--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Apr 12 00:52:40 WEST 2018
codeml.models=1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=
tcoffee.dir=
tcoffee.minScore=3
input.fasta=
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2070.09 -2086.67
2 -2070.24 -2083.84
--------------------------------------
TOTAL -2070.16 -2086.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)
95% Cred. Interval
----------------------
Parameter Mean Variance Lower Upper Median PSRF *
---------------------------------------------------------------------------------------------
TL{all} 0.387002 0.002772 0.302000 0.506000 0.381000 1.002
r(A<->C){all} 0.063303 0.000621 0.021490 0.117950 0.060938 1.000
r(A<->G){all} 0.298973 0.001963 0.216633 0.390808 0.297989 1.000
r(A<->T){all} 0.103916 0.001019 0.049369 0.171716 0.101087 1.001
r(C<->G){all} 0.097919 0.000523 0.057623 0.147252 0.096397 1.000
r(C<->T){all} 0.366160 0.002758 0.268401 0.474117 0.364419 1.000
r(G<->T){all} 0.069729 0.000452 0.033963 0.117084 0.067622 1.000
pi(A){all} 0.223771 0.000189 0.197390 0.251420 0.223506 1.000
pi(C){all} 0.252485 0.000208 0.224846 0.281379 0.252357 1.000
pi(G){all} 0.319789 0.000228 0.290485 0.349826 0.319538 1.000
pi(T){all} 0.203956 0.000181 0.178250 0.231141 0.203611 1.000
alpha{1,2} 28.031627 2721.559097 0.308864 180.764229 1.105597 1.012
alpha{3} 101.990667 3266.394053 6.809541 195.003643 100.976671 1.000
pinvar{all} 0.607037 0.006145 0.427042 0.720997 0.620129 1.007
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
--- CODEML SUMMARY
Model 8: beta&w>1 -2002.415363
Model 7: beta -2013.086717
Model 1: NearlyNeutral -2012.263927
Model 2: PositiveSelection -2002.425163
Model 2 vs 1 19.67752799999971
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.593 3.085
14 K 0.962* 4.446
38 Q 0.647 3.312
42 Y 0.929 4.329
55 F 0.963* 4.451
59 D 0.885 4.171
66 D 0.730 3.610
67 L 0.847 4.030
95 F 0.961* 4.442
98 D 0.992** 4.554
99 R 0.641 3.255
102 A 0.727 3.599
106 Y 0.939 4.363
114 G 0.961* 4.442
118 T 0.733 3.607
124 E 0.906 4.248
185 T 0.580 3.035
243 A 0.786 3.812
259 H 0.536 2.870
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
14 K 0.939 5.211 +- 2.037
38 Q 0.517 2.982 +- 2.230
42 Y 0.897 5.014 +- 2.172
55 F 0.949 5.278 +- 2.013
59 D 0.787 4.346 +- 2.291
66 D 0.595 3.358 +- 2.306
67 L 0.798 4.527 +- 2.395
95 F 0.943 5.246 +- 2.030
98 D 0.989* 5.475 +- 1.846
99 R 0.530 3.083 +- 2.368
102 A 0.595 3.367 +- 2.316
106 Y 0.897 4.986 +- 2.148
114 G 0.941 5.235 +- 2.035
118 T 0.629 3.585 +- 2.429
124 E 0.821 4.530 +- 2.253
243 A 0.662 3.705 +- 2.351
Model 8 vs 7 21.342707999999675
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.661 3.108
14 K 0.985* 4.340
38 Q 0.757 3.486
40 D 0.534 2.622
42 Y 0.963* 4.256
55 F 0.985* 4.339
59 D 0.951* 4.212
66 D 0.828 3.750
67 L 0.901 4.022
95 F 0.984* 4.336
98 D 0.997** 4.384
99 R 0.692 3.221
102 A 0.825 3.740
106 Y 0.971* 4.287
114 G 0.985* 4.337
118 T 0.797 3.625
124 E 0.962* 4.252
185 T 0.644 3.043
243 A 0.871 3.914
259 H 0.603 2.885
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.571 2.856 +- 2.258
14 K 0.975* 4.930 +- 1.855
38 Q 0.640 3.168 +- 2.234
42 Y 0.946 4.797 +- 1.964
55 F 0.978* 4.949 +- 1.848
59 D 0.898 4.509 +- 2.057
66 D 0.719 3.569 +- 2.253
67 L 0.870 4.438 +- 2.183
95 F 0.976* 4.937 +- 1.855
98 D 0.996** 5.032 +- 1.772
99 R 0.608 3.059 +- 2.323
102 A 0.719 3.575 +- 2.260
106 Y 0.952* 4.813 +- 1.935
114 G 0.975* 4.934 +- 1.856
118 T 0.720 3.625 +- 2.337
124 E 0.919 4.623 +- 2.009
185 T 0.563 2.833 +- 2.273
243 A 0.782 3.905 +- 2.236
259 H 0.517 2.586 +- 2.178
>C1
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
RAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
FYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS
>C2
MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT
EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGRHAEYWNGQKDVLEDRR
AEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSGF
YPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVYS
CEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYFR
NQKGHSGLQPTGLLNo
>C3
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDVLEDE
RASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVY
TCQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT
ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRPDAEYWNSQKDLLERR
RAEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDILERR
RAAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
TCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS
>C6
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT
ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
RAAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNG
FYPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYF
RNQKGHSGLQPTGLVS
>C7
MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDR
RAAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=267
C1 MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
C2 MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT
C3 MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
C4 MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT
C5 MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
C6 MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT
C7 MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT
** * :.*** ** **: *****.****: ***.***. :*.**** ***
C1 ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
C2 EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGR-HAEYWNGQKDVLEDR
C3 ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDVLEDE
C4 ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRPDAEYWNSQKDLLERR
C5 ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDILERR
C6 ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
C7 ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDR
* ** :** ***:** ***************** .*****.***.** .
C1 RAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
C2 RAEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSG
C3 RASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
C4 RAEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
C5 RAAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNG
C6 RAAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNG
C7 RAAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
** *** ***** : : * * *** *******::**.***********.*
C1 FYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
C2 FYPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVY
C3 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVY
C4 FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
C5 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
C6 FYPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
C7 FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
***..***:****.***::********:*****:* ********:*****
C1 TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C2 SCEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYF
C3 TCQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C4 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C5 TCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
C6 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYF
C7 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
:*:* ***: *:******:***********:********** **:***
C1 KNQKGHSGLHPTGLVS-
C2 RNQKGHSGLQPTGLLNo
C3 KNQKGHSGLHPTGLVS-
C4 RNQKGHSGLQPTGLLS-
C5 KNQKGHSGLHPTGLVS-
C6 RNQKGHSGLQPTGLVS-
C7 RNQKGHSGLQPTGLLS-
:********:****:.
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 266 type PROTEIN Struct Unchecked
Input File /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7 Length 266 type PROTEIN Struct Unchecked
Multi Core Mode: 8 processors:
--- Process Method/Library/Aln S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11224]
Library Relaxation: Multi_proc [8]
Relaxation Summary: [11224]--->[11222]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/tcoffee/input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.553 Mb, Max= 30.957 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRDAEYWNSQKDFLEDRR
AAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGF
YPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFK
NQKGHSGLHPTGLVS
>C2
MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT
EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGRHAEYWNGQKDVLEDRR
AEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSGF
YPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVYS
CEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYFR
NQKGHSGLQPTGLLN
>C3
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRDAEYWNSQKDVLEDER
ASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVYT
CQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFK
NQKGHSGLHPTGLVS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT
ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRDAEYWNSQKDLLERRR
AEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
NQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRDAEYWNSQKDILERRR
AAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVYT
CQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFK
NQKGHSGLHPTGLVS
>C6
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT
ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRDAEYWNSQKDFLEDRR
AAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNGF
YPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFR
NQKGHSGLQPTGLVS
>C7
MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRDAEYWNSQKDILEDRR
AAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
NQKGHSGLQPTGLLS
FORMAT of file /tmp/tmp3701335031495708246aln Not Supported[FATAL:T-COFFEE]
>C1
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRDAEYWNSQKDFLEDRR
AAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGF
YPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYFK
NQKGHSGLHPTGLVS
>C2
MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT
EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGRHAEYWNGQKDVLEDRR
AEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSGF
YPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVYS
CEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYFR
NQKGHSGLQPTGLLN
>C3
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRDAEYWNSQKDVLEDER
ASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVYT
CQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFK
NQKGHSGLHPTGLVS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT
ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRDAEYWNSQKDLLERRR
AEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
NQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRDAEYWNSQKDILERRR
AAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVYT
CQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFK
NQKGHSGLHPTGLVS
>C6
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT
ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRDAEYWNSQKDFLEDRR
AAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNGF
YPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFR
NQKGHSGLQPTGLVS
>C7
MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRDAEYWNSQKDILEDRR
AAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNGF
YPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYT
CQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
NQKGHSGLQPTGLLS
input.fasta.prot.fasta.muscle_rs_0_0.fasta.aln I:265 S:99 BS:265
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 78.11 C1 C2 78.11
TOP 1 0 78.11 C2 C1 78.11
BOT 0 2 95.49 C1 C3 95.49
TOP 2 0 95.49 C3 C1 95.49
BOT 0 3 92.11 C1 C4 92.11
TOP 3 0 92.11 C4 C1 92.11
BOT 0 4 94.36 C1 C5 94.36
TOP 4 0 94.36 C5 C1 94.36
BOT 0 5 93.61 C1 C6 93.61
TOP 5 0 93.61 C6 C1 93.61
BOT 0 6 93.98 C1 C7 93.98
TOP 6 0 93.98 C7 C1 93.98
BOT 1 2 78.11 C2 C3 78.11
TOP 2 1 78.11 C3 C2 78.11
BOT 1 3 79.62 C2 C4 79.62
TOP 3 1 79.62 C4 C2 79.62
BOT 1 4 79.25 C2 C5 79.25
TOP 4 1 79.25 C5 C2 79.25
BOT 1 5 79.25 C2 C6 79.25
TOP 5 1 79.25 C6 C2 79.25
BOT 1 6 79.25 C2 C7 79.25
TOP 6 1 79.25 C7 C2 79.25
BOT 2 3 92.11 C3 C4 92.11
TOP 3 2 92.11 C4 C3 92.11
BOT 2 4 95.11 C3 C5 95.11
TOP 4 2 95.11 C5 C3 95.11
BOT 2 5 92.86 C3 C6 92.86
TOP 5 2 92.86 C6 C3 92.86
BOT 2 6 93.98 C3 C7 93.98
TOP 6 2 93.98 C7 C3 93.98
BOT 3 4 92.86 C4 C5 92.86
TOP 4 3 92.86 C5 C4 92.86
BOT 3 5 92.11 C4 C6 92.11
TOP 5 3 92.11 C6 C4 92.11
BOT 3 6 96.24 C4 C7 96.24
TOP 6 3 96.24 C7 C4 96.24
BOT 4 5 93.61 C5 C6 93.61
TOP 5 4 93.61 C6 C5 93.61
BOT 4 6 94.36 C5 C7 94.36
TOP 6 4 94.36 C7 C5 94.36
BOT 5 6 93.23 C6 C7 93.23
TOP 6 5 93.23 C7 C6 93.23
AVG 0 C1 * 91.28
AVG 1 C2 * 78.93
AVG 2 C3 * 91.28
AVG 3 C4 * 90.84
AVG 4 C5 * 91.59
AVG 5 C6 * 90.78
AVG 6 C7 * 91.84
TOT TOT * 89.50
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAAAGCTGACAGT
C2 ATGGTGCACCTGTGGTTCCCTGGAGGGTCCTGGATGGCAGCTCTGACAAT
C3 ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGTGCTGACAGT
C4 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
C5 ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGTGCTGACAGT
C6 ATGGTATGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGCGCTGACAGT
C7 ATGGTGTGTCTGAAGCTCTCTGGAGGCTCCTGCATGGCAGCTCTCACAGT
*****. . ***:.* ** ******* ****. ******. ** ***.*
C1 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C2 GATACTGATGGTGCTGAGCCCTCCCCTGGCTTTGGCTACGGACACCCGCC
C3 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C4 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGACTGGGGACACCCGAC
C5 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
C6 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
C7 GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
** **************** * **.*********.**. *********.
C1 CACGTTTCTTGCAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG
C2 CGCGTTTCCTGGAACTGAATAAATTTGAGTGTCATTTCTCCAACGGGACG
C3 CACGTTTCTTGAAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG
C4 CACGTTTCTTGAAGCAGGAAAAGTTTGAGTGTCACTTCTTCAACGGGACG
C5 CACGTTTCTTGAAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG
C6 CACGTTTCTTGAGACAGGATAAGTATGAGTGTCATTTCTTCAACGGGACC
C7 CACGTTTCTTGAAGCAGGATAAGCATGAGTGTCATTTCTTCAACGGGACG
*.****** ** ..*:*.*:**. :********* **** *********
C1 GAGCGGGTGCGGTTCCTGCACAGAGACATCTATAACCAAGAGGAGGACTT
C2 GAGGGGGTGCGGTTCGTGCACAGAAAAATCTACAACCGGGAGGAGGTCGT
C3 GAGCGGGTGCGGTATCTGCACAGAGACATCTATAACCAAGAGGAGGACTT
C4 GAGCGGGTGCGGTTGCTGCACAGATACATCTATAACCAAGAGGAGGACGC
C5 GAGCGGGTGCGGTATCTGCACAGAGACATCTATAACCAAGAGGAGAACGT
C6 GAGCGGGTGCGGTTCCTGCACAGAGGCATCTATAACCAAGAAGAGAACGT
C7 GAGCGGGTGCGGTACCTGCACAGAGACATCTACAACCAAGAGGAAGACTT
*** *********: ******** ..***** ****..**.**..:*
C1 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C2 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C3 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C4 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C5 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C6 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
