -- (-6486.223) (-6486.981) [-6484.589] (-6487.466) * (-6484.787) [-6483.678] (-6480.439) (-6477.668) -- 0:03:04 762000 -- (-6488.335) (-6476.869) (-6478.273) [-6476.657] * (-6477.944) [-6485.048] (-6476.881) (-6481.309) -- 0:03:03 762500 -- (-6480.733) [-6482.661] (-6485.488) (-6486.310) * (-6478.378) [-6477.035] (-6476.614) (-6496.625) -- 0:03:03 763000 -- [-6475.172] (-6477.812) (-6487.770) (-6478.958) * [-6473.998] (-6484.310) (-6478.561) (-6484.286) -- 0:03:03 763500 -- (-6480.819) (-6474.570) [-6485.819] (-6484.530) * (-6488.870) [-6481.715] (-6486.939) (-6482.876) -- 0:03:02 764000 -- (-6481.107) (-6479.680) (-6481.372) [-6473.584] * (-6481.740) [-6480.766] (-6475.706) (-6483.747) -- 0:03:02 764500 -- (-6478.636) [-6475.003] (-6478.668) (-6476.335) * (-6486.841) (-6478.121) [-6479.865] (-6484.671) -- 0:03:02 765000 -- [-6478.017] (-6480.061) (-6482.968) (-6483.680) * (-6490.322) (-6480.744) [-6478.303] (-6485.243) -- 0:03:01 Average standard deviation of split frequencies: 0.000000 765500 -- (-6483.595) (-6477.518) (-6485.199) [-6475.662] * (-6484.447) (-6482.093) [-6484.410] (-6487.676) -- 0:03:01 766000 -- (-6483.100) [-6475.904] (-6481.809) (-6480.298) * (-6478.358) (-6481.728) (-6482.288) [-6481.179] -- 0:03:00 766500 -- (-6484.624) (-6479.307) [-6479.434] (-6485.247) * [-6474.974] (-6483.551) (-6475.350) (-6489.743) -- 0:03:00 767000 -- [-6476.262] (-6480.584) (-6478.132) (-6479.818) * (-6483.063) [-6478.984] (-6487.896) (-6484.577) -- 0:03:00 767500 -- (-6476.737) (-6478.510) (-6484.213) [-6485.798] * (-6478.635) [-6484.411] (-6480.527) (-6484.422) -- 0:02:59 768000 -- (-6479.427) (-6474.175) (-6482.015) [-6476.945] * (-6486.332) [-6475.928] (-6477.677) (-6475.848) -- 0:02:59 768500 -- (-6476.441) (-6484.640) (-6487.337) [-6479.004] * (-6480.291) (-6478.901) (-6484.307) [-6475.670] -- 0:02:58 769000 -- (-6478.938) [-6479.014] (-6487.007) (-6478.369) * (-6483.692) [-6476.959] (-6477.764) (-6481.017) -- 0:02:58 769500 -- (-6487.154) [-6472.360] (-6480.614) (-6476.795) * [-6487.491] (-6486.681) (-6478.599) (-6480.866) -- 0:02:58 770000 -- (-6486.399) [-6479.515] (-6484.895) (-6480.541) * (-6481.232) (-6481.418) [-6475.807] (-6485.920) -- 0:02:57 Average standard deviation of split frequencies: 0.000000 770500 -- (-6482.139) [-6478.204] (-6490.477) (-6482.329) * (-6481.449) (-6478.245) [-6477.721] (-6475.736) -- 0:02:57 771000 -- (-6491.809) [-6481.107] (-6483.199) (-6479.300) * (-6479.268) [-6481.441] (-6479.854) (-6478.322) -- 0:02:57 771500 -- (-6478.185) (-6476.800) (-6481.048) [-6481.319] * [-6482.062] (-6478.817) (-6475.982) (-6478.687) -- 0:02:56 772000 -- (-6479.175) [-6478.113] (-6482.022) (-6483.188) * (-6495.903) (-6483.579) [-6481.524] (-6476.835) -- 0:02:56 772500 -- (-6479.093) [-6481.866] (-6481.071) (-6482.486) * [-6480.225] (-6486.381) (-6477.697) (-6474.253) -- 0:02:55 773000 -- (-6479.110) [-6480.723] (-6490.787) (-6480.220) * (-6481.880) (-6482.133) [-6482.014] (-6474.428) -- 0:02:55 773500 -- (-6479.277) (-6483.237) (-6479.582) [-6478.048] * (-6485.574) (-6481.145) (-6476.257) [-6476.650] -- 0:02:55 774000 -- (-6480.577) (-6490.231) [-6482.176] (-6479.107) * (-6485.434) (-6484.157) (-6487.326) [-6480.297] -- 0:02:54 774500 -- [-6476.495] (-6482.586) (-6479.061) (-6488.796) * (-6483.288) (-6479.154) [-6479.362] (-6487.575) -- 0:02:54 775000 -- (-6478.919) (-6481.045) (-6486.771) [-6479.878] * (-6476.437) [-6478.788] (-6482.607) (-6481.445) -- 0:02:53 Average standard deviation of split frequencies: 0.000000 775500 -- [-6477.581] (-6480.856) (-6478.070) (-6481.548) * (-6480.051) (-6483.400) (-6480.163) [-6479.363] -- 0:02:53 776000 -- (-6477.571) [-6482.008] (-6479.151) (-6478.866) * [-6479.629] (-6478.668) (-6482.435) (-6480.273) -- 0:02:53 776500 -- (-6478.205) (-6478.022) [-6482.612] (-6481.142) * (-6486.222) [-6476.966] (-6482.316) (-6484.273) -- 0:02:52 777000 -- (-6479.744) (-6487.160) (-6492.408) [-6480.498] * (-6476.889) (-6483.003) (-6480.245) [-6481.381] -- 0:02:52 777500 -- (-6482.431) (-6486.082) (-6485.377) [-6475.118] * [-6486.354] (-6483.581) (-6486.906) (-6480.257) -- 0:02:51 778000 -- (-6483.486) [-6473.218] (-6487.091) (-6481.055) * (-6484.330) [-6477.434] (-6483.772) (-6481.192) -- 0:02:51 778500 -- (-6481.498) (-6474.449) (-6477.710) [-6479.464] * (-6482.216) [-6486.998] (-6473.979) (-6484.824) -- 0:02:51 779000 -- (-6478.027) [-6480.944] (-6480.292) (-6479.601) * (-6485.124) (-6483.894) [-6482.520] (-6476.815) -- 0:02:50 779500 -- (-6479.916) [-6484.716] (-6490.552) (-6481.918) * (-6485.218) (-6478.022) [-6476.294] (-6479.155) -- 0:02:50 780000 -- (-6481.317) [-6477.341] (-6485.022) (-6478.049) * (-6482.346) (-6479.873) [-6479.185] (-6482.561) -- 0:02:50 Average standard deviation of split frequencies: 0.000000 780500 -- (-6477.703) (-6482.023) [-6481.243] (-6475.990) * [-6479.081] (-6488.452) (-6485.691) (-6477.986) -- 0:02:49 781000 -- [-6478.436] (-6483.203) (-6477.506) (-6474.309) * (-6481.596) (-6486.103) (-6477.251) [-6477.610] -- 0:02:49 781500 -- (-6483.723) (-6488.051) [-6477.992] (-6477.850) * [-6481.717] (-6482.595) (-6483.755) (-6473.160) -- 0:02:48 782000 -- (-6480.653) (-6481.102) [-6479.352] (-6477.081) * [-6476.339] (-6481.662) (-6481.143) (-6479.025) -- 0:02:48 782500 -- [-6480.667] (-6478.231) (-6481.117) (-6477.532) * (-6476.567) (-6483.707) (-6474.070) [-6475.931] -- 0:02:48 783000 -- (-6478.261) (-6477.682) (-6475.539) [-6478.036] * (-6480.932) (-6482.171) [-6475.928] (-6479.268) -- 0:02:47 783500 -- (-6476.022) (-6478.444) (-6484.114) [-6476.544] * (-6476.929) [-6481.661] (-6472.734) (-6482.695) -- 0:02:47 784000 -- (-6480.977) (-6482.194) (-6485.546) [-6480.575] * (-6474.263) (-6476.906) [-6475.380] (-6477.697) -- 0:02:46 784500 -- (-6481.342) (-6474.262) (-6478.879) [-6477.617] * [-6474.531] (-6479.773) (-6480.434) (-6483.215) -- 0:02:46 785000 -- [-6475.847] (-6477.201) (-6477.676) (-6479.254) * (-6479.876) (-6483.117) [-6483.189] (-6481.380) -- 0:02:46 Average standard deviation of split frequencies: 0.000000 785500 -- (-6486.530) [-6481.647] (-6485.819) (-6475.965) * (-6482.359) [-6472.764] (-6489.129) (-6477.031) -- 0:02:45 786000 -- (-6479.230) (-6481.197) [-6481.370] (-6481.977) * (-6484.396) (-6476.411) [-6481.234] (-6479.436) -- 0:02:45 786500 -- [-6481.541] (-6474.969) (-6480.322) (-6484.106) * (-6477.290) (-6477.304) (-6475.329) [-6475.332] -- 0:02:45 787000 -- (-6476.212) [-6475.869] (-6480.612) (-6477.032) * (-6484.209) (-6480.444) [-6474.828] (-6479.039) -- 