C7 GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
**************************************************
C1 GGCCTGACGCTGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGG
C2 GG---CACGCCGAGTACTGGAACGGGCAGAAGGACGTCCTGGAGGACCGA
C3 GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACGTCCTGGAAGACGAG
C4 GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGG
C5 GGCCTGACGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCGGAGG
C6 GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGG
C7 GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAGG
** **** ************.* ********* *******. . ..
C1 CGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGGTGAGAG
C2 CGGGCTGAGGTGGACACGGTGTGCAGACACAACTACGAGATTTCCGATAG
C3 CGGGCCTCGGTGGACACCTATTGCAGACACAACTACGGGGTTGTGGAGAG
C4 CGGGCCGAGGTGGACACCTACTGCAGACACAACTATGGGGTTGTGGAGAG
C5 CGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGCTGAGAG
C6 CGGGCCGCGGTGGACACCTTCTGCAGACACAACTACGGGGTTGTGGAGAG
C7 CGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGTGGAGAG
** ** .********* : ************** *.*.** ** **
C1 CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
C2 ATTCCTGGTGCCGCGGCGAGTTCTGCCTAAGGTAACCGTGTACCCTACAA
C3 CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
C4 CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTAACTGTGTATCCTGCAA
C5 CTTCACAGTGCAGCGGCGAGTCCACCCTAAGGTGACTGTGTATCCTGCAA
C6 CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
C7 CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTAACTGTGTATCCTGCAA
.***. .****.********* : ********.** ***** ***.***
C1 GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C2 AGACCCAGCCCCTGCAACACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
C3 GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C4 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C5 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C6 AGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
C7 AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAACGGT
.*******.*******.****************************. ***
C1 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAGCCAGGAAGA
C2 TTCTATCCAGGCAACATCGAAGTCAAGTGGTTCCGGAATGGCCAGGAAGA
C3 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C4 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C5 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
C6 TTCTATCCAGACAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
C7 TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
**********.**.*** *******.************ .**********
C1 GAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCT
C2 GGAGGCTGGAGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C3 GAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCT
C4 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCT
C5 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
C6 GAAGACTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACTT
C7 GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCT
*.**.****.***** ************** ** ************** *
C1 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTAC
C2 ACCAGATCTTAGTGATGCTTGAAACAGTTCCTCAGAGTGGAGAGGTGTAC
C3 TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
C4 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTAC
C5 TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C6 TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
C7 TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
:***** *.******** *************..*********** ***
C1 ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
C2 AGCTGTGAAGTGGGGCACCCAAGTCTGATGAGCCCTGTCACAGTGGAATG
C3 ACCTGCCAAGTGGAGCACCCAAGCGTGACGATCCCTCTCACAGTGGAATG
C4 ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
C5 ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGGAATG
C6 ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
C7 ACCTGCCAAGTGGAGCACCCGAGCGTGACAAGCCCTCTCACAGTGGAATG
* *** ******.******.** *** * **** *************
C1 GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C2 GAGGGCACAGTCTGAGTCTGCACAGAGCAAGATGCTGAGTGGAATTGGAG
C3 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C4 GAGAGCACGGTCTGAATCCGCACAGAGCAAGATGCTGAGTGGAGTTGGGG
C5 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C6 GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
C7 GAGAGCACGGTCTGAATCCGCACAGAGCAAGATGCTGAGTGGAGTTGGGG
***.****.******.** ************************.* **.*
C1 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTATTCATCTACTTC
C2 GCTTTGTACTGGGCCTGCTCTTCCTCGTGATAGGTCTGCTCATCTACTTC
C3 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTATTCATCTACTTC
C4 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C5 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
C6 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGACCGGGCTGTTCATCTACTTC
C7 GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
*******.***************** * *. ** **. ***********
C1 AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC--
C2 AGGAATCAGAAAGGGCACTCTGGACTTCAGCCAACAGGACTCCTGAAC--
C3 AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC--
C4 AGGAATCAGAAAGGACACTCTGGACTTCAACCAACAGGACTCCTGAGC--
C5 AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC--
C6 AGGAATCAGAAAGGGCACTCTGGACTTCAGCCAACAGGACTCGTGAGC--
C7 AGGAATCAGAAAGGACACTCTGGACTTCAACCAACAGGACTCCTGAGC--
*.************.************** ************ ***.*
C1 -
C2 -
C3 -
C4 -
C5 -
C6 -
C7 -
>C1
ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAAAGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGCAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTTCCTGCACAGAGACATCTATAACCAAGAGGAGGACTT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCTGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGG
CGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGGTGAGAG
CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTATTCATCTACTTC
AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC--
-
>C2
ATGGTGCACCTGTGGTTCCCTGGAGGGTCCTGGATGGCAGCTCTGACAAT
GATACTGATGGTGCTGAGCCCTCCCCTGGCTTTGGCTACGGACACCCGCC
CGCGTTTCCTGGAACTGAATAAATTTGAGTGTCATTTCTCCAACGGGACG
GAGGGGGTGCGGTTCGTGCACAGAAAAATCTACAACCGGGAGGAGGTCGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GG---CACGCCGAGTACTGGAACGGGCAGAAGGACGTCCTGGAGGACCGA
CGGGCTGAGGTGGACACGGTGTGCAGACACAACTACGAGATTTCCGATAG
ATTCCTGGTGCCGCGGCGAGTTCTGCCTAAGGTAACCGTGTACCCTACAA
AGACCCAGCCCCTGCAACACCACAACCTCCTGGTCTGCTCTGTGAGTGGT
TTCTATCCAGGCAACATCGAAGTCAAGTGGTTCCGGAATGGCCAGGAAGA
GGAGGCTGGAGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
ACCAGATCTTAGTGATGCTTGAAACAGTTCCTCAGAGTGGAGAGGTGTAC
AGCTGTGAAGTGGGGCACCCAAGTCTGATGAGCCCTGTCACAGTGGAATG
GAGGGCACAGTCTGAGTCTGCACAGAGCAAGATGCTGAGTGGAATTGGAG
GCTTTGTACTGGGCCTGCTCTTCCTCGTGATAGGTCTGCTCATCTACTTC
AGGAATCAGAAAGGGCACTCTGGACTTCAGCCAACAGGACTCCTGAAC--
-
>C3
ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGTGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGAAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTATCTGCACAGAGACATCTATAACCAAGAGGAGGACTT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACGTCCTGGAAGACGAG
CGGGCCTCGGTGGACACCTATTGCAGACACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCT
TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGATCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTATTCATCTACTTC
AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC--
-
>C4
ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGACTGGGGACACCCGAC
CACGTTTCTTGAAGCAGGAAAAGTTTGAGTGTCACTTCTTCAACGGGACG
GAGCGGGTGCGGTTGCTGCACAGATACATCTATAACCAAGAGGAGGACGC
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGG
CGGGCCGAGGTGGACACCTACTGCAGACACAACTATGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTAACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCCGCACAGAGCAAGATGCTGAGTGGAGTTGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAACCAACAGGACTCCTGAGC--
-
>C5
ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGTGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGAAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTATCTGCACAGAGACATCTATAACCAAGAGGAGAACGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCGGAGG
CGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGCTGAGAG
CTTCACAGTGCAGCGGCGAGTCCACCCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT
TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC
AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC--
-
>C6
ATGGTATGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGCGCTGACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT
CACGTTTCTTGAGACAGGATAAGTATGAGTGTCATTTCTTCAACGGGACC
GAGCGGGTGCGGTTCCTGCACAGAGGCATCTATAACCAAGAAGAGAACGT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGG
CGGGCCGCGGTGGACACCTTCTGCAGACACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA
AGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT
TTCTATCCAGACAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA
GAAGACTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACTT
TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGACCGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGGCACTCTGGACTTCAGCCAACAGGACTCGTGAGC--
-
>C7
ATGGTGTGTCTGAAGCTCTCTGGAGGCTCCTGCATGGCAGCTCTCACAGT
GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC
CACGTTTCTTGAAGCAGGATAAGCATGAGTGTCATTTCTTCAACGGGACG
GAGCGGGTGCGGTACCTGCACAGAGACATCTACAACCAAGAGGAAGACTT
GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC
GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAGG
CGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGTGGAGAG
CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTAACTGTGTATCCTGCAA
AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAACGGT
TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA
GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCT
TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC
ACCTGCCAAGTGGAGCACCCGAGCGTGACAAGCCCTCTCACAGTGGAATG
GAGAGCACGGTCTGAATCCGCACAGAGCAAGATGCTGAGTGGAGTTGGGG
GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC
AGGAATCAGAAAGGACACTCTGGACTTCAACCAACAGGACTCCTGAGC--
-
>C1
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
RAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
FYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS
>C2
MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT
EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGRoHAEYWNGQKDVLEDR
RAEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSG
FYPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVY
SCEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYF
RNQKGHSGLQPTGLLN
>C3
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDVLEDE
RASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVY
TCQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS
>C4
MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT
ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRPDAEYWNSQKDLLERR
RAEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
>C5
MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDILERR
RAAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
TCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
KNQKGHSGLHPTGLVS
>C6
MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT
ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
RAAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNG
FYPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYF
RNQKGHSGLQPTGLVS
>C7
MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT
ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDR
RAAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
RNQKGHSGLQPTGLLS
MrBayes v3.1.2
(Bayesian Analysis of Phylogeny)
by
John P. Huelsenbeck and Fredrik Ronquist
Section of Ecology, Behavior and Evolution
Division of Biological Sciences
University of California, San Diego
johnh@biomail.ucsd.edu
School of Computational Science
Florida State University
ronquist@csit.fsu.edu
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Executing file "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 62
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated matrix
Matrix has 7 taxa and 801 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Setting default partition (does not divide up characters).
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Setting output file names to "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p/t>"
Successfully read matrix
Exiting data block
Reading MrBayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Resetting model values to defaults (NB! Any existing model settings will be deleted!)
Reinitializing link table (linking all parameters)
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3459631009
Seed = 1523490400
Swapseed = 1523490400
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is uniformly dist-
ributed on the interval (0.00,200.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is uniformly dist-
ributed on the interval (0.00,200.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is uniformly dist-
ributed on the interval (0.00,200.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Topology 6 6 6
Brlens 7 7 7
------------------------
All parameters can be linked or unlinked across partitions
1 -- Parameter = Revmat
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = 1, 2, and 3
2 -- Parameter = Statefreq
Prior = Dirichlet
Partitions = 1, 2, and 3
3 -- Parameter = Shape
Prior = Uniform(0.00,200.00)
Partitions = 1 and 2
4 -- Parameter = Shape
Prior = Uniform(0.00,200.00)
Partition = 3
5 -- Parameter = Pinvar
Prior = Uniform(0.00,1.00)
Partitions = 1, 2, and 3
6 -- Parameter = Topology
Prior = All topologies equally probable a priori
Partitions = 1, 2, and 3
7 -- Parameter = Brlens
Prior = Branch lengths are Unconstrained:Exponential(10.0)
Partitions = 1, 2, and 3
Number of taxa = 7
Number of characters = 801
Compressing data matrix for division 1
Division 1 has 34 unique site patterns
Compressing data matrix for division 2
Division 2 has 35 unique site patterns
Compressing data matrix for division 3
Division 3 has 52 unique site patterns
The MCMC sampler will use the following moves:
With prob. Chain will change
4.00 % param. 1 (revmat) with Dirichlet proposal
4.00 % param. 2 (state frequencies) with Dirichlet proposal
4.00 % param. 3 (gamma shape) with multiplier
4.00 % param. 4 (gamma shape) with multiplier
4.00 % param. 5 (prop. invar. sites) with sliding window
60.00 % param. 6 (topology and branch lengths) with extending TBR
20.00 % param. 6 (topology and branch lengths) with LOCAL
Creating parsimony (bitset) matrix for division 1
Creating parsimony (bitset) matrix for division 2
Creating parsimony (bitset) matrix for division 3
Initializing conditional likelihoods for terminals
Initializing invariable-site conditional likelihoods
Initializing conditional likelihoods for internal nodes
Initial log likelihoods for run 1:
Chain 1 -- -2424.634826
Chain 2 -- -2431.153364
Chain 3 -- -2441.936681
Chain 4 -- -2451.146300
Initial log likelihoods for run 2:
Chain 1 -- -2434.554857
Chain 2 -- -2430.392498
Chain 3 -- -2430.406221
Chain 4 -- -2435.165160
Chain results:
1 -- [-2424.635] (-2431.153) (-2441.937) (-2438.218) * [-2427.876] (-2430.392) (-2427.236) (-2425.123)
100 -- [-2185.247] (-2192.030) (-2228.674) (-2270.692) * [-2182.105] (-2235.061) (-2213.651) (-2207.433) -- 0:00:00
200 -- [-2121.526] (-2145.186) (-2147.102) (-2211.532) * (-2114.259) (-2139.655) [-2121.363] (-2167.622) -- 0:00:00
300 -- [-2102.738] (-2104.044) (-2115.113) (-2144.974) * [-2100.892] (-2112.232) (-2108.003) (-2130.399) -- 0:00:00
400 -- [-2098.158] (-2092.780) (-2104.058) (-2112.010) * [-2089.495] (-2094.164) (-2093.868) (-2109.438) -- 0:00:00
500 -- (-2099.277) (-2089.905) [-2084.999] (-2104.437) * [-2087.122] (-2091.240) (-2096.100) (-2104.899) -- 0:00:00
600 -- (-2097.546) (-2094.848) [-2081.903] (-2081.404) * [-2081.510] (-2080.464) (-2089.967) (-2096.667) -- 0:00:00
700 -- (-2092.372) (-2083.841) [-2082.688] (-2081.963) * (-2085.871) [-2074.186] (-2097.582) (-2095.359) -- 0:00:00
800 -- (-2088.113) (-2092.679) [-2080.960] (-2086.509) * (-2084.581) [-2080.381] (-2100.460) (-2089.560) -- 0:00:00
900 -- (-2088.443) (-2090.324) [-2079.107] (-2079.360) * (-2081.669) [-2076.581] (-2102.426) (-2074.127) -- 0:00:00
1000 -- (-2106.223) (-2092.441) [-2075.213] (-2085.422) * (-2075.485) (-2079.598) (-2097.953) [-2072.648] -- 0:00:00
Average standard deviation of split frequencies: 0.098209
1100 -- (-2090.735) (-2091.912) [-2078.437] (-2082.639) * (-2070.413) [-2075.432] (-2092.004) (-2078.249) -- 0:00:00
1200 -- [-2076.122] (-2082.218) (-2080.027) (-2080.022) * (-2075.591) (-2075.550) (-2089.104) [-2077.405] -- 0:00:00
1300 -- (-2080.854) (-2076.582) [-2071.516] (-2079.558) * (-2070.811) (-2075.562) (-2085.377) [-2078.161] -- 0:00:00
1400 -- [-2072.301] (-2079.765) (-2080.843) (-2082.233) * [-2072.232] (-2077.639) (-2082.226) (-2082.912) -- 0:00:00
1500 -- [-2069.693] (-2080.198) (-2071.192) (-2075.741) * (-2071.530) [-2076.523] (-2079.750) (-2079.111) -- 0:00:00
1600 -- (-2078.415) [-2079.760] (-2074.466) (-2077.711) * (-2072.941) (-2071.572) [-2076.151] (-2078.012) -- 0:00:00
1700 -- (-2079.491) (-2073.625) [-2071.293] (-2082.707) * (-2077.715) [-2070.786] (-2076.716) (-2072.166) -- 0:09:47
1800 -- (-2078.402) (-2074.351) [-2072.408] (-2075.492) * (-2069.424) (-2074.827) (-2084.660) [-2069.756] -- 0:09:14
1900 -- (-2082.863) (-2081.863) (-2073.189) [-2073.043] * (-2078.255) [-2080.178] (-2086.099) (-2081.935) -- 0:08:45
2000 -- [-2074.433] (-2085.817) (-2077.415) (-2077.139) * (-2082.372) (-2078.732) [-2077.540] (-2074.241) -- 0:08:19
Average standard deviation of split frequencies: 0.078567
2100 -- (-2079.095) (-2085.649) [-2070.149] (-2073.990) * (-2079.159) (-2076.048) (-2074.565) [-2078.746] -- 0:07:55
2200 -- (-2080.934) (-2084.011) [-2071.071] (-2083.956) * (-2085.382) (-2075.078) (-2074.820) [-2076.554] -- 0:07:33
2300 -- (-2078.031) (-2076.792) [-2074.559] (-2080.747) * [-2073.651] (-2073.866) (-2075.113) (-2079.146) -- 0:07:13
2400 -- (-2073.578) (-2088.631) [-2068.238] (-2072.258) * (-2086.787) (-2082.977) (-2082.412) [-2073.347] -- 0:06:55
2500 -- [-2080.466] (-2089.315) (-2071.134) (-2071.822) * [-2074.635] (-2077.289) (-2083.938) (-2078.193) -- 0:06:39
2600 -- (-2079.747) (-2078.007) (-2069.709) [-2074.223] * (-2079.588) (-2080.153) (-2073.743) [-2072.998] -- 0:06:23
2700 -- (-2074.753) (-2068.867) [-2068.854] (-2075.450) * (-2079.053) (-2076.068) (-2077.351) [-2070.582] -- 0:06:09
2800 -- (-2080.503) (-2078.467) [-2074.556] (-2070.003) * [-2074.371] (-2085.606) (-2076.460) (-2076.259) -- 0:05:56
2900 -- (-2074.172) (-2075.461) [-2071.186] (-2077.594) * [-2072.003] (-2074.111) (-2081.325) (-2076.797) -- 0:05:43
3000 -- (-2074.175) (-2078.017) [-2067.483] (-2071.669) * [-2078.436] (-2078.197) (-2084.769) (-2089.402) -- 0:05:32
Average standard deviation of split frequencies: 0.098209
3100 -- [-2069.020] (-2074.716) (-2076.550) (-2074.327) * [-2080.979] (-2079.749) (-2078.487) (-2086.898) -- 0:05:21
3200 -- (-2070.754) (-2077.533) (-2077.950) [-2071.088] * (-2078.175) [-2079.858] (-2083.127) (-2079.651) -- 0:05:11
3300 -- (-2076.719) [-2071.628] (-2079.616) (-2072.416) * (-2085.047) (-2081.005) (-2075.044) [-2072.943] -- 0:05:02
3400 -- [-2073.529] (-2070.272) (-2079.511) (-2081.737) * (-2080.519) (-2074.165) (-2079.176) [-2071.212] -- 0:04:53
3500 -- (-2073.041) [-2071.294] (-2075.004) (-2074.702) * [-2072.145] (-2076.834) (-2077.676) (-2078.069) -- 0:04:44
3600 -- [-2073.153] (-2072.218) (-2079.500) (-2091.787) * (-2076.301) [-2072.157] (-2081.842) (-2079.073) -- 0:04:36
3700 -- (-2076.833) (-2077.801) [-2069.199] (-2079.571) * (-2074.713) (-2075.870) (-2078.566) [-2073.578] -- 0:04:29
3800 -- (-2076.208) (-2080.271) [-2073.472] (-2076.247) * (-2079.714) (-2075.490) (-2074.153) [-2070.702] -- 0:04:22
3900 -- (-2075.891) [-2072.814] (-2082.058) (-2084.884) * (-2085.799) (-2078.984) [-2072.060] (-2076.227) -- 0:04:15
4000 -- [-2078.923] (-2072.283) (-2077.448) (-2082.752) * (-2080.287) (-2077.768) [-2074.413] (-2076.659) -- 0:04:09
Average standard deviation of split frequencies: 0.093774
4100 -- (-2068.796) (-2071.014) (-2084.728) [-2075.497] * (-2080.964) (-2075.402) (-2077.959) [-2074.312] -- 0:04:02
4200 -- (-2074.440) [-2079.280] (-2083.251) (-2075.848) * [-2071.297] (-2076.972) (-2075.767) (-2087.509) -- 0:03:57
4300 -- [-2081.196] (-2075.803) (-2079.283) (-2079.661) * [-2070.696] (-2079.634) (-2081.213) (-2080.563) -- 0:03:51
4400 -- [-2077.958] (-2079.400) (-2079.160) (-2078.009) * (-2079.962) [-2079.202] (-2079.088) (-2074.210) -- 0:03:46
4500 -- (-2073.262) [-2071.544] (-2088.069) (-2078.145) * (-2081.624) (-2080.434) [-2071.780] (-2082.772) -- 0:03:41
4600 -- (-2076.930) (-2072.466) [-2080.704] (-2084.522) * (-2087.366) [-2074.824] (-2077.383) (-2073.526) -- 0:03:36
4700 -- (-2070.349) [-2070.840] (-2081.423) (-2074.590) * (-2079.720) [-2076.353] (-2078.251) (-2069.724) -- 0:03:31
4800 -- (-2070.301) [-2074.765] (-2085.717) (-2081.101) * (-2082.937) (-2077.304) (-2080.075) [-2067.194] -- 0:03:27
4900 -- [-2073.989] (-2081.263) (-2085.014) (-2075.405) * (-2080.025) (-2082.113) (-2075.721) [-2071.030] -- 0:03:23
5000 -- [-2070.779] (-2077.252) (-2084.781) (-2078.127) * (-2084.442) [-2073.076] (-2074.952) (-2076.991) -- 0:03:19
Average standard deviation of split frequencies: 0.090655
5100 -- [-2071.310] (-2078.398) (-2079.097) (-2075.995) * (-2088.770) [-2073.329] (-2078.183) (-2071.251) -- 0:03:15
5200 -- (-2077.071) [-2075.785] (-2079.876) (-2086.271) * [-2072.756] (-2073.080) (-2084.746) (-2070.116) -- 0:03:11
5300 -- (-2083.640) [-2073.536] (-2075.770) (-2080.912) * (-2072.311) (-2075.075) (-2085.402) [-2072.085] -- 0:06:15
5400 -- (-2079.270) (-2081.517) [-2073.408] (-2077.087) * (-2078.829) [-2071.840] (-2078.708) (-2071.462) -- 0:06:08
5500 -- (-2080.219) (-2091.473) [-2070.649] (-2077.091) * [-2072.392] (-2070.600) (-2071.368) (-2078.658) -- 0:06:01
5600 -- (-2081.474) (-2090.660) (-2090.651) [-2076.497] * (-2066.871) (-2077.300) [-2072.559] (-2076.564) -- 0:05:55
5700 -- (-2083.906) (-2083.000) (-2087.785) [-2068.830] * (-2071.462) (-2076.206) [-2076.309] (-2078.172) -- 0:05:48
5800 -- (-2085.434) (-2082.164) (-2082.615) [-2073.447] * [-2068.751] (-2074.680) (-2076.224) (-2074.290) -- 0:05:42
5900 -- (-2075.474) (-2081.472) [-2075.819] (-2068.312) * [-2069.320] (-2079.999) (-2075.396) (-2077.651) -- 0:05:36
6000 -- (-2071.021) (-2084.833) (-2071.478) [-2073.861] * (-2070.840) (-2076.976) (-2071.425) [-2072.791] -- 0:05:31
Average standard deviation of split frequencies: 0.059780
6100 -- (-2072.774) (-2074.283) [-2071.245] (-2071.713) * (-2074.802) (-2079.336) (-2069.756) [-2070.875] -- 0:05:25
6200 -- (-2068.845) (-2082.766) [-2077.682] (-2079.132) * (-2075.826) [-2069.676] (-2069.705) (-2071.395) -- 0:05:20
6300 -- (-2077.123) (-2095.085) (-2072.678) [-2074.586] * (-2086.208) [-2070.196] (-2070.334) (-2079.469) -- 0:05:15
6400 -- (-2074.284) (-2090.690) (-2072.117) [-2078.740] * (-2083.742) [-2072.353] (-2076.439) (-2069.612) -- 0:05:10
6500 -- (-2080.504) [-2078.151] (-2083.964) (-2078.092) * (-2072.192) (-2084.270) [-2069.645] (-2068.315) -- 0:05:05
6600 -- (-2083.394) (-2080.593) (-2080.993) [-2072.755] * (-2072.018) [-2071.924] (-2074.843) (-2075.205) -- 0:05:01
6700 -- [-2078.501] (-2082.631) (-2090.039) (-2068.407) * [-2076.837] (-2074.230) (-2073.216) (-2072.019) -- 0:04:56
6800 -- [-2079.559] (-2089.062) (-2085.578) (-2068.978) * [-2074.258] (-2081.771) (-2085.145) (-2072.336) -- 0:04:52
6900 -- (-2080.642) (-2086.377) (-2086.423) [-2071.777] * [-2072.287] (-2081.624) (-2087.511) (-2070.500) -- 0:04:47
7000 -- (-2079.968) (-2085.675) (-2079.362) [-2069.711] * (-2081.275) (-2080.166) (-2078.840) [-2068.115] -- 0:04:43
Average standard deviation of split frequencies: 0.039284
7100 -- (-2081.310) (-2085.561) (-2078.860) [-2072.211] * (-2102.053) (-2083.669) (-2081.219) [-2067.333] -- 0:04:39
7200 -- (-2074.662) (-2081.119) (-2079.695) [-2074.352] * (-2084.576) (-2077.377) (-2089.196) [-2077.866] -- 0:04:35
7300 -- [-2072.428] (-2083.712) (-2077.612) (-2068.497) * (-2079.337) [-2069.933] (-2075.227) (-2074.641) -- 0:04:31
7400 -- (-2069.183) (-2082.940) (-2081.209) [-2071.290] * (-2080.249) [-2074.196] (-2082.639) (-2072.619) -- 0:04:28
7500 -- [-2069.354] (-2079.241) (-2083.838) (-2071.260) * (-2080.736) [-2072.222] (-2083.952) (-2078.350) -- 0:04:24
7600 -- (-2075.544) (-2079.138) (-2080.416) [-2074.646] * [-2071.349] (-2077.986) (-2078.373) (-2074.459) -- 0:04:21
7700 -- (-2071.966) (-2094.864) (-2083.068) [-2073.425] * (-2070.817) [-2075.369] (-2085.432) (-2080.628) -- 0:04:17
7800 -- (-2070.480) (-2085.084) (-2080.894) [-2078.576] * [-2073.112] (-2081.295) (-2082.035) (-2084.548) -- 0:04:14
7900 -- (-2080.690) (-2080.224) [-2079.309] (-2072.538) * [-2069.282] (-2083.302) (-2076.795) (-2080.580) -- 0:04:11
8000 -- [-2073.126] (-2087.158) (-2074.665) (-2071.281) * [-2071.613] (-2085.897) (-2077.533) (-2077.050) -- 0:04:08
Average standard deviation of split frequencies: 0.030429
8100 -- (-2074.745) (-2087.149) (-2077.808) [-2069.630] * (-2070.877) (-2083.642) (-2080.080) [-2075.032] -- 0:04:04
8200 -- [-2071.824] (-2078.866) (-2069.860) (-2071.414) * [-2069.900] (-2080.315) (-2068.861) (-2073.904) -- 0:04:01
8300 -- (-2074.811) (-2081.852) [-2071.156] (-2083.733) * [-2068.537] (-2082.918) (-2073.637) (-2075.065) -- 0:03:58
8400 -- (-2075.562) [-2075.603] (-2073.767) (-2074.779) * [-2071.305] (-2082.426) (-2075.966) (-2072.542) -- 0:03:56
8500 -- (-2075.523) [-2074.934] (-2072.864) (-2073.032) * (-2077.396) (-2079.258) (-2075.210) [-2071.881] -- 0:03:53
8600 -- (-2074.287) (-2080.289) [-2069.388] (-2073.180) * (-2073.442) (-2080.383) [-2067.228] (-2074.563) -- 0:05:45
8700 -- (-2076.373) (-2088.952) (-2068.768) [-2070.559] * (-2077.154) (-2081.080) [-2067.520] (-2068.832) -- 0:05:41
8800 -- (-2082.463) (-2084.180) [-2068.578] (-2072.808) * (-2071.884) (-2084.613) [-2075.170] (-2083.592) -- 0:05:37
8900 -- (-2087.130) (-2076.807) [-2070.942] (-2082.486) * (-2071.384) (-2079.920) (-2081.962) [-2078.276] -- 0:05:34
9000 -- (-2073.073) (-2078.840) [-2072.207] (-2085.306) * [-2072.409] (-2075.086) (-2079.787) (-2078.995) -- 0:05:30
Average standard deviation of split frequencies: 0.021777
9100 -- [-2070.591] (-2079.906) (-2081.981) (-2099.273) * [-2068.263] (-2076.507) (-2079.259) (-2077.024) -- 0:05:26
9200 -- [-2071.453] (-2077.316) (-2077.512) (-2076.858) * (-2068.836) [-2074.720] (-2074.637) (-2078.161) -- 0:05:23
9300 -- [-2071.892] (-2082.835) (-2069.513) (-2073.990) * [-2069.284] (-2083.830) (-2080.205) (-2072.795) -- 0:05:19
9400 -- (-2072.355) (-2086.188) [-2068.853] (-2069.308) * (-2076.593) (-2083.908) (-2080.093) [-2070.801] -- 0:05:16
9500 -- (-2076.734) (-2081.136) [-2075.592] (-2080.840) * (-2072.463) [-2076.658] (-2082.118) (-2074.114) -- 0:05:12
9600 -- [-2068.627] (-2075.902) (-2072.050) (-2076.726) * [-2071.706] (-2078.807) (-2089.527) (-2075.629) -- 0:05:09
9700 -- [-2068.597] (-2079.926) (-2074.015) (-2081.969) * (-2076.017) [-2075.447] (-2090.046) (-2073.939) -- 0:05:06
9800 -- [-2073.992] (-2074.542) (-2074.467) (-2073.816) * (-2076.983) (-2081.148) (-2088.989) [-2067.958] -- 0:05:03
9900 -- (-2077.677) (-2077.197) [-2072.718] (-2074.969) * (-2080.651) (-2078.168) (-2079.160) [-2069.201] -- 0:05:00
10000 -- (-2074.979) (-2082.406) (-2083.748) [-2073.621] * (-2079.161) (-2081.956) [-2074.312] (-2081.576) -- 0:04:57
Average standard deviation of split frequencies: 0.018608
10100 -- (-2072.916) (-2086.510) (-2088.698) [-2082.077] * [-2075.359] (-2076.454) (-2073.656) (-2076.434) -- 0:04:54
10200 -- (-2074.229) (-2084.757) [-2075.589] (-2081.046) * (-2076.470) (-2081.150) [-2074.527] (-2074.008) -- 0:04:51
10300 -- [-2070.184] (-2083.239) (-2080.980) (-2077.408) * (-2076.745) (-2075.400) (-2084.761) [-2072.701] -- 0:04:48
10400 -- [-2068.613] (-2089.321) (-2078.505) (-2073.490) * [-2073.783] (-2070.251) (-2075.814) (-2085.598) -- 0:04:45
10500 -- [-2072.290] (-2083.108) (-2076.306) (-2086.830) * (-2072.279) [-2068.600] (-2073.981) (-2073.285) -- 0:04:42
10600 -- (-2079.068) [-2082.299] (-2076.653) (-2083.157) * (-2076.970) [-2068.305] (-2066.626) (-2076.020) -- 0:04:40
10700 -- (-2072.541) [-2072.785] (-2072.767) (-2088.110) * (-2088.122) (-2068.406) [-2073.560] (-2079.165) -- 0:04:37
10800 -- (-2075.755) [-2073.312] (-2078.492) (-2073.428) * (-2074.943) (-2072.205) [-2070.707] (-2073.419) -- 0:04:34
10900 -- (-2073.480) (-2068.341) [-2075.396] (-2078.557) * (-2073.724) (-2072.018) [-2068.150] (-2074.013) -- 0:04:32
11000 -- (-2076.946) [-2071.088] (-2078.340) (-2080.816) * (-2077.509) (-2079.663) [-2072.826] (-2080.713) -- 0:04:29
Average standard deviation of split frequencies: 0.034874
11100 -- (-2086.295) [-2066.151] (-2077.872) (-2083.886) * (-2076.872) (-2075.273) [-2070.487] (-2080.381) -- 0:04:27