0:02:44 787500 -- (-6473.416) [-6479.598] (-6477.642) (-6482.141) * (-6487.274) (-6474.847) [-6477.873] (-6480.508) -- 0:02:44 788000 -- [-6477.518] (-6487.604) (-6478.113) (-6483.126) * (-6476.549) [-6476.096] (-6477.091) (-6480.287) -- 0:02:43 788500 -- (-6481.111) [-6472.842] (-6477.626) (-6489.228) * (-6473.632) (-6478.797) [-6476.580] (-6476.705) -- 0:02:43 789000 -- [-6475.018] (-6475.507) (-6478.564) (-6485.141) * (-6482.811) [-6478.107] (-6475.521) (-6481.980) -- 0:02:43 789500 -- (-6480.804) [-6474.585] (-6473.839) (-6491.489) * (-6479.728) [-6481.897] (-6477.032) (-6479.852) -- 0:02:42 790000 -- (-6486.938) [-6475.128] (-6481.016) (-6487.633) * (-6482.070) (-6475.884) (-6480.665) [-6484.708] -- 0:02:42 Average standard deviation of split frequencies: 0.000000 790500 -- (-6484.125) (-6488.454) (-6490.311) [-6483.129] * [-6476.706] (-6480.137) (-6478.772) (-6481.272) -- 0:02:41 791000 -- (-6480.332) (-6478.689) (-6480.261) [-6479.400] * (-6480.611) [-6482.449] (-6478.569) (-6479.234) -- 0:02:41 791500 -- (-6479.820) (-6479.023) [-6484.216] (-6476.682) * (-6483.382) (-6480.328) [-6478.628] (-6477.499) -- 0:02:40 792000 -- (-6482.279) (-6479.942) (-6493.030) [-6478.117] * (-6481.556) (-6475.877) (-6479.600) [-6477.048] -- 0:02:40 792500 -- (-6479.800) (-6484.265) [-6476.361] (-6481.997) * (-6475.717) (-6479.809) [-6477.988] (-6475.191) -- 0:02:40 793000 -- (-6476.243) [-6482.892] (-6481.835) (-6481.510) * (-6483.831) (-6490.438) [-6482.436] (-6485.554) -- 0:02:39 793500 -- (-6480.433) [-6481.210] (-6476.061) (-6478.807) * [-6474.835] (-6479.955) (-6484.437) (-6482.294) -- 0:02:39 794000 -- (-6479.710) [-6478.061] (-6479.738) (-6479.424) * (-6473.983) (-6474.046) (-6482.297) [-6479.420] -- 0:02:39 794500 -- (-6473.877) (-6489.587) (-6485.112) [-6478.372] * (-6476.546) [-6474.639] (-6479.888) (-6477.401) -- 0:02:38 795000 -- (-6479.626) [-6477.491] (-6481.929) (-6475.249) * (-6476.407) (-6481.747) [-6481.828] (-6479.296) -- 0:02:38 Average standard deviation of split frequencies: 0.000000 795500 -- (-6475.802) (-6477.155) [-6477.996] (-6475.499) * [-6478.086] (-6482.363) (-6483.377) (-6480.297) -- 0:02:37 796000 -- (-6478.893) (-6477.409) [-6480.630] (-6482.896) * [-6478.372] (-6472.871) (-6483.235) (-6476.482) -- 0:02:37 796500 -- (-6480.363) (-6477.626) [-6481.779] (-6478.886) * (-6482.201) [-6478.837] (-6480.108) (-6478.140) -- 0:02:37 797000 -- [-6480.164] (-6479.563) (-6479.619) (-6478.802) * [-6479.174] (-6480.924) (-6477.315) (-6480.934) -- 0:02:36 797500 -- (-6475.836) (-6480.993) (-6481.796) [-6480.163] * (-6477.709) (-6481.736) [-6475.737] (-6473.225) -- 0:02:36 798000 -- (-6481.902) (-6485.758) (-6477.974) [-6477.139] * (-6478.391) (-6480.697) (-6483.422) [-6478.573] -- 0:02:35 798500 -- (-6475.079) (-6477.568) [-6479.683] (-6481.348) * (-6479.660) (-6478.857) [-6478.127] (-6478.632) -- 0:02:35 799000 -- (-6477.343) (-6478.289) [-6476.631] (-6478.290) * (-6477.166) (-6477.221) [-6483.256] (-6477.895) -- 0:02:35 799500 -- [-6475.086] (-6479.203) (-6484.085) (-6483.539) * (-6483.127) (-6480.684) (-6478.762) [-6472.523] -- 0:02:34 800000 -- (-6475.469) [-6481.039] (-6481.804) (-6484.501) * [-6475.517] (-6475.424) (-6477.834) (-6495.070) -- 