11200 -- (-2079.249) [-2068.511] (-2090.950) (-2089.083) * [-2069.491] (-2078.110) (-2073.791) (-2081.378) -- 0:04:24
11300 -- (-2081.369) [-2071.563] (-2086.263) (-2080.177) * (-2068.147) [-2077.171] (-2088.834) (-2082.004) -- 0:04:22
11400 -- (-2073.285) [-2076.053] (-2080.296) (-2078.057) * [-2073.247] (-2082.828) (-2088.757) (-2080.376) -- 0:04:20
11500 -- (-2074.291) [-2076.038] (-2077.074) (-2078.843) * [-2072.182] (-2079.682) (-2078.242) (-2082.069) -- 0:04:17
11600 -- (-2073.515) [-2075.293] (-2076.992) (-2085.792) * [-2073.408] (-2080.296) (-2077.501) (-2078.729) -- 0:04:15
11700 -- [-2073.096] (-2074.572) (-2081.852) (-2074.771) * [-2072.174] (-2084.150) (-2073.032) (-2073.748) -- 0:04:13
11800 -- [-2070.321] (-2073.270) (-2080.995) (-2075.209) * (-2073.550) [-2079.053] (-2076.021) (-2073.796) -- 0:04:11
11900 -- (-2072.154) (-2071.767) (-2082.409) [-2070.004] * [-2070.358] (-2074.254) (-2073.374) (-2080.126) -- 0:04:09
12000 -- (-2074.409) (-2069.812) (-2082.009) [-2071.408] * [-2070.713] (-2080.749) (-2079.289) (-2083.350) -- 0:04:07
Average standard deviation of split frequencies: 0.028862
12100 -- (-2070.934) (-2074.573) (-2075.478) [-2075.986] * [-2075.761] (-2079.734) (-2073.520) (-2080.010) -- 0:04:04
12200 -- (-2072.258) [-2071.691] (-2074.946) (-2075.158) * (-2074.160) [-2072.045] (-2082.747) (-2084.654) -- 0:04:02
12300 -- (-2084.238) (-2067.405) [-2075.139] (-2075.152) * (-2073.517) (-2072.854) (-2069.793) [-2074.889] -- 0:05:21
12400 -- (-2080.124) [-2071.691] (-2074.524) (-2072.336) * (-2074.472) (-2075.804) (-2069.555) [-2081.531] -- 0:05:18
12500 -- (-2073.888) (-2072.846) [-2072.611] (-2075.049) * [-2071.812] (-2077.403) (-2070.886) (-2077.353) -- 0:05:16
12600 -- (-2090.114) (-2073.895) [-2072.439] (-2072.802) * [-2078.025] (-2080.116) (-2079.432) (-2083.051) -- 0:05:13
12700 -- (-2081.096) (-2070.450) (-2068.167) [-2070.724] * [-2077.170] (-2077.643) (-2079.877) (-2081.667) -- 0:05:10
12800 -- (-2075.243) (-2071.889) [-2071.201] (-2070.466) * (-2076.477) [-2074.059] (-2071.191) (-2084.506) -- 0:05:08
12900 -- (-2086.618) [-2075.829] (-2072.345) (-2071.849) * (-2076.353) (-2077.402) [-2076.634] (-2081.679) -- 0:05:06
13000 -- (-2077.927) (-2073.684) (-2079.534) [-2073.711] * (-2076.273) (-2087.420) [-2074.583] (-2083.345) -- 0:05:03
Average standard deviation of split frequencies: 0.032141
13100 -- (-2092.000) [-2075.932] (-2077.072) (-2075.173) * (-2071.617) (-2085.420) [-2073.635] (-2086.449) -- 0:05:01
13200 -- (-2087.452) (-2075.854) (-2078.299) [-2070.086] * (-2074.245) (-2081.304) [-2075.047] (-2090.270) -- 0:04:59
13300 -- (-2078.638) (-2075.875) [-2077.781] (-2071.493) * [-2072.453] (-2078.284) (-2073.231) (-2085.395) -- 0:04:56
13400 -- [-2076.326] (-2078.630) (-2073.958) (-2076.152) * [-2068.332] (-2072.450) (-2084.834) (-2091.934) -- 0:04:54
13500 -- (-2079.183) [-2075.739] (-2072.299) (-2076.930) * [-2073.156] (-2072.104) (-2078.216) (-2087.648) -- 0:04:52
13600 -- (-2075.069) (-2077.045) [-2075.703] (-2083.502) * [-2074.935] (-2071.102) (-2079.991) (-2089.352) -- 0:04:50
13700 -- (-2074.977) [-2075.027] (-2083.100) (-2088.163) * (-2078.647) (-2075.021) [-2076.212] (-2099.819) -- 0:04:47
13800 -- (-2074.900) [-2072.207] (-2079.577) (-2083.755) * (-2077.864) (-2073.048) [-2067.575] (-2083.853) -- 0:04:45
13900 -- (-2079.347) [-2074.919] (-2077.283) (-2086.478) * (-2078.024) [-2072.803] (-2073.632) (-2083.968) -- 0:04:43
14000 -- (-2080.963) [-2074.914] (-2085.328) (-2079.899) * (-2075.223) [-2073.279] (-2072.088) (-2074.431) -- 0:04:41
Average standard deviation of split frequencies: 0.031686
14100 -- (-2079.050) [-2071.919] (-2080.967) (-2075.246) * (-2081.952) (-2074.598) (-2087.429) [-2077.492] -- 0:04:39
14200 -- (-2077.286) [-2073.962] (-2085.696) (-2082.635) * (-2079.953) (-2083.500) (-2082.096) [-2079.948] -- 0:04:37
14300 -- (-2078.761) [-2071.387] (-2089.170) (-2072.282) * (-2076.820) (-2070.473) [-2075.388] (-2074.713) -- 0:04:35
14400 -- (-2078.263) (-2071.692) (-2086.461) [-2073.547] * (-2078.813) [-2069.903] (-2084.504) (-2073.791) -- 0:04:33
14500 -- [-2074.220] (-2086.426) (-2078.456) (-2074.371) * [-2077.218] (-2075.250) (-2073.707) (-2080.984) -- 0:04:31
14600 -- (-2092.057) [-2072.089] (-2074.705) (-2069.398) * (-2085.195) (-2081.997) [-2074.383] (-2085.063) -- 0:04:29
14700 -- (-2074.951) (-2073.343) (-2080.250) [-2069.215] * (-2079.583) (-2076.360) [-2071.226] (-2094.664) -- 0:04:28
14800 -- (-2076.583) [-2073.468] (-2081.689) (-2076.622) * (-2072.775) [-2078.002] (-2078.370) (-2080.428) -- 0:04:26
14900 -- (-2074.085) [-2068.319] (-2078.050) (-2071.342) * (-2075.180) (-2076.408) [-2079.043] (-2085.495) -- 0:04:24
15000 -- (-2077.294) [-2070.510] (-2080.651) (-2076.600) * (-2080.095) [-2072.784] (-2074.441) (-2091.290) -- 0:04:22
Average standard deviation of split frequencies: 0.031789
15100 -- [-2076.877] (-2080.663) (-2075.209) (-2075.642) * (-2079.158) (-2074.094) [-2068.670] (-2079.157) -- 0:04:20
15200 -- (-2078.593) (-2083.750) (-2076.695) [-2072.355] * (-2081.449) (-2076.247) [-2071.463] (-2079.727) -- 0:04:19
15300 -- (-2076.588) [-2072.786] (-2082.881) (-2080.009) * (-2085.418) (-2074.784) [-2070.409] (-2070.891) -- 0:04:17
15400 -- (-2087.747) [-2071.620] (-2073.202) (-2082.590) * (-2081.657) [-2085.469] (-2072.950) (-2075.913) -- 0:04:15
15500 -- (-2077.847) (-2079.549) [-2070.947] (-2088.108) * (-2075.429) (-2075.584) [-2067.449] (-2088.498) -- 0:04:14
15600 -- (-2078.829) (-2081.916) [-2071.376] (-2078.074) * (-2076.117) [-2074.872] (-2067.010) (-2079.525) -- 0:04:12
15700 -- (-2077.079) (-2075.679) [-2074.150] (-2080.349) * (-2076.191) (-2076.512) [-2076.059] (-2079.087) -- 0:04:10
15800 -- (-2084.131) [-2075.239] (-2078.716) (-2084.001) * (-2078.998) (-2082.802) (-2081.327) [-2074.635] -- 0:05:11
15900 -- (-2084.421) (-2079.697) [-2072.152] (-2079.799) * (-2081.369) (-2082.466) (-2074.776) [-2077.779] -- 0:05:09
16000 -- (-2083.846) (-2070.190) (-2078.768) [-2077.147] * [-2082.256] (-2085.655) (-2077.665) (-2077.277) -- 0:05:07
Average standard deviation of split frequencies: 0.026297
16100 -- (-2082.269) [-2074.076] (-2080.629) (-2083.631) * (-2078.578) (-2091.308) [-2074.894] (-2077.117) -- 0:05:05
16200 -- (-2077.754) (-2072.715) (-2083.807) [-2071.252] * (-2077.274) (-2085.561) [-2073.798] (-2088.232) -- 0:05:03
16300 -- (-2081.318) (-2073.356) [-2070.654] (-2083.203) * (-2075.731) [-2070.504] (-2072.136) (-2075.334) -- 0:05:01
16400 -- (-2071.464) (-2070.733) [-2070.242] (-2082.099) * [-2074.677] (-2073.909) (-2076.819) (-2070.328) -- 0:04:59
16500 -- [-2074.916] (-2070.678) (-2073.210) (-2085.302) * [-2074.254] (-2076.045) (-2075.875) (-2071.985) -- 0:04:58
16600 -- (-2073.586) (-2073.167) [-2078.203] (-2078.524) * (-2075.848) (-2074.701) (-2078.673) [-2072.330] -- 0:04:56
16700 -- (-2078.518) [-2072.485] (-2069.919) (-2085.251) * [-2073.565] (-2091.699) (-2082.464) (-2073.118) -- 0:04:54
16800 -- (-2089.944) (-2068.949) [-2075.989] (-2077.008) * [-2070.088] (-2090.603) (-2080.609) (-2082.280) -- 0:04:52
16900 -- (-2082.408) (-2071.292) [-2073.290] (-2082.641) * (-2074.326) [-2078.256] (-2083.656) (-2073.865) -- 0:04:50
17000 -- (-2084.707) (-2070.733) (-2080.177) [-2073.876] * (-2077.348) (-2080.975) (-2075.910) [-2071.982] -- 0:04:49
Average standard deviation of split frequencies: 0.024667
17100 -- (-2084.380) [-2070.252] (-2081.468) (-2074.998) * (-2082.132) (-2081.096) (-2074.257) [-2075.050] -- 0:04:47
17200 -- (-2073.486) [-2073.033] (-2082.144) (-2077.220) * (-2071.587) (-2080.740) [-2072.267] (-2074.050) -- 0:04:45
17300 -- [-2080.006] (-2072.472) (-2087.908) (-2077.859) * (-2085.481) [-2070.893] (-2072.648) (-2071.138) -- 0:04:44
17400 -- (-2085.662) [-2074.362] (-2077.009) (-2075.968) * (-2090.040) (-2069.408) [-2075.873] (-2080.012) -- 0:04:42
17500 -- (-2084.485) (-2071.795) [-2071.085] (-2075.256) * (-2074.186) [-2072.059] (-2073.080) (-2078.059) -- 0:04:40
17600 -- (-2074.573) (-2075.067) (-2086.484) [-2071.129] * [-2071.012] (-2076.693) (-2075.206) (-2078.579) -- 0:04:39
17700 -- (-2069.022) (-2074.577) (-2080.166) [-2069.693] * (-2071.357) (-2078.659) [-2070.688] (-2077.731) -- 0:04:37
17800 -- [-2068.929] (-2077.011) (-2079.175) (-2075.081) * [-2070.997] (-2082.112) (-2076.467) (-2081.294) -- 0:04:35
17900 -- (-2089.354) (-2077.596) (-2072.903) [-2069.134] * (-2072.755) [-2076.834] (-2073.963) (-2080.508) -- 0:04:34
18000 -- (-2071.457) [-2071.122] (-2076.540) (-2078.470) * (-2076.852) [-2073.696] (-2077.752) (-2080.483) -- 0:04:32
Average standard deviation of split frequencies: 0.017826
18100 -- [-2074.249] (-2070.799) (-2078.733) (-2082.552) * (-2079.635) (-2075.855) [-2078.196] (-2076.621) -- 0:04:31
18200 -- (-2080.590) [-2070.842] (-2077.734) (-2077.527) * (-2077.116) (-2074.960) (-2078.494) [-2072.549] -- 0:04:29
18300 -- (-2082.613) (-2073.005) (-2072.448) [-2078.996] * (-2083.767) [-2076.960] (-2073.633) (-2075.432) -- 0:04:28
18400 -- (-2086.403) [-2072.681] (-2075.907) (-2077.678) * [-2071.822] (-2075.800) (-2069.331) (-2079.868) -- 0:04:26
18500 -- (-2077.093) (-2077.665) [-2077.273] (-2082.198) * (-2079.061) (-2079.027) (-2081.522) [-2068.367] -- 0:04:25
18600 -- (-2072.470) [-2074.748] (-2075.456) (-2077.341) * [-2073.111] (-2097.652) (-2079.485) (-2072.825) -- 0:04:23
18700 -- (-2074.448) (-2077.033) [-2073.820] (-2080.418) * [-2070.223] (-2079.256) (-2076.734) (-2076.023) -- 0:04:22
18800 -- [-2068.970] (-2097.139) (-2073.257) (-2068.833) * (-2070.882) (-2083.526) (-2079.558) [-2071.969] -- 0:04:20
18900 -- (-2072.012) (-2080.314) (-2081.793) [-2070.710] * [-2068.564] (-2078.033) (-2081.353) (-2075.101) -- 0:04:19
19000 -- (-2073.162) (-2083.955) (-2082.598) [-2070.070] * [-2071.200] (-2075.974) (-2081.689) (-2081.309) -- 0:04:18
Average standard deviation of split frequencies: 0.020343
19100 -- (-2075.737) [-2077.257] (-2086.785) (-2076.082) * (-2071.252) (-2077.618) (-2081.163) [-2075.735] -- 0:04:16
19200 -- (-2078.818) (-2077.449) [-2073.981] (-2072.840) * [-2069.694] (-2080.290) (-2084.178) (-2082.191) -- 0:04:15
19300 -- (-2083.651) (-2070.971) [-2071.957] (-2077.676) * [-2076.572] (-2076.169) (-2080.744) (-2078.024) -- 0:04:14
19400 -- (-2082.252) [-2068.422] (-2075.102) (-2083.883) * (-2079.713) (-2074.526) (-2079.325) [-2079.321] -- 0:04:12
19500 -- (-2076.730) [-2075.271] (-2076.267) (-2074.873) * (-2078.731) (-2077.994) (-2078.962) [-2074.122] -- 0:05:01
19600 -- (-2073.906) [-2077.784] (-2078.700) (-2076.167) * (-2073.540) (-2075.137) (-2091.879) [-2072.350] -- 0:05:00
19700 -- (-2076.129) [-2072.868] (-2078.638) (-2073.285) * (-2079.219) [-2077.337] (-2087.045) (-2077.740) -- 0:04:58
19800 -- (-2080.910) [-2066.102] (-2077.163) (-2081.374) * [-2074.277] (-2076.515) (-2083.828) (-2082.236) -- 0:04:57
19900 -- (-2083.173) [-2071.706] (-2076.915) (-2077.943) * (-2072.411) (-2080.330) [-2080.736] (-2081.810) -- 0:04:55
20000 -- [-2079.755] (-2080.243) (-2090.016) (-2089.376) * [-2068.880] (-2075.648) (-2088.601) (-2077.729) -- 0:04:54
Average standard deviation of split frequencies: 0.015386
20100 -- (-2075.575) [-2077.920] (-2080.233) (-2085.088) * [-2070.047] (-2081.017) (-2083.777) (-2073.792) -- 0:04:52
20200 -- (-2082.267) [-2073.588] (-2080.759) (-2079.759) * [-2074.698] (-2085.119) (-2085.191) (-2075.951) -- 0:04:51
20300 -- (-2083.564) (-2075.302) (-2075.903) [-2071.937] * (-2071.227) (-2081.911) (-2079.587) [-2071.311] -- 0:04:49
20400 -- (-2085.652) (-2081.256) [-2073.754] (-2081.209) * [-2070.495] (-2083.991) (-2076.202) (-2073.538) -- 0:04:48
20500 -- (-2088.847) [-2072.483] (-2073.843) (-2077.494) * [-2067.057] (-2080.021) (-2076.498) (-2078.657) -- 0:04:46
20600 -- (-2077.695) (-2082.752) (-2073.575) [-2071.883] * [-2072.638] (-2084.123) (-2075.481) (-2079.070) -- 0:04:45
20700 -- (-2083.275) (-2083.084) (-2069.707) [-2075.734] * (-2082.564) [-2080.824] (-2068.516) (-2074.734) -- 0:04:43
20800 -- (-2075.258) (-2083.268) (-2079.669) [-2070.417] * (-2074.678) (-2083.990) [-2076.843] (-2071.900) -- 0:04:42
20900 -- (-2078.277) (-2080.116) [-2071.875] (-2074.143) * (-2076.349) (-2085.108) [-2075.142] (-2077.239) -- 0:04:41
21000 -- (-2086.086) (-2076.322) [-2072.676] (-2078.526) * (-2096.745) [-2080.011] (-2074.179) (-2074.299) -- 0:04:39
Average standard deviation of split frequencies: 0.012706
21100 -- (-2079.272) (-2076.816) (-2080.793) [-2073.682] * (-2080.712) [-2072.909] (-2081.176) (-2077.043) -- 0:04:38
21200 -- (-2094.478) [-2077.596] (-2075.955) (-2077.524) * [-2070.457] (-2070.153) (-2089.555) (-2083.193) -- 0:04:37
21300 -- [-2087.161] (-2073.832) (-2072.668) (-2070.286) * (-2079.837) [-2071.142] (-2087.872) (-2075.327) -- 0:04:35
21400 -- (-2085.531) [-2073.289] (-2073.628) (-2073.558) * (-2076.967) (-2076.106) [-2073.952] (-2079.374) -- 0:04:34
21500 -- (-2087.730) [-2075.250] (-2075.078) (-2076.509) * [-2073.527] (-2084.653) (-2091.337) (-2080.600) -- 0:04:33
21600 -- (-2083.380) (-2087.830) [-2075.366] (-2076.718) * [-2073.097] (-2077.981) (-2086.518) (-2078.106) -- 0:04:31
21700 -- (-2085.222) (-2073.549) [-2071.113] (-2077.859) * [-2074.259] (-2078.285) (-2096.546) (-2078.644) -- 0:04:30
21800 -- (-2083.820) (-2075.360) [-2075.022] (-2077.502) * [-2071.144] (-2088.897) (-2094.294) (-2086.116) -- 0:04:29
21900 -- (-2083.607) (-2074.793) (-2087.053) [-2074.147] * (-2077.614) (-2082.939) (-2084.718) [-2078.737] -- 0:04:27
22000 -- (-2088.255) (-2083.603) (-2080.366) [-2077.815] * (-2078.589) (-2076.468) [-2074.134] (-2070.841) -- 0:04:26
Average standard deviation of split frequencies: 0.018636
22100 -- [-2081.802] (-2075.629) (-2077.959) (-2074.394) * (-2072.218) (-2078.845) (-2075.237) [-2072.606] -- 0:04:25
22200 -- (-2079.212) (-2076.298) (-2080.769) [-2072.138] * (-2072.129) [-2079.520] (-2076.743) (-2075.661) -- 0:04:24
22300 -- (-2080.208) (-2078.943) (-2073.623) [-2077.432] * (-2072.886) (-2078.686) (-2082.157) [-2069.108] -- 0:04:23
22400 -- (-2081.922) (-2085.141) [-2072.901] (-2072.876) * [-2069.177] (-2077.771) (-2075.277) (-2070.294) -- 0:04:21
22500 -- (-2082.453) (-2085.144) [-2078.982] (-2073.816) * (-2069.185) (-2074.911) (-2083.399) [-2072.497] -- 0:04:20
22600 -- (-2074.787) (-2088.740) [-2077.953] (-2075.891) * [-2066.639] (-2083.239) (-2076.367) (-2072.864) -- 0:04:19
22700 -- (-2081.456) (-2084.556) (-2077.502) [-2075.724] * (-2067.814) (-2073.421) (-2080.441) [-2072.525] -- 0:04:18
22800 -- (-2078.155) (-2082.212) [-2071.901] (-2080.717) * (-2074.837) (-2076.043) (-2082.904) [-2073.703] -- 0:04:17
22900 -- [-2076.225] (-2078.288) (-2078.090) (-2080.637) * (-2074.219) (-2089.127) [-2076.037] (-2077.794) -- 0:04:16
23000 -- (-2076.524) (-2080.231) (-2073.180) [-2077.232] * (-2084.540) (-2087.479) [-2074.766] (-2079.490) -- 0:04:14
Average standard deviation of split frequencies: 0.021335
23100 -- [-2071.805] (-2084.982) (-2075.783) (-2077.782) * (-2079.635) (-2078.706) [-2075.988] (-2075.053) -- 0:04:56
23200 -- (-2084.010) (-2081.034) [-2073.974] (-2084.387) * [-2085.044] (-2077.840) (-2087.620) (-2073.410) -- 0:04:54
23300 -- (-2080.937) (-2075.064) (-2078.666) [-2080.410] * (-2083.641) [-2069.482] (-2083.850) (-2073.696) -- 0:04:53
23400 -- (-2080.958) (-2076.616) [-2078.559] (-2074.869) * (-2081.318) [-2075.157] (-2086.004) (-2085.309) -- 0:04:52
23500 -- (-2079.690) (-2078.060) [-2079.505] (-2077.009) * (-2076.239) [-2076.951] (-2079.916) (-2081.355) -- 0:04:50
23600 -- (-2081.365) [-2076.241] (-2088.230) (-2074.651) * (-2077.637) (-2073.199) [-2072.482] (-2085.107) -- 0:04:49
23700 -- [-2084.621] (-2073.526) (-2089.376) (-2084.372) * (-2080.795) [-2072.789] (-2083.888) (-2084.623) -- 0:04:48
23800 -- (-2078.754) [-2073.030] (-2081.723) (-2084.279) * [-2072.482] (-2076.475) (-2079.680) (-2083.175) -- 0:04:47
23900 -- (-2073.203) [-2072.583] (-2080.167) (-2085.418) * [-2073.393] (-2079.331) (-2078.300) (-2084.734) -- 0:04:45
24000 -- (-2077.668) [-2069.773] (-2077.135) (-2079.685) * (-2073.778) (-2073.918) [-2071.095] (-2090.016) -- 0:04:44
Average standard deviation of split frequencies: 0.027347
24100 -- (-2074.464) [-2070.304] (-2080.372) (-2084.555) * [-2072.284] (-2072.860) (-2077.000) (-2085.559) -- 0:04:43
24200 -- [-2072.693] (-2071.226) (-2086.321) (-2077.052) * (-2084.195) [-2068.248] (-2075.039) (-2081.729) -- 0:04:42
24300 -- [-2071.231] (-2071.076) (-2075.188) (-2077.583) * (-2081.736) (-2078.997) [-2072.461] (-2079.038) -- 0:04:41
24400 -- (-2083.242) [-2077.457] (-2082.747) (-2078.696) * [-2080.132] (-2082.068) (-2072.015) (-2079.654) -- 0:04:39
24500 -- (-2077.509) [-2069.300] (-2086.896) (-2075.258) * (-2077.068) [-2072.717] (-2073.780) (-2080.014) -- 0:04:38
24600 -- (-2087.501) (-2070.433) (-2093.488) [-2068.947] * (-2082.367) (-2072.767) [-2072.236] (-2088.953) -- 0:04:37
24700 -- (-2082.486) [-2069.876] (-2084.385) (-2072.831) * (-2077.673) (-2072.010) (-2073.383) [-2077.503] -- 0:04:36
24800 -- (-2082.389) [-2073.912] (-2082.361) (-2070.853) * (-2077.749) (-2069.380) [-2076.010] (-2078.689) -- 0:04:35
24900 -- (-2089.555) [-2072.607] (-2088.993) (-2071.698) * [-2078.819] (-2080.895) (-2084.251) (-2074.240) -- 0:04:34
25000 -- (-2086.783) [-2068.192] (-2088.964) (-2073.328) * (-2081.218) (-2075.127) [-2072.791] (-2072.939) -- 0:04:33
Average standard deviation of split frequencies: 0.029463
25100 -- (-2079.940) [-2070.841] (-2091.020) (-2085.606) * (-2083.722) (-2074.621) (-2072.806) [-2070.226] -- 0:04:31
25200 -- (-2073.562) [-2074.621] (-2084.365) (-2079.174) * [-2074.665] (-2079.654) (-2071.283) (-2073.156) -- 0:04:30
25300 -- (-2077.086) [-2072.134] (-2089.103) (-2077.517) * (-2075.158) (-2079.532) (-2076.641) [-2074.316] -- 0:04:29
25400 -- (-2080.357) (-2073.410) (-2093.449) [-2072.022] * (-2076.807) (-2075.114) [-2071.863] (-2077.384) -- 0:04:28
25500 -- (-2080.754) (-2071.464) (-2085.071) [-2073.794] * (-2088.307) (-2072.635) [-2076.498] (-2082.270) -- 0:04:27
25600 -- (-2079.448) [-2068.335] (-2078.503) (-2084.284) * (-2081.812) [-2071.133] (-2083.980) (-2080.756) -- 0:04:26
25700 -- (-2080.721) (-2072.648) [-2080.691] (-2076.778) * (-2080.113) [-2070.065] (-2088.116) (-2081.722) -- 0:04:25
25800 -- (-2089.556) [-2072.537] (-2079.053) (-2085.510) * (-2083.025) (-2084.061) [-2090.321] (-2083.847) -- 0:04:24
25900 -- (-2077.333) [-2069.713] (-2077.325) (-2089.579) * [-2082.378] (-2077.754) (-2085.622) (-2073.407) -- 0:04:23
26000 -- [-2073.882] (-2077.467) (-2078.720) (-2088.914) * [-2079.028] (-2072.749) (-2082.647) (-2078.949) -- 0:04:22
Average standard deviation of split frequencies: 0.032920
26100 -- (-2078.816) [-2076.754] (-2082.662) (-2077.062) * (-2079.901) [-2073.618] (-2081.028) (-2091.667) -- 0:04:21
26200 -- (-2076.382) (-2072.079) (-2086.060) [-2075.538] * (-2089.080) [-2082.155] (-2082.363) (-2091.004) -- 0:04:20
26300 -- (-2082.878) [-2072.122] (-2090.748) (-2077.896) * (-2092.749) [-2074.817] (-2087.558) (-2085.413) -- 0:04:19
26400 -- [-2080.487] (-2073.772) (-2089.997) (-2069.906) * (-2079.999) [-2074.182] (-2091.545) (-2077.339) -- 0:04:18
26500 -- (-2080.153) (-2075.108) (-2079.688) [-2071.763] * (-2071.754) [-2070.895] (-2082.049) (-2084.018) -- 0:04:17
26600 -- (-2094.290) (-2083.526) (-2079.513) [-2075.367] * (-2078.963) [-2074.009] (-2080.077) (-2079.875) -- 0:04:16
26700 -- (-2085.656) [-2089.531] (-2089.297) (-2071.511) * [-2073.252] (-2072.764) (-2078.718) (-2078.211) -- 0:04:51
26800 -- (-2082.325) [-2077.560] (-2085.224) (-2074.584) * (-2078.289) (-2077.636) (-2084.269) [-2073.960] -- 0:04:50
26900 -- [-2083.143] (-2076.319) (-2084.250) (-2084.014) * (-2085.935) (-2076.199) [-2077.098] (-2073.664) -- 0:04:49
27000 -- (-2082.130) [-2072.230] (-2082.803) (-2079.443) * (-2081.761) (-2078.716) (-2078.585) [-2080.962] -- 0:04:48
Average standard deviation of split frequencies: 0.038128
27100 -- (-2076.925) [-2070.951] (-2083.888) (-2083.034) * [-2075.290] (-2074.204) (-2078.475) (-2072.906) -- 0:04:47
27200 -- [-2073.313] (-2071.570) (-2087.105) (-2079.305) * (-2072.313) [-2070.451] (-2083.199) (-2071.506) -- 0:04:46
27300 -- (-2075.880) [-2070.673] (-2087.362) (-2079.211) * (-2078.530) (-2081.735) (-2089.221) [-2067.785] -- 0:04:45
27400 -- (-2076.072) [-2072.995] (-2078.379) (-2086.721) * (-2073.731) (-2078.683) (-2081.753) [-2073.027] -- 0:04:43
27500 -- (-2080.110) [-2071.461] (-2083.376) (-2087.885) * (-2078.395) [-2070.116] (-2093.909) (-2077.753) -- 0:04:42
27600 -- (-2091.254) (-2072.858) (-2094.744) [-2077.958] * (-2074.705) [-2075.308] (-2089.706) (-2074.700) -- 0:04:41
27700 -- (-2100.146) (-2072.036) [-2080.201] (-2091.039) * (-2076.870) (-2072.120) (-2088.087) [-2079.116] -- 0:04:40
27800 -- (-2092.515) (-2068.626) (-2082.401) [-2079.864] * (-2070.012) [-2080.567] (-2086.442) (-2076.396) -- 0:04:39
27900 -- (-2087.355) (-2072.792) [-2078.557] (-2082.119) * (-2071.694) (-2084.658) (-2088.583) [-2075.383] -- 0:04:38
28000 -- (-2082.323) [-2071.360] (-2087.634) (-2078.089) * (-2074.403) (-2077.343) [-2081.234] (-2069.544) -- 0:04:37
Average standard deviation of split frequencies: 0.038120
28100 -- (-2079.329) (-2080.943) (-2082.755) [-2080.380] * (-2075.577) (-2082.204) (-2084.158) [-2074.344] -- 0:04:36
28200 -- (-2082.978) [-2068.653] (-2092.882) (-2080.001) * [-2075.415] (-2083.898) (-2093.855) (-2073.468) -- 0:04:35
28300 -- (-2079.486) [-2075.061] (-2082.548) (-2085.560) * (-2074.970) (-2084.838) (-2089.329) [-2071.485] -- 0:04:34
28400 -- (-2079.444) (-2074.812) [-2085.800] (-2085.729) * [-2069.135] (-2079.515) (-2084.472) (-2071.951) -- 0:04:33
28500 -- [-2079.565] (-2080.604) (-2085.689) (-2082.053) * (-2082.132) [-2077.333] (-2080.298) (-2072.283) -- 0:04:32
28600 -- [-2076.169] (-2077.520) (-2090.045) (-2082.862) * (-2076.483) (-2086.842) (-2075.930) [-2072.759] -- 0:04:31
28700 -- (-2082.062) (-2075.295) (-2093.671) [-2070.730] * [-2071.654] (-2081.870) (-2082.714) (-2084.438) -- 0:04:30
28800 -- [-2080.341] (-2077.735) (-2102.611) (-2078.581) * (-2071.758) (-2074.229) [-2075.155] (-2084.690) -- 0:04:29
28900 -- (-2077.763) (-2080.423) (-2087.156) [-2076.057] * (-2071.633) [-2072.146] (-2070.825) (-2084.410) -- 0:04:28
29000 -- (-2077.338) [-2072.743] (-2091.152) (-2077.161) * (-2075.014) (-2075.571) (-2073.924) [-2078.894] -- 0:04:27
Average standard deviation of split frequencies: 0.038342
29100 -- (-2075.130) [-2070.640] (-2080.854) (-2082.566) * (-2079.923) (-2083.170) [-2073.563] (-2068.388) -- 0:04:26
29200 -- (-2082.161) [-2072.872] (-2073.238) (-2081.738) * (-2076.130) (-2089.079) [-2069.284] (-2081.548) -- 0:04:25
29300 -- (-2078.361) (-2070.288) [-2076.191] (-2089.428) * (-2071.311) (-2073.711) [-2066.736] (-2085.928) -- 0:04:25
29400 -- (-2082.082) [-2068.826] (-2074.034) (-2086.016) * (-2080.551) [-2075.896] (-2076.126) (-2080.589) -- 0:04:24
29500 -- (-2080.123) (-2067.970) (-2082.719) [-2073.413] * (-2087.781) (-2078.833) (-2070.563) [-2072.025] -- 0:04:23
29600 -- (-2077.845) [-2068.806] (-2092.458) (-2078.294) * (-2078.227) (-2088.100) [-2074.152] (-2075.215) -- 0:04:22
29700 -- (-2076.625) (-2073.465) (-2089.751) [-2072.664] * (-2081.907) (-2083.880) [-2069.749] (-2075.218) -- 0:04:21
29800 -- (-2080.927) (-2077.754) (-2079.973) [-2068.884] * (-2075.346) (-2080.222) [-2075.064] (-2076.414) -- 0:04:20
29900 -- (-2083.675) [-2073.635] (-2080.173) (-2071.424) * (-2076.135) (-2081.760) [-2072.410] (-2074.212) -- 0:04:19
30000 -- (-2088.926) [-2071.561] (-2078.627) (-2077.863) * (-2079.972) (-2081.616) (-2076.296) [-2077.916] -- 0:04:18
Average standard deviation of split frequencies: 0.040283
30100 -- (-2088.865) (-2074.455) [-2079.092] (-2078.168) * (-2074.986) [-2080.264] (-2082.248) (-2082.094) -- 0:04:17
30200 -- (-2082.746) (-2078.831) (-2084.203) [-2076.351] * [-2077.164] (-2077.118) (-2076.147) (-2088.656) -- 0:04:16
30300 -- [-2077.075] (-2078.948) (-2082.390) (-2078.696) * (-2078.641) (-2095.987) [-2073.654] (-2076.138) -- 0:04:48
30400 -- (-2078.034) (-2073.079) (-2079.123) [-2079.835] * (-2076.358) [-2083.846] (-2071.327) (-2091.241) -- 0:04:47
30500 -- (-2081.089) (-2075.770) (-2080.111) [-2077.698] * (-2087.069) (-2092.990) [-2069.200] (-2071.113) -- 0:04:46
30600 -- (-2077.624) (-2075.343) [-2083.098] (-2081.544) * (-2075.355) (-2084.960) (-2083.931) [-2073.663] -- 0:04:45
30700 -- (-2077.704) (-2071.474) [-2080.231] (-2079.028) * (-2076.132) (-2082.063) [-2075.822] (-2080.758) -- 0:04:44
30800 -- (-2077.135) (-2072.297) (-2076.064) [-2071.147] * [-2071.323] (-2079.360) (-2080.996) (-2081.876) -- 0:04:43
30900 -- (-2075.814) [-2072.058] (-2073.295) (-2073.068) * [-2075.585] (-2075.640) (-2086.509) (-2078.495) -- 0:04:42
31000 -- (-2078.380) [-2068.082] (-2079.109) (-2078.330) * [-2072.378] (-2082.100) (-2085.527) (-2078.277) -- 0:04:41
Average standard deviation of split frequencies: 0.040417
31100 -- (-2080.067) (-2070.677) (-2080.896) [-2074.871] * [-2070.902] (-2076.634) (-2075.574) (-2080.180) -- 0:04:40
31200 -- (-2091.026) (-2074.202) (-2081.204) [-2071.375] * (-2080.057) (-2073.450) [-2073.777] (-2078.178) -- 0:04:39
31300 -- (-2077.917) [-2068.642] (-2077.944) (-2074.623) * (-2080.959) [-2075.748] (-2079.584) (-2079.584) -- 0:04:38
31400 -- (-2080.660) (-2072.760) (-2080.106) [-2071.801] * (-2075.461) (-2080.447) (-2074.366) [-2079.159] -- 0:04:37
31500 -- [-2075.968] (-2075.133) (-2083.646) (-2071.696) * [-2080.527] (-2073.175) (-2072.226) (-2082.373) -- 0:04:36
31600 -- (-2080.569) (-2076.476) (-2081.879) [-2072.153] * [-2076.011] (-2076.263) (-2068.935) (-2083.928) -- 0:04:35
31700 -- (-2080.821) (-2078.557) [-2077.767] (-2073.063) * (-2077.740) (-2073.976) (-2070.984) [-2080.655] -- 0:04:34
31800 -- [-2074.393] (-2076.016) (-2073.719) (-2083.397) * (-2075.897) (-2076.287) (-2079.473) [-2076.800] -- 0:04:34
31900 -- (-2074.179) (-2077.510) (-2081.088) [-2074.312] * [-2076.734] (-2080.197) (-2071.192) (-2075.530) -- 0:04:33
32000 -- (-2074.628) (-2082.208) (-2075.457) [-2072.168] * (-2075.765) (-2074.853) (-2067.748) [-2071.191] -- 0:04:32
Average standard deviation of split frequencies: 0.039243
32100 -- (-2073.374) (-2081.034) [-2073.364] (-2071.287) * (-2070.024) (-2073.851) [-2068.128] (-2087.222) -- 0:04:31
32200 -- (-2079.336) (-2075.428) [-2081.892] (-2072.619) * (-2075.341) (-2075.385) [-2072.594] (-2079.549) -- 0:04:30
32300 -- (-2077.548) (-2078.916) (-2080.436) [-2069.521] * (-2081.359) (-2079.686) (-2076.999) [-2072.934] -- 0:04:29
32400 -- (-2078.255) (-2082.663) [-2079.461] (-2076.295) * (-2087.685) (-2075.656) [-2073.480] (-2076.908) -- 0:04:28
32500 -- (-2076.202) (-2086.819) (-2083.180) [-2075.873] * (-2075.993) (-2074.293) [-2073.961] (-2076.640) -- 0:04:27
32600 -- [-2075.398] (-2086.758) (-2083.067) (-2074.652) * (-2077.551) (-2090.419) (-2074.765) [-2076.193] -- 0:04:27
32700 -- (-2088.493) (-2083.607) [-2078.944] (-2079.413) * [-2074.980] (-2075.274) (-2081.527) (-2075.623) -- 0:04:26
32800 -- [-2079.674] (-2087.862) (-2088.178) (-2076.703) * [-2079.716] (-2071.298) (-2080.892) (-2085.416) -- 0:04:25
32900 -- (-2077.734) (-2085.858) (-2087.563) [-2078.361] * (-2079.900) [-2073.238] (-2084.638) (-2081.415) -- 0:04:24
33000 -- (-2074.502) [-2081.309] (-2083.216) (-2078.033) * (-2078.690) (-2084.864) [-2077.723] (-2080.150) -- 0:04:23
Average standard deviation of split frequencies: 0.038337
33100 -- (-2088.038) (-2082.707) (-2090.349) [-2079.761] * [-2073.638] (-2080.012) (-2079.440) (-2085.404) -- 0:04:22
33200 -- [-2075.629] (-2079.875) (-2082.485) (-2073.915) * [-2072.860] (-2080.269) (-2077.330) (-2085.006) -- 0:04:22
33300 -- [-2080.146] (-2078.747) (-2079.610) (-2071.438) * (-2078.871) (-2081.642) [-2075.855] (-2085.120) -- 0:04:21
33400 -- [-2078.991] (-2088.836) (-2085.747) (-2074.121) * [-2073.374] (-2078.601) (-2080.464) (-2080.408) -- 0:04:20
33500 -- (-2082.910) (-2089.559) (-2097.941) [-2070.941] * [-2074.231] (-2078.487) (-2079.676) (-2084.149) -- 0:04:19
33600 -- (-2088.248) (-2078.757) (-2095.253) [-2070.928] * (-2075.556) (-2078.627) (-2082.277) [-2077.407] -- 0:04:18
33700 -- (-2079.388) (-2085.200) (-2091.745) [-2078.352] * (-2073.357) (-2086.784) [-2075.260] (-2080.208) -- 0:04:18
33800 -- (-2076.877) [-2076.789] (-2085.630) (-2088.084) * [-2075.022] (-2077.932) (-2077.745) (-2078.463) -- 0:04:17
33900 -- (-2082.515) [-2078.026] (-2077.049) (-2078.888) * (-2078.333) [-2084.976] (-2081.035) (-2078.794) -- 0:04:44
34000 -- (-2084.019) [-2078.846] (-2086.705) (-2078.465) * [-2078.219] (-2080.185) (-2084.612) (-2078.351) -- 0:04:44
Average standard deviation of split frequencies: 0.036253
34100 -- [-2077.504] (-2079.976) (-2089.513) (-2075.007) * (-2075.978) [-2080.942] (-2082.024) (-2081.974) -- 0:04:43
34200 -- (-2074.071) (-2085.448) [-2079.655] (-2076.492) * [-2076.250] (-2083.273) (-2082.042) (-2079.703) -- 0:04:42