0:02:34 Average standard deviation of split frequencies: 0.000000 800500 -- (-6485.856) (-6484.557) (-6479.649) [-6487.488] * (-6478.830) (-6482.651) [-6478.344] (-6476.215) -- 0:02:34 801000 -- (-6482.653) (-6487.192) [-6478.475] (-6493.643) * (-6477.173) (-6475.765) [-6479.814] (-6485.788) -- 0:02:33 801500 -- (-6485.540) (-6481.204) [-6482.345] (-6483.815) * (-6478.515) (-6482.725) (-6482.060) [-6482.015] -- 0:02:33 802000 -- (-6478.292) [-6474.864] (-6484.605) (-6482.007) * (-6482.835) [-6476.158] (-6473.408) (-6475.438) -- 0:02:32 802500 -- (-6479.454) [-6483.605] (-6488.035) (-6482.770) * (-6482.504) (-6479.301) [-6478.948] (-6482.373) -- 0:02:32 803000 -- (-6480.376) (-6486.651) (-6477.417) [-6479.589] * (-6487.517) (-6480.470) [-6475.726] (-6482.789) -- 0:02:32 803500 -- (-6481.554) [-6478.818] (-6478.841) (-6483.204) * (-6491.705) [-6475.616] (-6476.078) (-6482.216) -- 0:02:31 804000 -- (-6477.808) (-6480.856) [-6473.298] (-6488.607) * (-6480.141) [-6482.799] (-6478.293) (-6490.683) -- 0:02:31 804500 -- (-6476.400) (-6496.902) [-6478.445] (-6480.449) * (-6477.069) (-6482.010) (-6481.616) [-6476.124] -- 0:02:30 805000 -- [-6483.516] (-6491.537) (-6477.316) (-6479.463) * (-6491.301) (-6484.365) (-6482.599) [-6478.516] -- 0:02:30 Average standard deviation of split frequencies: 0.000000 805500 -- (-6482.207) (-6479.958) [-6476.900] (-6481.224) * (-6486.834) (-6475.600) [-6474.901] (-6481.666) -- 0:02:30 806000 -- (-6475.491) [-6480.370] (-6481.789) (-6477.193) * (-6486.175) [-6477.494] (-6482.336) (-6480.865) -- 0:02:29 806500 -- (-6474.071) (-6483.645) (-6476.217) [-6489.945] * (-6476.570) [-6482.536] (-6484.333) (-6483.262) -- 0:02:29 807000 -- (-6474.965) (-6481.518) (-6481.593) [-6479.469] * (-6480.099) [-6478.245] (-6478.181) (-6478.292) -- 0:02:28 807500 -- [-6481.482] (-6476.685) (-6478.167) (-6479.746) * (-6478.445) (-6482.633) (-6488.675) [-6479.652] -- 0:02:28 808000 -- (-6494.989) (-6479.270) (-6482.594) [-6477.846] * (-6482.063) (-6484.783) [-6476.938] (-6474.473) -- 0:02:28 808500 -- [-6482.057] (-6480.948) (-6488.070) (-6483.042) * (-6477.832) (-6484.351) [-6478.402] (-6478.072) -- 0:02:27 809000 -- (-6483.550) (-6483.486) (-6489.898) [-6478.038] * (-6481.232) (-6477.814) [-6479.990] (-6482.376) -- 0:02:27 809500 -- (-6479.232) (-6492.057) (-6483.064) [-6481.032] * (-6484.006) (-6476.392) (-6479.501) [-6480.174] -- 0:02:27 810000 -- [-6478.020] (-6483.804) (-6479.414) (-6478.552) * (-6486.422) (-6475.167) [-6478.292] (-6479.751) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 810500 -- [-6475.943] (-6480.907) (-6485.539) (-6486.269) * (-6482.393) (-6477.877) [-6476.401] (-6479.668) -- 0:02:26 811000 -- [-6473.257] (-6478.924) (-6482.510) (-6478.220) * [-6477.195] (-6479.631) (-6475.856) (-6478.147) -- 0:02:25 811500 -- (-6476.959) (-6483.792) (-6486.909) [-6475.885] * [-6476.308] (-6479.123) (-6487.927) (-6476.422) -- 0:02:25 812000 -- (-6483.771) (-6486.006) [-6484.062] (-6484.870) * (-6481.363) (-6480.896) (-6489.750) [-6479.604] -- 0:02:25 812500 -- (-6478.013) [-6476.122] (-6483.663) (-6483.826) * (-6485.918) (-6484.477) [-6475.191] (-6485.114) -- 0:02:24 813000 -- [-6479.886] (-6481.678) (-6481.643) (-6484.833) * (-6476.374) (-6487.050) [-6478.737] (-6477.920) -- 0:02:24 813500 -- [-6473.680] (-6477.738) (-6482.545) (-6484.270) * (-6479.313) (-6486.809) (-6476.314) [-6478.220] -- 0:02:23 814000 -- (-6484.138) (-6475.423) (-6478.846) [-6478.556] * (-6486.271) [-6480.187] (-6486.009) (-6481.711) -- 0:02:23 814500 -- (-6476.475) [-6484.763] (-6473.961) (-6488.601) * (-6475.196) [-6479.107] (-6486.004) (-6484.628) -- 0:02:23 815000 -- (-6479.209) (-6482.017) [-6480.495] (-6478.759) * (-6480.924) (-6476.429) (-6482.600) [-6480.761] -- 0:02:22 Average standard deviation of split frequencies: 0.000000 815500 -- (-6479.962) [-6481.846] (-6482.302) (-6480.037) * (-6475.679) (-6478.796) (-6490.098) [-6478.500] -- 0:02:22 816000 -- (-6486.216) (-6483.356) (-6477.696) [-6476.732] * [-6478.658] (-6475.540) (-6481.498) (-6476.137) -- 0:02:22 816500 -- (-6477.016) (-6478.876) [-6482.985] (-6480.899) * [-6478.081] (-6486.494) (-6499.124) (-6480.805) -- 0:02:21 817000 -- (-6480.235) (-6490.272) [-6482.576] (-6484.537) * (-6479.679) [-6477.837] (-6484.562) (-6477.408) -- 0:02:21 817500 -- (-6485.114) [-6482.402] (-6481.833) (-6480.031) * (-6488.017) [-6476.529] (-6483.164) (-6480.174) -- 0:02:20 818000 -- (-6480.051) [-6480.366] (-6477.352) (-6477.347) * [-6478.114] (-6479.217) (-6487.356) (-6482.806) -- 0:02:20 818500 -- [-6482.560] (-6489.256) (-6481.681) (-6477.391) * (-6478.102) (-6476.515) (-6485.363) [-6480.875] -- 0:02:19 819000 -- (-6483.017) (-6477.740) (-6477.616) [-6478.423] * (-6481.388) [-6477.940] (-6483.796) (-6485.560) -- 0:02:19 819500 -- (-6480.162) [-6481.356] (-6478.729) (-6475.905) * (-6481.879) [-6474.705] (-6477.512) (-6482.943) -- 0:02:19 820000 -- (-6478.627) (-6478.296) [-6485.752] (-6483.700) * (-6482.921) [-6474.130] (-6477.720) (-6479.283) -- 0:02:18 Average standard deviation of split frequencies: 0.000000 820500 -- [-6479.753] (-6485.449) (-6481.112) (-6472.978) * (-6482.412) (-6476.865) (-6475.452) [-6479.562] -- 0:02:18 821000 -- (-6476.158) (-6480.589) [-6478.416] (-6476.473) * (-6482.028) [-6482.108] (-6480.725) (-6483.447) -- 0:02:18 821500 -- (-6478.487) (-6486.576) [-6482.357] (-6475.938) * (-6481.204) (-6481.432) (-6478.983) [-6475.492] -- 0:02:17 822000 -- (-6486.912) (-6477.117) [-6483.735] (-6479.995) * (-6479.057) (-6486.209) (-6479.184) [-6477.285] -- 0:02:17 822500 -- (-6483.790) (-6480.269) [-6482.861] (-6480.618) * (-6477.955) [-6480.253] (-6476.792) (-6476.170) -- 0:02:17 823000 -- (-6475.767) [-6477.650] (-6485.412) (-6478.806) * (-6481.561) [-6482.714] (-6490.550) (-6484.941) -- 0:02:16 823500 -- (-6481.176) (-6476.033) [-6481.617] (-6483.738) * (-6475.736) [-6476.314] (-6488.103) (-6481.535) -- 0:02:16 824000 -- (-6487.722) (-6486.495) (-6476.942) [-6474.946] * [-6479.838] (-6481.275) (-6482.910) (-6485.267) -- 0:02:15 824500 -- (-6481.531) (-6484.151) (-6484.279) [-6490.362] * (-6475.122) (-6479.834) [-6482.396] (-6478.723) -- 0:02:15 825000 -- (-6487.971) [-6477.614] (-6481.188) (-6480.830) * (-6478.245) (-6488.986) (-6480.910) [-6477.342] -- 0:02:14 Average standard deviation of split frequencies: 0.000000 825500 -- (-6476.212) (-6476.405) [-6479.460] (-6479.971) * (-6484.809) (-6482.005) [-6475.962] (-6474.111) -- 0:02:14 826000 -- (-6477.884) (-6487.894) (-6478.569) [-6482.824] * (-6486.266) (-6479.076) (-6485.176) [-6476.843] -- 0:02:14 826500 -- [-6481.518] (-6485.131) (-6475.352) (-6478.282) * [-6479.235] (-6482.683) (-6479.830) (-6482.399) -- 0:02:13 827000 -- [-6473.718] (-6488.675) (-6479.244) (-6480.712) * [-6478.562] (-6489.684) (-6478.277) (-6476.227) -- 0:02:13 827500 -- [-6481.449] (-6479.997) (-6477.516) (-6480.446) * (-6485.381) (-6477.057) [-6477.876] (-6476.456) -- 0:02:12 828000 -- (-6478.600) (-6476.138) [-6478.660] (-6480.547) * (-6477.136) (-6485.825) [-6480.205] (-6480.978) -- 0:02:12 828500 -- (-6477.936) [-6475.880] (-6481.726) (-6477.951) * (-6479.201) [-6476.875] (-6484.780) (-6479.958) -- 0:02:12 829000 -- [-6480.415] (-6475.810) (-6482.804) (-6479.595) * (-6480.238) (-6485.291) [-6475.672] (-6482.025) -- 0:02:11 829500 -- [-6479.157] (-6475.179) (-6480.795) (-6475.599) * (-6480.416) (-6482.321) [-6484.207] (-6481.711) -- 0:02:11 830000 -- (-6485.224) (-6488.167) [-6487.086] (-6480.593) * [-6482.029] (-6488.565) (-6476.096) (-6484.835) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 830500 -- [-6484.051] (-6483.611) (-6481.265) (-6477.228) * (-6479.215) [-6479.088] (-6476.205) (-6484.310) -- 0:02:10 831000 -- (-6477.167) (-6478.205) [-6479.461] (-6476.036) * [-6473.171] (-6482.902) (-6477.045) (-6476.875) -- 0:02:10 831500 -- (-6476.522) [-6482.361] (-6477.115) (-6480.796) * (-6486.793) (-6477.422) [-6474.733] (-6477.124) -- 0:02:09 832000 -- (-6475.276) (-6483.756) (-6474.993) [-6480.830] * (-6492.319) (-6480.214) (-6485.470) [-6480.432] -- 0:02:09 832500 -- (-6476.072) (-6480.475) [-6474.488] (-6481.863) * [-6476.948] (-6481.733) (-6480.484) (-6478.124) -- 0:02:09 833000 -- [-6480.821] (-6478.365) (-6483.270) (-6479.013) * (-6487.334) [-6476.892] (-6480.669) (-6486.424) -- 0:02:08 833500 -- (-6478.299) (-6483.692) (-6477.253) [-6477.385] * (-6484.070) (-6477.243) (-6483.775) [-6476.657] -- 0:02:08 834000 -- (-6484.667) [-6477.812] (-6483.772) (-6485.712) * (-6480.623) (-6474.623) (-6484.139) [-6485.422] -- 0:02:07 834500 -- (-6488.936) [-6478.789] (-6486.472) (-6482.478) * [-6480.871] (-6477.654) (-6485.627) (-6489.736) -- 0:02:07 835000 -- (-6485.041) [-6478.709] (-6486.904) (-6482.253) * (-6483.222) [-6475.053] (-6487.319) (-6491.578) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 835500 -- (-6485.603) [-6478.256] (-6483.608) (-6482.744) * (-6483.163) (-6472.825) (-6474.910) [-6487.170] -- 0:02:06 836000 -- (-6477.998) (-6478.551) [-6472.966] (-6478.235) * [-6479.578] (-6481.534) (-6479.253) (-6480.634) -- 0:02:06 836500 -- (-6484.811) [-6479.724] (-6475.955) (-6476.283) * (-6475.516) (-6472.858) (-6481.012) [-6478.506] -- 0:02:06 837000 -- (-6476.287) (-6482.512) (-6480.848) [-6477.221] * (-6476.103) (-6481.159) [-6483.056] (-6481.049) -- 0:02:05 837500 -- (-6485.580) (-6479.639) [-6480.848] (-6476.476) * [-6475.590] (-6479.385) (-6480.361) (-6478.638) -- 0:02:05 838000 -- (-6484.180) [-6489.297] (-6479.755) (-6481.713) * (-6474.818) (-6481.066) [-6475.027] (-6478.369) -- 0:02:04 838500 -- (-6488.836) [-6480.265] (-6481.568) (-6478.524) * (-6477.854) (-6479.319) [-6473.937] (-6478.557) -- 0:02:04 839000 -- [-6484.847] (-6476.586) (-6486.638) (-6476.940) * (-6479.075) (-6478.826) (-6474.595) [-6481.296] -- 