34300 -- (-2079.550) (-2078.633) [-2077.156] (-2082.075) * (-2074.583) (-2077.677) (-2083.761) [-2077.325] -- 0:04:41
34400 -- (-2084.502) (-2075.069) (-2079.282) [-2075.503] * (-2077.909) (-2087.400) (-2078.025) [-2081.991] -- 0:04:40
34500 -- (-2081.842) (-2077.918) (-2080.086) [-2069.856] * (-2073.108) (-2080.077) [-2074.608] (-2085.598) -- 0:04:39
34600 -- (-2082.466) (-2079.192) [-2087.492] (-2075.293) * [-2071.509] (-2075.263) (-2070.403) (-2084.087) -- 0:04:39
34700 -- (-2079.114) (-2075.500) (-2083.760) [-2072.696] * (-2072.267) (-2073.635) [-2068.321] (-2084.520) -- 0:04:38
34800 -- [-2075.227] (-2072.489) (-2080.314) (-2076.848) * (-2072.838) [-2074.738] (-2075.962) (-2093.362) -- 0:04:37
34900 -- (-2077.207) (-2082.082) (-2082.113) [-2074.505] * (-2072.980) [-2070.199] (-2069.490) (-2087.534) -- 0:04:36
35000 -- [-2075.531] (-2074.816) (-2077.433) (-2083.968) * (-2080.610) (-2075.372) [-2069.279] (-2078.956) -- 0:04:35
Average standard deviation of split frequencies: 0.034150
35100 -- [-2077.715] (-2075.874) (-2080.771) (-2087.529) * (-2082.873) (-2073.598) (-2072.259) [-2073.733] -- 0:04:34
35200 -- (-2076.174) [-2072.430] (-2077.825) (-2081.937) * (-2075.075) [-2069.980] (-2068.884) (-2085.006) -- 0:04:34
35300 -- (-2080.406) (-2079.469) [-2079.999] (-2084.253) * [-2072.292] (-2075.204) (-2069.689) (-2083.388) -- 0:04:33
35400 -- (-2080.097) (-2077.761) (-2085.920) [-2081.049] * (-2071.024) (-2078.002) [-2073.245] (-2075.465) -- 0:04:32
35500 -- (-2075.252) (-2081.127) [-2072.378] (-2081.942) * [-2067.463] (-2076.135) (-2069.764) (-2079.929) -- 0:04:31
35600 -- (-2073.271) (-2078.006) [-2075.141] (-2084.714) * [-2072.839] (-2075.277) (-2075.545) (-2090.114) -- 0:04:30
35700 -- (-2081.192) (-2080.132) (-2073.951) [-2079.808] * (-2071.084) (-2079.361) (-2074.185) [-2082.334] -- 0:04:30
35800 -- (-2084.598) [-2076.070] (-2077.034) (-2073.385) * [-2072.565] (-2080.120) (-2077.924) (-2083.991) -- 0:04:29
35900 -- (-2078.149) [-2070.861] (-2082.466) (-2071.277) * [-2071.881] (-2075.944) (-2073.679) (-2087.579) -- 0:04:28
36000 -- [-2071.889] (-2073.648) (-2083.046) (-2079.726) * [-2070.640] (-2074.977) (-2073.378) (-2088.858) -- 0:04:27
Average standard deviation of split frequencies: 0.034573
36100 -- (-2078.597) (-2077.230) (-2080.027) [-2067.591] * (-2086.986) (-2077.012) [-2076.758] (-2074.358) -- 0:04:27
36200 -- [-2082.369] (-2074.160) (-2084.582) (-2071.564) * (-2074.588) (-2080.724) [-2077.519] (-2077.346) -- 0:04:26
36300 -- (-2083.037) (-2076.795) (-2090.760) [-2071.203] * (-2073.335) [-2076.152] (-2076.510) (-2077.985) -- 0:04:25
36400 -- (-2080.946) [-2070.471] (-2094.237) (-2072.638) * (-2076.064) (-2072.725) (-2076.872) [-2070.311] -- 0:04:24
36500 -- (-2076.638) [-2071.990] (-2079.720) (-2074.562) * [-2071.979] (-2075.362) (-2081.449) (-2075.916) -- 0:04:23
36600 -- (-2085.609) (-2075.394) (-2087.775) [-2075.104] * [-2067.243] (-2075.713) (-2078.023) (-2071.915) -- 0:04:23
36700 -- (-2086.767) [-2075.712] (-2084.440) (-2073.480) * (-2078.740) (-2075.711) (-2081.866) [-2067.107] -- 0:04:22
36800 -- (-2087.016) (-2073.142) (-2090.319) [-2072.951] * (-2076.465) (-2082.499) [-2075.368] (-2075.076) -- 0:04:21
36900 -- (-2085.048) [-2073.868] (-2086.308) (-2074.202) * [-2076.828] (-2089.988) (-2070.385) (-2077.409) -- 0:04:21
37000 -- (-2084.704) [-2073.512] (-2079.046) (-2076.215) * [-2073.025] (-2081.398) (-2072.443) (-2077.372) -- 0:04:20
Average standard deviation of split frequencies: 0.034532
37100 -- (-2079.146) [-2070.533] (-2078.884) (-2070.561) * (-2079.191) (-2087.990) (-2074.494) [-2070.326] -- 0:04:19
37200 -- (-2082.690) (-2077.625) (-2086.372) [-2075.213] * (-2080.062) (-2082.135) (-2077.973) [-2066.252] -- 0:04:18
37300 -- (-2089.693) (-2076.819) (-2080.950) [-2070.709] * (-2078.571) (-2076.987) [-2072.252] (-2079.043) -- 0:04:18
37400 -- [-2079.379] (-2080.343) (-2082.371) (-2068.635) * (-2080.391) (-2074.958) (-2072.522) [-2069.444] -- 0:04:43
37500 -- (-2077.164) (-2085.845) (-2079.884) [-2067.411] * (-2092.908) (-2086.075) [-2078.782] (-2073.112) -- 0:04:42
37600 -- (-2074.622) [-2078.699] (-2088.338) (-2076.871) * (-2082.670) [-2071.436] (-2077.425) (-2079.445) -- 0:04:41
37700 -- (-2082.117) (-2081.988) [-2081.492] (-2079.249) * (-2083.819) [-2072.706] (-2071.364) (-2080.280) -- 0:04:40
37800 -- (-2084.885) [-2076.687] (-2083.734) (-2076.254) * (-2088.802) (-2076.278) (-2074.094) [-2072.288] -- 0:04:40
37900 -- (-2075.705) (-2071.361) [-2073.559] (-2070.058) * (-2076.894) (-2073.221) [-2073.081] (-2070.931) -- 0:04:39
38000 -- (-2073.041) (-2081.967) [-2078.372] (-2076.153) * (-2079.497) (-2070.596) (-2078.814) [-2071.197] -- 0:04:38
Average standard deviation of split frequencies: 0.033377
38100 -- (-2079.622) (-2081.848) (-2083.340) [-2077.046] * (-2076.152) [-2073.829] (-2077.158) (-2075.256) -- 0:04:37
38200 -- (-2073.557) (-2079.912) (-2093.415) [-2073.869] * (-2073.267) (-2074.101) [-2074.878] (-2075.127) -- 0:04:36
38300 -- [-2073.779] (-2076.529) (-2082.171) (-2078.738) * [-2079.451] (-2080.925) (-2078.436) (-2072.220) -- 0:04:36
38400 -- (-2077.363) (-2081.553) [-2072.937] (-2076.016) * (-2084.130) (-2075.566) (-2077.912) [-2070.468] -- 0:04:35
38500 -- (-2079.336) (-2083.103) [-2075.719] (-2075.567) * (-2078.257) [-2080.322] (-2087.623) (-2079.739) -- 0:04:34
38600 -- (-2071.731) (-2086.534) (-2081.204) [-2076.048] * [-2073.296] (-2081.773) (-2074.609) (-2077.389) -- 0:04:33
38700 -- (-2076.012) (-2083.206) (-2076.022) [-2072.185] * [-2074.423] (-2092.814) (-2071.147) (-2080.259) -- 0:04:33
38800 -- (-2078.806) (-2077.484) [-2074.087] (-2083.631) * (-2081.364) (-2081.624) (-2073.234) [-2078.417] -- 0:04:32
38900 -- (-2081.968) [-2069.149] (-2070.904) (-2091.055) * (-2079.583) (-2085.970) (-2077.282) [-2073.084] -- 0:04:31
39000 -- (-2088.297) (-2079.738) [-2073.796] (-2099.955) * (-2088.859) (-2079.528) (-2078.716) [-2068.335] -- 0:04:31
Average standard deviation of split frequencies: 0.030365
39100 -- [-2081.893] (-2081.611) (-2086.910) (-2088.676) * (-2089.398) (-2078.583) [-2074.514] (-2066.786) -- 0:04:30
39200 -- [-2077.680] (-2076.606) (-2079.950) (-2092.840) * (-2075.148) [-2074.876] (-2082.194) (-2075.235) -- 0:04:29
39300 -- (-2075.405) (-2077.817) (-2083.643) [-2076.367] * (-2080.781) (-2083.636) (-2078.825) [-2078.974] -- 0:04:28
39400 -- [-2078.477] (-2072.633) (-2085.268) (-2081.161) * (-2088.750) (-2082.888) (-2082.175) [-2073.252] -- 0:04:28
39500 -- (-2079.506) (-2074.347) (-2081.789) [-2075.296] * (-2079.756) [-2075.196] (-2088.638) (-2080.113) -- 0:04:27
39600 -- (-2074.642) [-2070.302] (-2079.157) (-2080.593) * (-2086.549) (-2088.698) (-2085.213) [-2079.760] -- 0:04:26
39700 -- (-2078.220) [-2071.506] (-2076.150) (-2074.208) * (-2080.716) [-2079.287] (-2080.240) (-2078.234) -- 0:04:26
39800 -- (-2081.584) [-2070.287] (-2078.946) (-2073.123) * [-2077.813] (-2082.596) (-2079.980) (-2077.631) -- 0:04:25
39900 -- (-2080.296) [-2068.785] (-2083.271) (-2072.898) * (-2077.645) (-2081.557) (-2081.684) [-2070.301] -- 0:04:24
40000 -- (-2080.015) (-2073.208) (-2077.540) [-2073.019] * [-2076.449] (-2078.666) (-2078.379) (-2075.974) -- 0:04:24
Average standard deviation of split frequencies: 0.030875
40100 -- (-2082.064) [-2073.987] (-2075.560) (-2074.538) * (-2076.431) [-2073.875] (-2076.802) (-2079.738) -- 0:04:23
40200 -- (-2078.800) [-2069.930] (-2077.725) (-2070.244) * (-2076.098) [-2078.388] (-2078.589) (-2084.673) -- 0:04:22
40300 -- (-2081.579) (-2074.762) [-2077.453] (-2077.203) * [-2076.164] (-2078.226) (-2079.888) (-2087.104) -- 0:04:21
40400 -- (-2093.122) [-2074.795] (-2083.092) (-2073.341) * (-2086.690) (-2081.166) [-2081.068] (-2083.457) -- 0:04:21
40500 -- (-2080.996) (-2077.597) (-2079.352) [-2069.010] * (-2082.644) [-2076.306] (-2076.859) (-2082.608) -- 0:04:20
40600 -- (-2079.524) (-2072.846) (-2075.309) [-2070.738] * (-2077.887) [-2079.989] (-2083.162) (-2081.915) -- 0:04:19
40700 -- (-2079.976) (-2072.502) (-2078.940) [-2075.858] * (-2083.942) [-2077.812] (-2077.595) (-2075.236) -- 0:04:19
40800 -- (-2089.844) (-2073.923) (-2081.924) [-2070.245] * (-2081.885) [-2076.395] (-2081.427) (-2081.571) -- 0:04:18
40900 -- (-2075.110) (-2077.838) (-2074.089) [-2069.357] * [-2077.518] (-2084.097) (-2084.761) (-2083.237) -- 0:04:17
41000 -- [-2076.549] (-2083.935) (-2077.677) (-2075.591) * (-2079.435) (-2085.581) [-2075.405] (-2085.948) -- 0:04:17
Average standard deviation of split frequencies: 0.031179
41100 -- (-2077.426) (-2084.867) [-2075.022] (-2077.534) * (-2080.867) (-2085.451) (-2084.061) [-2083.175] -- 0:04:39
41200 -- (-2081.455) (-2079.533) (-2080.013) [-2071.015] * [-2078.520] (-2083.467) (-2088.990) (-2085.035) -- 0:04:39
41300 -- (-2078.701) (-2072.280) (-2077.576) [-2074.486] * (-2085.002) (-2088.825) [-2077.902] (-2090.394) -- 0:04:38
41400 -- (-2081.967) (-2086.096) (-2080.629) [-2075.614] * (-2085.014) (-2092.550) [-2072.165] (-2082.081) -- 0:04:37
41500 -- (-2079.661) (-2084.179) (-2084.900) [-2072.079] * (-2084.604) (-2076.114) [-2077.259] (-2078.725) -- 0:04:37
41600 -- (-2077.045) [-2068.716] (-2081.484) (-2078.632) * [-2081.843] (-2079.652) (-2073.864) (-2088.434) -- 0:04:36
41700 -- (-2091.070) (-2071.628) (-2082.287) [-2068.683] * (-2082.028) (-2079.770) (-2070.002) [-2089.501] -- 0:04:35
41800 -- (-2085.970) [-2072.414] (-2076.508) (-2071.340) * (-2084.741) (-2085.392) [-2077.218] (-2081.784) -- 0:04:35
41900 -- (-2082.887) (-2076.059) (-2082.654) [-2072.301] * (-2076.717) (-2074.709) [-2072.519] (-2085.150) -- 0:04:34
42000 -- (-2076.112) [-2069.947] (-2081.619) (-2075.667) * (-2075.567) (-2078.804) [-2078.721] (-2089.051) -- 0:04:33
Average standard deviation of split frequencies: 0.030488
42100 -- (-2081.789) (-2067.903) [-2080.045] (-2083.153) * (-2071.295) (-2083.373) (-2078.966) [-2079.956] -- 0:04:33
42200 -- (-2083.353) [-2074.459] (-2078.509) (-2081.382) * [-2071.352] (-2082.002) (-2074.379) (-2086.258) -- 0:04:32
42300 -- (-2080.460) [-2073.108] (-2082.616) (-2078.134) * [-2072.477] (-2078.585) (-2077.555) (-2090.669) -- 0:04:31
42400 -- (-2078.589) [-2081.367] (-2079.006) (-2079.148) * [-2070.557] (-2081.824) (-2083.904) (-2088.242) -- 0:04:31
42500 -- (-2092.030) (-2071.759) (-2080.653) [-2073.449] * [-2070.803] (-2080.434) (-2084.144) (-2083.216) -- 0:04:30
42600 -- (-2082.537) [-2069.805] (-2085.185) (-2077.401) * (-2077.747) (-2084.665) [-2074.783] (-2079.256) -- 0:04:29
42700 -- (-2084.618) [-2069.137] (-2082.288) (-2080.844) * [-2078.996] (-2078.335) (-2074.569) (-2083.338) -- 0:04:29
42800 -- (-2079.829) [-2069.458] (-2079.054) (-2081.134) * [-2067.968] (-2081.889) (-2077.788) (-2078.879) -- 0:04:28
42900 -- (-2082.450) [-2068.511] (-2080.740) (-2085.873) * (-2075.690) [-2078.865] (-2077.851) (-2074.435) -- 0:04:27
43000 -- (-2096.586) [-2067.042] (-2086.606) (-2075.719) * [-2078.691] (-2080.590) (-2078.283) (-2083.652) -- 0:04:27
Average standard deviation of split frequencies: 0.030866
43100 -- (-2087.841) (-2069.451) (-2095.235) [-2078.902] * (-2077.392) [-2073.882] (-2077.175) (-2080.414) -- 0:04:26
43200 -- (-2087.542) (-2074.132) (-2085.663) [-2074.406] * (-2071.059) (-2076.818) [-2073.481] (-2075.104) -- 0:04:25
43300 -- (-2086.068) [-2070.383] (-2087.348) (-2073.724) * (-2073.218) (-2079.763) [-2073.482] (-2077.398) -- 0:04:25
43400 -- (-2089.759) (-2080.227) (-2081.428) [-2074.476] * (-2075.076) (-2078.779) (-2072.067) [-2081.387] -- 0:04:24
43500 -- (-2084.897) (-2079.881) [-2074.702] (-2078.829) * [-2075.355] (-2073.645) (-2079.595) (-2082.986) -- 0:04:23
43600 -- (-2085.384) [-2070.324] (-2081.228) (-2086.772) * (-2072.354) [-2069.821] (-2079.384) (-2081.362) -- 0:04:23
43700 -- (-2089.422) [-2072.699] (-2087.251) (-2071.711) * [-2072.577] (-2078.316) (-2091.052) (-2076.040) -- 0:04:22
43800 -- (-2082.339) (-2075.327) [-2074.919] (-2078.401) * [-2067.588] (-2072.931) (-2095.929) (-2078.579) -- 0:04:21
43900 -- (-2079.551) (-2083.630) (-2076.877) [-2074.730] * (-2073.128) (-2084.911) [-2072.029] (-2080.120) -- 0:04:21
44000 -- (-2083.865) (-2078.804) [-2074.743] (-2078.573) * [-2078.132] (-2076.196) (-2075.132) (-2085.833) -- 0:04:20
Average standard deviation of split frequencies: 0.027772
44100 -- (-2082.261) [-2073.271] (-2076.156) (-2084.581) * [-2074.310] (-2079.780) (-2075.223) (-2092.878) -- 0:04:20
44200 -- (-2083.807) [-2071.881] (-2076.720) (-2079.790) * [-2078.754] (-2073.844) (-2072.509) (-2087.666) -- 0:04:19
44300 -- (-2087.163) [-2070.347] (-2077.093) (-2079.929) * [-2070.907] (-2075.517) (-2073.870) (-2080.372) -- 0:04:18
44400 -- (-2086.246) (-2072.135) [-2081.203] (-2084.512) * (-2076.027) [-2071.455] (-2069.944) (-2078.659) -- 0:04:18
44500 -- (-2088.202) [-2071.707] (-2084.407) (-2080.885) * (-2074.257) [-2070.121] (-2074.971) (-2085.398) -- 0:04:17
44600 -- (-2080.782) (-2074.063) (-2081.718) [-2085.952] * [-2067.991] (-2077.068) (-2075.738) (-2084.724) -- 0:04:17
44700 -- (-2083.557) (-2076.486) [-2078.237] (-2081.292) * [-2072.107] (-2070.838) (-2073.462) (-2084.181) -- 0:04:37
44800 -- (-2089.423) (-2080.112) [-2081.366] (-2082.104) * [-2070.536] (-2069.543) (-2073.617) (-2093.617) -- 0:04:37
44900 -- (-2086.520) (-2082.455) [-2085.645] (-2082.009) * [-2074.726] (-2071.558) (-2082.133) (-2092.057) -- 0:04:36
45000 -- (-2081.486) [-2080.612] (-2080.618) (-2088.753) * [-2072.344] (-2073.046) (-2078.415) (-2101.630) -- 0:04:35
Average standard deviation of split frequencies: 0.028308
45100 -- (-2083.959) [-2081.338] (-2082.791) (-2078.740) * [-2074.091] (-2070.890) (-2083.803) (-2091.592) -- 0:04:35
45200 -- (-2083.372) (-2072.869) [-2076.488] (-2081.983) * [-2073.960] (-2072.775) (-2093.372) (-2088.433) -- 0:04:34
45300 -- (-2088.237) [-2074.877] (-2079.099) (-2078.392) * (-2067.963) [-2076.696] (-2091.884) (-2080.869) -- 0:04:33
45400 -- (-2082.520) [-2077.464] (-2097.086) (-2087.848) * (-2071.310) [-2069.504] (-2080.538) (-2087.294) -- 0:04:33
45500 -- (-2080.961) (-2090.138) [-2080.636] (-2078.310) * (-2074.611) (-2068.198) [-2075.206] (-2088.259) -- 0:04:32
45600 -- (-2075.922) [-2081.544] (-2077.820) (-2086.123) * [-2075.512] (-2069.233) (-2084.014) (-2084.557) -- 0:04:32
45700 -- (-2084.823) [-2076.764] (-2078.201) (-2082.225) * (-2073.314) [-2068.272] (-2078.434) (-2089.959) -- 0:04:31
45800 -- [-2076.988] (-2078.604) (-2082.646) (-2078.641) * (-2086.024) [-2068.812] (-2082.334) (-2085.249) -- 0:04:30