0:02:04 839500 -- (-6482.481) (-6481.514) (-6478.320) [-6479.527] * (-6487.964) (-6477.928) (-6482.381) [-6476.790] -- 0:02:03 840000 -- [-6477.490] (-6480.054) (-6477.806) (-6481.582) * (-6486.729) [-6480.082] (-6486.829) (-6476.024) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 840500 -- (-6482.984) (-6481.660) [-6482.093] (-6476.601) * (-6481.078) (-6484.173) [-6480.196] (-6480.137) -- 0:02:02 841000 -- (-6478.442) (-6486.658) (-6478.477) [-6478.575] * (-6477.997) (-6481.195) (-6485.841) [-6479.367] -- 0:02:02 841500 -- (-6475.063) (-6480.658) (-6483.050) [-6481.808] * (-6481.966) (-6480.133) [-6483.470] (-6486.689) -- 0:02:02 842000 -- (-6476.669) (-6482.313) [-6476.536] (-6475.718) * [-6482.651] (-6477.776) (-6476.080) (-6480.184) -- 0:02:01 842500 -- [-6480.665] (-6480.675) (-6477.131) (-6481.262) * (-6484.653) [-6481.251] (-6475.977) (-6478.977) -- 0:02:01 843000 -- (-6477.696) (-6481.573) [-6472.524] (-6474.475) * (-6482.927) (-6480.206) [-6483.864] (-6480.034) -- 0:02:01 843500 -- (-6480.735) [-6480.460] (-6479.760) (-6479.873) * (-6478.939) [-6481.461] (-6481.383) (-6477.637) -- 0:02:00 844000 -- (-6476.918) [-6478.751] (-6480.251) (-6482.879) * (-6485.392) (-6479.880) (-6485.064) [-6478.559] -- 0:02:00 844500 -- (-6484.402) (-6477.797) (-6476.002) [-6475.958] * (-6479.072) [-6477.309] (-6483.225) (-6484.595) -- 0:01:59 845000 -- (-6480.457) (-6480.095) (-6480.710) [-6482.229] * (-6480.285) (-6479.967) [-6480.855] (-6485.514) -- 0:01:59 Average standard deviation of split frequencies: 0.000000 845500 -- (-6483.479) [-6475.123] (-6483.520) (-6478.683) * (-6485.049) (-6486.898) (-6491.089) [-6480.893] -- 0:01:59 846000 -- [-6478.832] (-6477.118) (-6483.468) (-6474.566) * [-6480.210] (-6478.111) (-6477.045) (-6475.915) -- 0:01:58 846500 -- (-6476.566) [-6474.373] (-6482.778) (-6482.125) * (-6475.738) [-6479.933] (-6477.300) (-6475.055) -- 0:01:58 847000 -- (-6491.353) [-6482.848] (-6479.260) (-6478.942) * (-6475.320) [-6474.010] (-6476.008) (-6473.470) -- 0:01:57 847500 -- [-6481.342] (-6476.311) (-6485.765) (-6486.603) * (-6474.041) (-6474.132) [-6476.372] (-6476.314) -- 0:01:57 848000 -- (-6474.733) (-6480.481) (-6481.460) [-6479.142] * (-6487.705) (-6479.754) [-6475.684] (-6486.527) -- 0:01:57 848500 -- (-6476.542) (-6476.141) [-6480.696] (-6485.763) * (-6480.038) (-6472.914) [-6479.818] (-6482.527) -- 0:01:56 849000 -- (-6474.944) (-6483.304) [-6479.037] (-6484.753) * (-6480.031) [-6480.947] (-6479.118) (-6481.762) -- 0:01:56 849500 -- (-6482.008) (-6481.167) [-6478.492] (-6482.301) * (-6480.277) (-6488.072) (-6478.784) [-6477.748] -- 0:01:56 850000 -- (-6485.338) [-6476.508] (-6479.501) (-6480.545) * (-6475.826) (-6477.206) (-6485.038) [-6476.961] -- 0:01:55 Average standard deviation of split frequencies: 0.000000 850500 -- (-6493.610) [-6477.336] (-6482.209) (-6477.555) * (-6480.868) (-6480.671) (-6486.449) [-6477.837] -- 0:01:55 851000 -- [-6476.836] (-6481.314) (-6491.106) (-6477.642) * (-6481.169) [-6490.047] (-6483.390) (-6478.283) -- 0:01:54 851500 -- [-6476.384] (-6478.512) (-6482.955) (-6480.228) * [-6478.508] (-6493.448) (-6476.036) (-6480.254) -- 0:01:54 852000 -- (-6487.381) [-6481.817] (-6479.150) (-6482.252) * [-6478.154] (-6482.586) (-6476.615) (-6482.514) -- 0:01:54 852500 -- [-6483.150] (-6476.093) (-6485.247) (-6479.143) * (-6477.355) [-6477.557] (-6485.333) (-6487.659) -- 0:01:53 853000 -- (-6480.576) (-6486.379) (-6478.588) [-6481.674] * [-6482.284] (-6475.829) (-6488.027) (-6477.614) -- 0:01:53 853500 -- (-6477.650) (-6477.130) (-6479.540) [-6477.091] * (-6481.797) (-6472.243) (-6487.920) [-6477.241] -- 0:01:52 854000 -- (-6476.494) (-6483.843) [-6475.548] (-6478.489) * [-6477.134] (-6483.706) (-6483.422) (-6476.960) -- 0:01:52 854500 -- (-6488.048) (-6474.773) [-6480.631] (-6482.214) * (-6478.654) (-6478.386) (-6484.132) [-6479.436] -- 0:01:52 855000 -- (-6474.081) (-6482.649) (-6480.553) [-6480.511] * (-6482.155) [-6482.248] (-6477.452) (-6480.184) -- 0:01:51 Average standard deviation of split frequencies: 0.000000 855500 -- [-6474.614] (-6478.578) (-6482.190) (-6478.954) * (-6485.292) (-6482.180) [-6478.450] (-6477.337) -- 0:01:51 856000 -- [-6477.505] (-6474.315) (-6483.218) (-6478.651) * (-6481.261) (-6485.399) (-6480.474) [-6472.952] -- 0:01:51 856500 -- (-6475.922) (-6472.875) [-6483.768] (-6493.556) * [-6477.113] (-6486.485) (-6476.016) (-6476.210) -- 0:01:50 857000 -- (-6479.135) [-6474.715] (-6480.455) (-6486.152) * (-6483.385) (-6483.949) (-6477.484) [-6474.420] -- 0:01:50 857500 -- (-6480.794) (-6483.019) (-6481.258) [-6477.593] * (-6485.400) [-6483.660] (-6488.608) (-6479.865) -- 0:01:49 858000 -- [-6478.086] (-6481.709) (-6479.979) (-6481.668) * [-6479.882] (-6486.422) (-6476.823) (-6482.136) -- 0:01:49 858500 -- [-6488.000] (-6485.925) (-6486.270) (-6481.028) * (-6480.489) (-6478.871) [-6477.495] (-6476.548) -- 0:01:49 859000 -- [-6474.713] (-6481.617) (-6480.558) (-6481.402) * [-6475.124] (-6481.018) (-6480.501) (-6483.622) -- 0:01:48 859500 -- (-6477.566) (-6480.923) (-6486.921) [-6479.834] * (-6486.604) (-6480.739) [-6475.616] (-6485.177) -- 0:01:48 860000 -- (-6478.808) (-6483.372) [-6483.691] (-6481.258) * (-6478.391) (-6477.710) [-6477.375] (-6477.830) -- 0:01:47 Average standard deviation of split frequencies: 0.000000 860500 -- (-6477.032) [-6482.740] (-6476.245) (-6482.763) * (-6478.960) (-6489.875) [-6479.056] (-6480.940) -- 0:01:47 861000 -- (-6484.623) (-6491.560) [-6481.829] (-6475.527) * (-6483.818) [-6476.361] (-6483.048) (-6480.946) -- 0:01:47 861500 -- (-6478.128) (-6484.829) (-6486.421) [-6479.855] * (-6483.414) (-6473.125) (-6475.833) [-6488.794] -- 0:01:46 862000 -- [-6472.272] (-6479.398) (-6482.940) (-6476.768) * (-6475.392) (-6480.004) [-6475.565] (-6485.438) -- 0:01:46 862500 -- (-6476.693) (-6476.394) (-6482.311) [-6476.006] * [-6480.138] (-6477.899) (-6483.343) (-6482.197) -- 0:01:46 863000 -- [-6479.303] (-6477.948) (-6480.469) (-6475.079) * [-6477.253] (-6480.157) (-6484.715) (-6484.472) -- 0:01:45 863500 -- (-6480.530) (-6481.439) [-6477.528] (-6476.029) * (-6482.005) [-6483.937] (-6478.997) (-6476.253) -- 0:01:45 864000 -- (-6483.161) [-6476.803] (-6480.524) (-6477.775) * (-6478.427) (-6477.783) [-6474.082] (-6480.884) -- 0:01:44 864500 -- (-6476.573) [-6482.362] (-6482.271) (-6479.315) * (-6483.529) (-6479.749) (-6477.964) [-6478.213] -- 0:01:44 865000 -- (-6486.320) (-6481.427) (-6482.836) [-6480.844] * (-6