45900 -- (-2083.157) [-2071.293] (-2087.110) (-2079.357) * (-2087.902) (-2074.449) [-2070.034] (-2082.112) -- 0:04:30
46000 -- (-2087.608) (-2066.952) [-2082.785] (-2081.803) * [-2082.789] (-2073.709) (-2071.493) (-2087.065) -- 0:04:29
Average standard deviation of split frequencies: 0.031239
46100 -- (-2086.834) [-2071.829] (-2082.718) (-2077.327) * (-2082.305) [-2078.835] (-2074.465) (-2084.071) -- 0:04:28
46200 -- (-2080.325) [-2071.488] (-2083.373) (-2092.342) * [-2077.380] (-2077.618) (-2078.017) (-2083.247) -- 0:04:28
46300 -- (-2086.248) [-2072.211] (-2087.632) (-2095.420) * (-2078.488) [-2074.622] (-2080.082) (-2080.414) -- 0:04:27
46400 -- (-2083.232) [-2071.496] (-2078.660) (-2085.411) * (-2078.063) [-2075.776] (-2081.472) (-2082.605) -- 0:04:27
46500 -- (-2087.010) [-2070.917] (-2080.776) (-2078.790) * [-2076.231] (-2081.053) (-2086.479) (-2083.508) -- 0:04:26
46600 -- (-2091.177) [-2074.164] (-2076.274) (-2086.879) * [-2075.339] (-2086.029) (-2082.829) (-2083.231) -- 0:04:25
46700 -- (-2086.628) (-2070.057) (-2077.930) [-2082.481] * (-2081.518) (-2079.287) [-2082.233] (-2085.869) -- 0:04:25
46800 -- [-2085.783] (-2071.945) (-2075.269) (-2084.928) * [-2078.513] (-2083.213) (-2082.767) (-2086.396) -- 0:04:24
46900 -- (-2082.200) [-2071.901] (-2080.811) (-2075.753) * (-2075.419) [-2075.496] (-2085.071) (-2082.432) -- 0:04:24
47000 -- (-2083.458) (-2078.770) [-2077.936] (-2086.847) * [-2073.688] (-2088.635) (-2092.961) (-2079.608) -- 0:04:23
Average standard deviation of split frequencies: 0.029677
47100 -- (-2080.687) (-2082.815) [-2080.776] (-2086.720) * (-2072.273) (-2081.656) (-2077.531) [-2079.471] -- 0:04:23
47200 -- (-2083.265) (-2075.753) [-2078.785] (-2088.690) * (-2074.588) (-2091.126) [-2070.851] (-2079.875) -- 0:04:22
47300 -- (-2091.811) [-2074.480] (-2081.517) (-2078.010) * (-2075.240) (-2078.012) [-2069.941] (-2078.154) -- 0:04:21
47400 -- (-2088.842) [-2070.636] (-2080.144) (-2084.980) * (-2078.789) (-2077.399) [-2076.721] (-2087.099) -- 0:04:21
47500 -- (-2093.842) [-2077.358] (-2080.894) (-2082.448) * (-2080.370) (-2088.397) [-2072.767] (-2079.266) -- 0:04:20
47600 -- (-2097.455) [-2074.576] (-2090.443) (-2080.815) * (-2092.363) (-2088.032) [-2070.863] (-2076.937) -- 0:04:20
47700 -- (-2091.901) [-2069.652] (-2082.881) (-2083.258) * (-2094.262) (-2084.681) [-2079.511] (-2077.641) -- 0:04:19
47800 -- (-2084.954) [-2071.319] (-2080.653) (-2087.664) * (-2097.379) (-2089.646) [-2071.930] (-2077.880) -- 0:04:18
47900 -- (-2086.566) [-2074.608] (-2076.727) (-2080.281) * (-2084.391) (-2094.592) [-2068.616] (-2072.701) -- 0:04:18
48000 -- (-2086.648) [-2073.734] (-2075.581) (-2078.464) * (-2094.706) (-2080.184) [-2065.474] (-2078.123) -- 0:04:17
Average standard deviation of split frequencies: 0.031620
48100 -- (-2090.423) (-2073.664) [-2077.740] (-2082.514) * (-2077.385) (-2072.862) [-2069.421] (-2076.436) -- 0:04:17
48200 -- (-2086.630) (-2075.798) [-2077.942] (-2084.760) * (-2081.744) (-2072.996) [-2074.666] (-2080.807) -- 0:04:36
48300 -- [-2076.756] (-2071.420) (-2083.269) (-2089.952) * (-2080.377) (-2076.285) [-2068.235] (-2080.967) -- 0:04:35
48400 -- (-2081.616) [-2074.176] (-2082.356) (-2080.552) * (-2083.971) (-2081.958) [-2067.482] (-2078.920) -- 0:04:35
48500 -- (-2081.920) (-2073.982) [-2081.604] (-2083.000) * (-2094.851) (-2074.252) [-2067.428] (-2084.773) -- 0:04:34
48600 -- (-2082.523) [-2073.034] (-2074.721) (-2084.496) * (-2090.661) (-2076.326) (-2069.028) [-2079.896] -- 0:04:34
48700 -- (-2083.214) (-2072.611) [-2078.604] (-2083.811) * (-2083.895) (-2074.947) [-2067.918] (-2076.634) -- 0:04:33
48800 -- (-2083.164) [-2073.310] (-2092.006) (-2087.219) * (-2080.323) (-2075.498) [-2074.245] (-2080.938) -- 0:04:32
48900 -- (-2087.994) [-2072.575] (-2077.735) (-2089.538) * (-2086.293) (-2078.438) [-2078.011] (-2089.803) -- 0:04:32
49000 -- [-2077.712] (-2071.284) (-2077.693) (-2093.130) * (-2080.176) (-2079.595) [-2069.369] (-2087.766) -- 0:04:31
Average standard deviation of split frequencies: 0.030934
49100 -- [-2075.890] (-2073.890) (-2077.108) (-2089.895) * [-2078.092] (-2078.731) (-2073.484) (-2079.424) -- 0:04:31
49200 -- [-2075.717] (-2075.066) (-2086.438) (-2091.162) * (-2088.054) (-2082.158) [-2083.671] (-2079.959) -- 0:04:30
49300 -- [-2076.347] (-2074.486) (-2081.748) (-2081.970) * (-2080.768) (-2085.121) [-2075.933] (-2082.009) -- 0:04:29
49400 -- [-2076.701] (-2074.394) (-2081.671) (-2078.373) * [-2075.274] (-2086.241) (-2081.282) (-2078.323) -- 0:04:29
49500 -- (-2078.371) [-2073.145] (-2080.524) (-2078.211) * (-2080.995) [-2070.881] (-2076.834) (-2074.013) -- 0:04:28
49600 -- [-2079.541] (-2089.440) (-2080.828) (-2077.272) * (-2083.592) (-2075.340) [-2072.319] (-2076.468) -- 0:04:28
49700 -- (-2078.299) (-2075.402) (-2086.318) [-2075.935] * (-2073.366) [-2078.668] (-2072.463) (-2081.872) -- 0:04:27
49800 -- (-2088.056) (-2083.983) (-2082.406) [-2075.541] * (-2087.323) (-2080.070) [-2070.613] (-2076.716) -- 0:04:27
49900 -- (-2091.731) (-2079.456) (-2086.032) [-2073.382] * (-2079.617) (-2081.427) [-2068.691] (-2077.490) -- 0:04:26
50000 -- (-2080.368) (-2075.516) (-2086.270) [-2073.694] * (-2080.957) (-2081.525) [-2069.178] (-2077.466) -- 0:04:26
Average standard deviation of split frequencies: 0.032776
50100 -- (-2077.086) [-2074.538] (-2100.841) (-2077.810) * (-2078.591) (-2088.730) [-2070.456] (-2082.387) -- 0:04:25
50200 -- [-2076.803] (-2073.160) (-2090.341) (-2080.818) * (-2082.440) (-2086.711) [-2075.026] (-2088.254) -- 0:04:24
50300 -- [-2079.907] (-2076.110) (-2090.685) (-2077.501) * (-2089.651) (-2089.982) (-2068.655) [-2080.379] -- 0:04:24
50400 -- (-2074.217) [-2072.751] (-2086.179) (-2076.010) * (-2094.600) (-2091.163) [-2071.575] (-2088.396) -- 0:04:23
50500 -- (-2083.386) [-2077.246] (-2095.244) (-2076.765) * (-2084.694) (-2095.458) [-2070.196] (-2081.865) -- 0:04:23
50600 -- (-2088.984) (-2075.124) (-2082.603) [-2083.161] * [-2078.399] (-2096.265) (-2068.666) (-2078.964) -- 0:04:22
50700 -- (-2090.237) [-2073.660] (-2075.638) (-2078.636) * (-2078.669) (-2095.673) [-2072.600] (-2084.470) -- 0:04:22
50800 -- (-2091.823) (-2076.520) (-2078.108) [-2076.343] * (-2072.117) (-2096.635) [-2075.855] (-2076.696) -- 0:04:21
50900 -- (-2089.921) [-2075.579] (-2080.067) (-2080.526) * (-2073.754) (-2099.854) (-2078.927) [-2079.876] -- 0:04:21
51000 -- (-2088.258) [-2073.548] (-2076.029) (-2074.183) * [-2069.808] (-2087.266) (-2070.317) (-2081.850) -- 0:04:20
Average standard deviation of split frequencies: 0.035513
51100 -- (-2080.551) (-2079.469) [-2076.051] (-2080.482) * (-2074.447) (-2084.172) [-2071.222] (-2079.587) -- 0:04:19
51200 -- (-2079.782) (-2079.965) [-2081.305] (-2076.764) * (-2076.266) (-2080.127) (-2074.656) [-2079.691] -- 0:04:19
51300 -- (-2077.277) (-2082.019) (-2078.418) [-2074.628] * (-2076.887) (-2081.985) [-2076.388] (-2092.140) -- 0:04:18
51400 -- (-2079.437) (-2075.754) (-2077.797) [-2072.494] * [-2074.531] (-2083.150) (-2074.616) (-2077.825) -- 0:04:18
51500 -- (-2087.474) (-2074.866) [-2077.190] (-2080.399) * (-2082.618) (-2085.518) (-2073.873) [-2075.142] -- 0:04:17
51600 -- [-2076.059] (-2076.887) (-2087.266) (-2076.798) * (-2079.103) (-2076.851) [-2079.185] (-2074.414) -- 0:04:17
51700 -- [-2076.924] (-2081.300) (-2083.522) (-2078.005) * (-2085.788) [-2078.760] (-2090.077) (-2078.954) -- 0:04:35
51800 -- (-2076.374) (-2079.093) (-2078.731) [-2073.639] * (-2090.990) (-2078.529) [-2077.333] (-2085.783) -- 0:04:34
51900 -- (-2080.591) (-2071.812) (-2077.750) [-2078.708] * (-2089.990) (-2078.550) [-2073.839] (-2082.700) -- 0:04:34
52000 -- (-2079.333) (-2079.075) [-2073.764] (-2078.676) * (-2091.163) (-2085.464) [-2072.441] (-2080.627) -- 0:04:33
Average standard deviation of split frequencies: 0.036169
52100 -- (-2075.017) [-2076.882] (-2083.238) (-2082.954) * (-2082.968) (-2087.615) [-2073.301] (-2078.983) -- 0:04:32
52200 -- [-2073.879] (-2072.289) (-2075.745) (-2080.055) * (-2073.298) (-2082.392) [-2076.653] (-2080.199) -- 0:04:32
52300 -- [-2074.167] (-2082.289) (-2087.603) (-2077.038) * (-2073.858) (-2083.496) (-2072.231) [-2088.509] -- 0:04:31
52400 -- (-2072.916) (-2088.145) [-2083.315] (-2077.077) * (-2077.491) (-2073.773) [-2075.303] (-2083.634) -- 0:04:31
52500 -- (-2073.011) (-2085.965) (-2083.902) [-2077.781] * [-2072.156] (-2076.132) (-2076.224) (-2082.218) -- 0:04:30
52600 -- [-2079.155] (-2079.877) (-2083.200) (-2078.005) * [-2072.134] (-2079.301) (-2087.562) (-2079.160) -- 0:04:30
52700 -- (-2075.275) [-2077.447] (-2080.938) (-2073.114) * (-2075.031) (-2070.858) [-2077.049] (-2082.210) -- 0:04:29
52800 -- (-2071.355) (-2079.483) (-2079.662) [-2080.374] * (-2077.394) (-2075.527) [-2082.914] (-2097.373) -- 0:04:29
52900 -- [-2074.465] (-2074.154) (-2075.964) (-2084.388) * (-2076.879) (-2073.005) [-2075.510] (-2103.182) -- 0:04:28
53000 -- [-2068.799] (-2078.739) (-2085.997) (-2082.024) * [-2075.345] (-2076.207) (-2086.781) (-2090.698) -- 0:04:28
Average standard deviation of split frequencies: 0.037722
53100 -- [-2076.316] (-2079.032) (-2081.370) (-2082.334) * (-2075.751) (-2086.407) [-2081.178] (-2087.006) -- 0:04:27
53200 -- [-2074.718] (-2079.531) (-2087.198) (-2077.443) * [-2073.500] (-2089.874) (-2090.123) (-2072.944) -- 0:04:26
53300 -- [-2073.991] (-2083.459) (-2090.596) (-2076.008) * (-2078.060) (-2074.382) (-2085.179) [-2075.126] -- 0:04:26
53400 -- (-2079.687) [-2076.737] (-2092.788) (-2077.172) * (-2070.154) (-2080.356) [-2078.968] (-2074.837) -- 0:04:25
53500 -- [-2076.094] (-2074.830) (-2087.979) (-2077.092) * [-2075.539] (-2085.621) (-2076.275) (-2079.358) -- 0:04:25
53600 -- (-2081.240) [-2077.692] (-2082.770) (-2078.296) * [-2086.820] (-2090.419) (-2083.858) (-2076.470) -- 0:04:24
53700 -- (-2079.340) [-2076.383] (-2090.306) (-2083.458) * (-2071.353) (-2086.552) [-2073.722] (-2084.016) -- 0:04:24
53800 -- (-2078.558) (-2075.595) (-2093.790) [-2080.829] * (-2070.533) (-2096.669) [-2082.585] (-2076.419) -- 0:04:23
53900 -- (-2085.232) [-2075.264] (-2095.936) (-2081.656) * [-2072.545] (-2088.704) (-2080.977) (-2075.088) -- 0:04:23
54000 -- (-2082.678) (-2082.070) (-2100.953) [-2080.042] * (-2074.108) (-2097.775) [-2082.589] (-2076.951) -- 0:04:22
Average standard deviation of split frequencies: 0.033838
54100 -- (-2085.103) [-2075.435] (-2089.795) (-2079.250) * [-2074.433] (-2083.400) (-2088.740) (-2080.760) -- 0:04:22
54200 -- (-2082.969) [-2074.605] (-2089.349) (-2075.877) * [-2072.793] (-2087.201) (-2079.146) (-2082.936) -- 0:04:21
54300 -- (-2084.605) [-2072.601] (-2088.934) (-2081.874) * (-2070.073) [-2079.259] (-2073.264) (-2082.424) -- 0:04:21
54400 -- [-2078.127] (-2078.961) (-2087.011) (-2090.783) * [-2069.673] (-2083.345) (-2084.445) (-2080.644) -- 0:04:20
54500 -- [-2074.607] (-2080.276) (-2081.863) (-2083.658) * [-2069.813] (-2079.225) (-2079.349) (-2084.578) -- 0:04:20
54600 -- (-2079.897) [-2078.910] (-2077.314) (-2082.205) * [-2072.211] (-2073.660) (-2081.926) (-2083.771) -- 0:04:19
54700 -- (-2077.569) [-2073.011] (-2082.415) (-2078.616) * [-2073.279] (-2087.185) (-2083.685) (-2077.828) -- 0:04:19
54800 -- (-2078.097) [-2076.887] (-2079.610) (-2092.602) * [-2071.812] (-2090.008) (-2084.574) (-2075.932) -- 0:04:18
54900 -- (-2074.982) [-2079.978] (-2075.633) (-2078.916) * [-2073.130] (-2077.875) (-2088.014) (-2084.575) -- 0:04:18
55000 -- (-2075.382) (-2076.131) [-2077.396] (-2074.649) * [-2072.211] (-2083.140) (-2085.802) (-2085.110) -- 0:04:17
Average standard deviation of split frequencies: 0.032208
55100 -- (-2080.427) (-2082.280) [-2079.073] (-2078.672) * [-2076.915] (-2074.625) (-2082.137) (-2087.154) -- 0:04:17
55200 -- (-2074.430) [-2076.548] (-2077.400) (-2077.378) * [-2073.347] (-2073.665) (-2079.906) (-2091.478) -- 0:04:16
55300 -- [-2073.951] (-2077.741) (-2074.976) (-2083.608) * (-2074.332) [-2075.146] (-2089.878) (-2074.782) -- 0:04:33
55400 -- [-2071.455] (-2079.464) (-2080.278) (-2083.881) * (-2076.078) [-2077.776] (-2085.374) (-2074.872) -- 0:04:32
55500 -- (-2075.989) (-2081.755) (-2079.122) [-2079.118] * (-2081.113) (-2084.698) [-2085.162] (-2080.154) -- 0:04:32
55600 -- (-2081.644) (-2074.927) [-2076.662] (-2075.576) * (-2086.031) [-2073.605] (-2081.901) (-2076.664) -- 0:04:31
55700 -- (-2079.214) (-2080.806) (-2080.166) [-2077.868] * (-2084.828) (-2078.615) (-2074.819) [-2079.385] -- 0:04:31
55800 -- [-2078.651] (-2076.520) (-2080.834) (-2092.951) * (-2090.435) [-2083.784] (-2079.838) (-2081.081) -- 0:04:30
55900 -- (-2080.225) [-2076.831] (-2082.781) (-2081.067) * (-2086.699) [-2077.121] (-2086.323) (-2081.645) -- 0:04:30
56000 -- [-2074.056] (-2091.014) (-2082.415) (-2080.861) * (-2085.609) (-2081.751) [-2081.210] (-2080.756) -- 0:04:29
Average standard deviation of split frequencies: 0.031912
56100 -- [-2077.270] (-2087.410) (-2085.846) (-2082.119) * (-2085.428) [-2076.920] (-2085.056) (-2076.640) -- 0:04:29
56200 -- [-2081.283] (-2076.881) (-2078.035) (-2081.432) * (-2104.786) (-2086.515) [-2075.393] (-2085.268) -- 0:04:28
56300 -- (-2081.636) (-2075.761) (-2082.432) [-2084.651] * (-2092.247) [-2083.468] (-2079.636) (-2076.829) -- 0:04:28
56400 -- (-2076.734) [-2074.057] (-2090.683) (-2085.095) * (-2079.898) [-2078.250] (-2081.693) (-2080.198) -- 0:04:27
56500 -- [-2069.929] (-2074.738) (-2074.209) (-2087.361) * (-2077.279) (-2079.545) (-2077.924) [-2079.116] -- 0:04:27
56600 -- (-2073.670) (-2074.559) (-2075.993) [-2082.027] * (-2080.556) (-2080.424) [-2077.020] (-2080.052) -- 0:04:26
56700 -- (-2076.191) [-2072.863] (-2076.926) (-2084.770) * (-2084.879) (-2076.301) [-2081.445] (-2083.394) -- 0:04:26
56800 -- [-2074.043] (-2078.080) (-2088.090) (-2079.647) * [-2076.596] (-2080.673) (-2080.105) (-2083.578) -- 0:04:25
56900 -- [-2073.198] (-2078.498) (-2083.524) (-2076.460) * [-2075.494] (-2082.774) (-2085.136) (-2086.354) -- 0:04:25
57000 -- [-2076.352] (-2072.606) (-2089.012) (-2079.057) * [-2074.570] (-2081.268) (-2081.286) (-2079.850) -- 0:04:24
Average standard deviation of split frequencies: 0.031317
57100 -- (-2079.496) [-2073.863] (-2079.433) (-2076.569) * [-2071.462] (-2084.654) (-2081.982) (-2085.637) -- 0:04:24
57200 -- (-2079.978) [-2077.866] (-2074.643) (-2076.556) * (-2082.388) (-2081.118) (-2086.904) [-2078.285] -- 0:04:23
57300 -- (-2076.005) (-2072.112) (-2076.576) [-2071.907] * [-2072.921] (-2087.677) (-2082.928) (-2077.276) -- 0:04:23
57400 -- (-2072.339) (-2073.985) [-2073.345] (-2081.673) * (-2070.252) (-2076.500) [-2077.348] (-2081.365) -- 0:04:22
57500 -- [-2072.207] (-2079.797) (-2080.904) (-2081.172) * (-2072.176) (-2084.373) [-2080.151] (-2082.402) -- 0:04:22
57600 -- (-2079.290) (-2077.892) [-2074.665] (-2089.580) * [-2076.991] (-2077.793) (-2078.724) (-2085.886) -- 0:04:21
57700 -- (-2092.751) [-2073.190] (-2072.759) (-2079.740) * (-2071.678) [-2082.596] (-2085.665) (-2088.246) -- 0:04:21
57800 -- (-2088.132) [-2076.247] (-2083.640) (-2074.334) * [-2068.484] (-2089.503) (-2074.610) (-2086.220) -- 0:04:20
57900 -- (-2084.317) (-2075.679) [-2074.489] (-2078.688) * (-2073.218) (-2089.014) [-2077.397] (-2089.367) -- 0:04:20
58000 -- (-2086.360) (-2081.439) (-2080.249) [-2076.013] * (-2072.601) (-2096.748) (-2080.321) [-2077.809] -- 0:04:19
Average standard deviation of split frequencies: 0.030814
58100 -- (-2090.411) (-2082.102) (-2073.391) [-2077.592] * (-2072.214) (-2083.475) [-2074.247] (-2082.698) -- 0:04:19
58200 -- (-2082.294) (-2082.726) [-2071.508] (-2081.675) * [-2072.159] (-2084.100) (-2076.567) (-2090.268) -- 0:04:18
58300 -- (-2071.788) (-2082.835) (-2072.093) [-2072.867] * [-2073.305] (-2080.998) (-2077.696) (-2077.019) -- 0:04:18
58400 -- (-2079.164) (-2081.841) [-2070.229] (-2078.087) * (-2073.186) [-2088.174] (-2085.729) (-2078.860) -- 0:04:17
58500 -- (-2083.417) (-2084.170) [-2073.276] (-2080.267) * (-2072.274) (-2083.637) (-2089.932) [-2071.083] -- 0:04:17
58600 -- (-2083.510) (-2076.725) [-2071.273] (-2085.390) * [-2073.220] (-2083.840) (-2081.599) (-2073.156) -- 0:04:17
58700 -- (-2082.232) (-2090.914) [-2072.976] (-2088.439) * (-2077.078) [-2082.104] (-2074.735) (-2077.961) -- 0:04:16
58800 -- [-2073.659] (-2089.128) (-2073.953) (-2089.177) * (-2076.882) (-2080.593) (-2074.482) [-2077.963] -- 0:04:16
58900 -- [-2078.193] (-2093.929) (-2079.387) (-2082.801) * [-2079.241] (-2076.643) (-2083.966) (-2076.414) -- 0:04:31
59000 -- (-2071.267) (-2097.137) [-2079.821] (-2080.092) * [-2075.937] (-2085.819) (-2078.220) (-2078.772) -- 0:04:31
Average standard deviation of split frequencies: 0.030259
59100 -- [-2070.982] (-2084.053) (-2080.298) (-2077.102) * (-2067.893) (-2076.342) (-2087.754) [-2076.476] -- 0:04:30
59200 -- [-2070.402] (-2083.049) (-2080.745) (-2078.783) * (-2075.481) (-2079.841) (-2077.355) [-2072.310] -- 0:04:30
59300 -- [-2069.403] (-2082.734) (-2090.323) (-2089.107) * (-2082.983) (-2082.481) [-2077.719] (-2074.234) -- 0:04:29
59400 -- [-2069.504] (-2080.808) (-2089.800) (-2085.298) * [-2077.221] (-2086.589) (-2087.177) (-2073.057) -- 0:04:29
59500 -- [-2071.687] (-2088.140) (-2083.760) (-2079.398) * (-2081.331) [-2078.200] (-2092.535) (-2073.564) -- 0:04:28
59600 -- (-2084.001) (-2073.412) (-2080.353) [-2072.970] * (-2083.735) (-2078.976) (-2090.452) [-2085.193] -- 0:04:28
59700 -- (-2075.181) [-2076.176] (-2080.473) (-2071.410) * (-2085.867) (-2082.238) [-2079.481] (-2079.130) -- 0:04:27
59800 -- (-2090.518) (-2074.310) (-2073.001) [-2072.205] * (-2085.426) (-2078.374) [-2074.104] (-2079.842) -- 0:04:27
59900 -- (-2084.157) (-2077.405) [-2082.870] (-2073.542) * (-2074.724) (-2083.607) [-2080.104] (-2089.636) -- 0:04:26
60000 -- (-2074.000) [-2079.340] (-2071.272) (-2083.774) * (-2079.871) [-2082.191] (-2086.361) (-2084.502) -- 0:04:26
Average standard deviation of split frequencies: 0.030461
60100 -- (-2073.315) (-2077.452) [-2071.752] (-2081.608) * (-2079.561) (-2073.902) [-2080.303] (-2090.346) -- 0:04:25
60200 -- (-2076.435) (-2078.787) [-2073.702] (-2074.528) * [-2073.913] (-2082.928) (-2084.343) (-2092.563) -- 0:04:25
60300 -- (-2082.909) (-2083.994) (-2080.598) [-2075.466] * (-2077.286) [-2076.776] (-2086.966) (-2089.426) -- 0:04:24
60400 -- (-2077.349) (-2082.639) [-2074.140] (-2076.599) * [-2076.879] (-2079.125) (-2082.140) (-2083.909) -- 0:04:24
60500 -- (-2078.762) (-2096.848) [-2076.379] (-2082.181) * (-2071.702) (-2085.332) [-2073.996] (-2076.094) -- 0:04:23
60600 -- [-2073.850] (-2089.606) (-2074.466) (-2078.357) * [-2077.843] (-2080.545) (-2080.069) (-2079.447) -- 0:04:23
60700 -- (-2075.446) (-2085.808) [-2076.884] (-2078.840) * (-2086.315) [-2078.785] (-2087.128) (-2077.663) -- 0:04:23
60800 -- (-2074.972) (-2088.310) (-2076.568) [-2080.821] * [-2069.250] (-2088.469) (-2078.364) (-2077.356) -- 0:04:22
60900 -- [-2076.618] (-2078.255) (-2084.174) (-2087.323) * (-2070.310) (-2082.202) [-2081.045] (-2083.618) -- 0:04:22
61000 -- (-2075.260) [-2079.960] (-2083.165) (-2083.905) * [-2066.853] (-2080.898) (-2082.966) (-2081.153) -- 0:04:21
Average standard deviation of split frequencies: 0.029710
61100 -- [-2072.171] (-2094.060) (-2081.715) (-2080.515) * [-2073.180] (-2078.437) (-2072.859) (-2084.399) -- 0:04:21
61200 -- (-2078.250) (-2084.662) [-2083.826] (-2081.322) * [-2069.287] (-2081.538) (-2073.904) (-2085.828) -- 0:04:20
61300 -- [-2077.126] (-2085.853) (-2081.604) (-2072.886) * [-2072.268] (-2085.042) (-2077.321) (-2089.761) -- 0:04:20
61400 -- (-2074.205) (-2082.185) (-2089.582) [-2081.957] * (-2072.329) (-2086.288) (-2079.389) [-2076.945] -- 0:04:19
61500 -- [-2073.446] (-2084.309) (-2081.815) (-2090.279) * [-2072.843] (-2088.324) (-2086.865) (-2077.995) -- 0:04:19
61600 -- (-2073.720) (-2088.164) [-2077.490] (-2077.383) * [-2071.734] (-2102.613) (-2082.428) (-2081.954) -- 0:04:18
61700 -- [-2076.724] (-2087.560) (-2080.831) (-2076.028) * [-2075.759] (-2086.999) (-2079.949) (-2079.776) -- 0:04:18
61800 -- [-2069.240] (-2100.374) (-2078.069) (-2075.263) * [-2073.985] (-2078.271) (-2073.420) (-2086.549) -- 0:04:18
61900 -- [-2067.305] (-2087.016) (-2073.891) (-2077.749) * (-2075.209) [-2081.140] (-2083.381) (-2087.099) -- 0:04:17
62000 -- (-2073.833) (-2084.835) [-2076.573] (-2078.935) * [-2074.082] (-2072.765) (-2085.172) (-2083.985) -- 0:04:17
Average standard deviation of split frequencies: 0.029264
62100 -- (-2077.686) [-2079.396] (-2081.734) (-2081.210) * (-2074.554) (-2075.904) [-2074.277] (-2083.663) -- 0:04:16
62200 -- [-2074.089] (-2077.114) (-2079.012) (-2079.696) * [-2073.354] (-2083.384) (-2076.026) (-2103.101) -- 0:04:16
62300 -- (-2077.144) [-2076.605] (-2087.296) (-2075.882) * [-2075.144] (-2093.021) (-2077.591) (-2098.682) -- 0:04:15
62400 -- (-2073.395) [-2078.405] (-2080.072) (-2083.411) * (-2072.311) (-2089.789) (-2086.279) [-2075.500] -- 0:04:15
62500 -- (-2072.307) [-2077.174] (-2084.126) (-2083.326) * [-2068.223] (-2079.141) (-2079.465) (-2084.837) -- 0:04:30
62600 -- [-2070.489] (-2075.388) (-2086.260) (-2085.475) * [-2078.114] (-2077.278) (-2078.195) (-2080.768) -- 0:04:29
62700 -- (-2077.176) (-2078.886) (-2076.216) [-2076.768] * (-2075.450) [-2075.142] (-2076.258) (-2092.443) -- 0:04:29
62800 -- [-2073.049] (-2082.441) (-2078.681) (-2079.119) * [-2074.747] (-2078.439) (-2083.062) (-2075.710) -- 0:04:28
62900 -- [-2077.038] (-2083.245) (-2083.675) (-2085.559) * (-2072.684) [-2073.982] (-2076.089) (-2078.151) -- 0:04:28
63000 -- [-2074.213] (-2082.765) (-2092.226) (-2087.015) * [-2073.358] (-2081.025) (-2078.503) (-2077.973) -- 0:04:27
Average standard deviation of split frequencies: 0.030901
63100 -- (-2073.076) [-2080.208] (-2082.557) (-2089.761) * (-2075.480) (-2077.224) (-2078.691) [-2080.262] -- 0:04:27
63200 -- (-2075.620) (-2081.934) [-2083.721] (-2089.928) * (-2077.144) (-2075.532) (-2084.963) [-2072.614] -- 0:04:26
63300 -- (-2078.480) (-2079.404) (-2082.110) [-2085.373] * (-2084.521) (-2074.014) (-2088.362) [-2074.756] -- 0:04:26
63400 -- (-2080.394) (-2077.891) [-2078.295] (-2082.641) * (-2078.847) [-2077.365] (-2101.833) (-2076.585) -- 0:04:25
63500 -- (-2090.627) [-2082.917] (-2084.156) (-2083.638) * (-2075.923) [-2077.533] (-2089.491) (-2079.740) -- 0:04:25
63600 -- (-2088.070) [-2080.392] (-2079.298) (-2084.784) * (-2068.078) [-2079.767] (-2091.854) (-2079.233) -- 0:04:25
63700 -- (-2079.951) [-2077.627] (-2089.241) (-2077.236) * [-2069.493] (-2087.231) (-2083.787) (-2082.810) -- 0:04:24
63800 -- (-2077.303) [-2080.681] (-2081.735) (-2080.329) * [-2078.868] (-2095.742) (-2079.261) (-2078.115) -- 0:04:24
63900 -- [-2075.152] (-2078.938) (-2081.030) (-2086.902) * (-2071.570) (-2087.331) (-2087.355) [-2081.114] -- 0:04:23
64000 -- [-2073.065] (-2080.686) (-2086.947) (-2079.067) * (-2072.623) [-2079.965] (-2082.928) (-2083.570) -- 0:04:23
Average standard deviation of split frequencies: 0.028771
64100 -- (-2075.783) (-2083.976) (-2090.805) [-2078.927] * (-2071.449) (-2082.753) [-2074.265] (-2079.136) -- 0:04:22
64200 -- (-2075.135) (-2081.818) (-2086.243) [-2080.638] * [-2069.302] (-2078.393) (-2071.795) (-2082.345) -- 0:04:22
64300 -- [-2076.019] (-2089.205) (-2084.991) (-2088.815) * (-2072.771) (-2076.080) [-2075.272] (-2081.904) -- 0:04:21
64400 -- [-2075.388] (-2087.866) (-2086.214) (-2082.965) * [-2081.221] (-2079.656) (-2086.916) (-2083.014) -- 0:04:21
64500 -- (-2072.641) (-2092.086) (-2089.741) [-2079.183] * [-2084.105] (-2078.357) (-2086.922) (-2085.605) -- 0:04:21
64600 -- [-2074.558] (-2081.761) (-2088.472) (-2081.150) * [-2078.443] (-2074.138) (-2082.743) (-2089.519) -- 0:04:20
64700 -- (-2074.060) [-2082.631] (-2085.830) (-2087.042) * [-2079.874] (-2075.145) (-2084.699) (-2085.568) -- 0:04:20
64800 -- (-2078.318) [-2081.890] (-2087.307) (-2077.406) * (-2075.608) [-2073.906] (-2074.827) (-2082.524) -- 0:04:19
64900 -- [-2075.473] (-2080.794) (-2093.625) (-2086.096) * (-2073.129) [-2074.747] (-2075.174) (-2081.688) -- 0:04:19
65000 -- [-2073.846] (-2074.930) (-2087.921) (-2089.515) * (-2077.405) [-2072.447] (-2075.006) (-2075.373) -- 0:04:18
Average standard deviation of split frequencies: 0.029127
65100 -- [-2074.363] (-2082.471) (-2081.939) (-2088.348) * (-2075.745) (-2079.305) [-2078.806] (-2077.785) -- 0:04:18
65200 -- [-2072.033] (-2082.558) (-2088.108) (-2091.409) * [-2076.111] (-2097.944) (-2076.447) (-2077.392) -- 0:04:18
65300 -- [-2072.921] (-2077.746) (-2082.781) (-2086.375) * [-2075.029] (-2093.798) (-2075.182) (-2077.672) -- 0:04:17
65400 -- [-2072.553] (-2076.315) (-2076.619) (-2086.016) * [-2073.924] (-2089.973) (-2074.480) (-2079.033) -- 0:04:17
65500 -- (-2074.847) (-2076.378) [-2084.954] (-2090.315) * (-2081.746) [-2073.447] (-2076.267) (-2075.295) -- 0:04:16
65600 -- [-2071.988] (-2080.403) (-2085.638) (-2086.343) * (-2084.634) (-2084.803) [-2073.178] (-2085.270) -- 0:04:16
65700 -- [-2070.069] (-2082.773) (-2090.778) (-2089.006) * (-2086.522) (-2081.679) [-2074.542] (-2078.130) -- 0:04:15
65800 -- [-2067.801] (-2091.216) (-2083.632) (-2083.287) * (-2081.720) [-2080.235] (-2073.955) (-2086.911) -- 0:04:15
65900 -- [-2069.324] (-2084.025) (-2080.556) (-2088.349) * (-2090.113) [-2078.591] (-2073.475) (-2080.734) -- 0:04:15
66000 -- [-2066.986] (-2079.235) (-2089.767) (-2086.264) * (-2084.659) (-2086.225) (-2076.198) [-2083.804] -- 0:04:14
Average standard deviation of split frequencies: 0.027698
66100 -- [-2072.235] (-2087.489) (-2075.747) (-2083.618) * (-2092.032) (-2083.966) [-2073.680] (-2081.823) -- 0:04:28
66200 -- (-2077.183) (-2084.236) [-2074.261] (-2083.143) * (-2083.391) [-2078.250] (-2083.350) (-2087.058) -- 0:04:28
66300 -- [-2075.507] (-2081.065) (-2082.893) (-2078.850) * [-2082.360] (-2080.898) (-2076.850) (-2090.693) -- 0:04:27
66400 -- (-2082.296) [-2078.424] (-2080.712) (-2081.332) * [-2078.791] (-2080.752) (-2087.079) (-2085.550) -- 0:04:27
66500 -- (-2078.157) (-2086.918) [-2077.376] (-2086.938) * (-2072.561) (-2081.906) (-2081.517) [-2077.845] -- 0:04:26
66600 -- [-2072.276] (-2079.776) (-2076.992) (-2086.718) * [-2072.400] (-2081.843) (-2084.838) (-2075.910) -- 0:04:26
66700 -- [-2069.991] (-2088.689) (-2074.277) (-2084.797) * [-2077.348] (-2084.670) (-2083.684) (-2075.342) -- 0:04:25
66800 -- [-2074.255] (-2090.537) (-2081.720) (-2084.111) * [-2072.648] (-2078.486) (-2081.419) (-2076.927) -- 0:04:25
66900 -- (-2075.864) (-2086.577) [-2073.797] (-2092.341) * (-2073.544) (-2094.652) (-2088.151) [-2074.414] -- 0:04:25
67000 -- [-2071.780] (-2086.260) (-2076.118) (-2082.960) * (-2081.682) (-2086.721) (-2084.322) [-2075.798] -- 0:04:24
Average standard deviation of split frequencies: 0.027258
67100 -- (-2072.465) [-2075.999] (-2080.801) (-2083.463) * (-2075.037) (-2084.467) [-2081.087] (-2082.633) -- 0:04:24
67200 -- (-2078.710) (-2083.700) [-2075.520] (-2082.224) * [-2074.022] (-2087.098) (-2082.600) (-2079.069) -- 0:04:23
67300 -- [-2076.563] (-2075.364) (-2081.123) (-2089.313) * (-2079.304) (-2080.460) [-2083.783] (-2081.951) -- 0:04:23
67400 -- (-2080.131) (-2079.624) [-2077.657] (-2091.155) * (-2078.263) [-2077.032] (-2083.192) (-2082.924) -- 0:04:22
67500 -- (-2083.591) [-2076.191] (-2078.844) (-2090.263) * (-2084.749) (-2079.424) (-2099.623) [-2083.409] -- 0:04:22
67600 -- (-2082.362) [-2072.760] (-2085.886) (-2080.824) * (-2076.276) (-2083.531) (-2095.070) [-2072.100] -- 0:04:22
67700 -- (-2097.425) (-2080.527) (-2084.709) [-2077.321] * [-2075.536] (-2083.526) (-2087.141) (-2077.722) -- 0:04:21
67800 -- (-2095.483) [-2078.012] (-2084.656) (-2079.781) * (-2076.538) (-2086.488) (-2075.952) [-2076.540] -- 0:04:21
67900 -- (-2078.947) [-2076.990] (-2083.557) (-2078.145) * (-2077.544) (-2078.426) [-2078.214] (-2077.140) -- 0:04:20
68000 -- (-2084.839) [-2084.321] (-2096.122) (-2083.229) * (-2080.172) (-2085.577) (-2086.016) [-2078.284] -- 0:04:20
Average standard deviation of split frequencies: 0.023919
68100 -- (-2082.245) [-2080.933] (-2084.062) (-2085.797) * (-2081.210) [-2081.871] (-2083.228) (-2072.219) -- 0:04:20
68200 -- [-2080.886] (-2080.374) (-2083.081) (-2090.976) * (-2086.310) (-2082.168) (-2084.164) [-2077.011] -- 0:04:19
68300 -- (-2085.436) [-2081.651] (-2086.034) (-2077.920) * [-2080.653] (-2083.644) (-2083.293) (-2075.312) -- 0:04:19
68400 -- (-2085.325) (-2091.958) [-2076.565] (-2079.413) * (-2084.642) (-2082.668) [-2075.230] (-2078.079) -- 0:04:18
68500 -- (-2082.674) (-2086.510) (-2091.516) [-2075.653] * (-2078.282) (-2090.592) [-2084.548] (-2081.186) -- 0:04:18
68600 -- (-2087.117) [-2076.324] (-2086.531) (-2079.746) * (-2075.392) [-2077.697] (-2075.970) (-2089.737) -- 0:04:17
68700 -- (-2088.259) [-2082.520] (-2086.406) (-2078.092) * [-2074.531] (-2075.221) (-2074.233) (-2085.649) -- 0:04:17
68800 -- (-2080.890) (-2080.001) [-2081.726] (-2088.656) * (-2080.963) (-2088.738) [-2071.635] (-2084.659) -- 0:04:17
68900 -- (-2076.087) (-2083.773) (-2081.975) [-2073.632] * (-2075.662) (-2080.385) (-2074.817) [-2077.601] -- 0:04:16
69000 -- (-2081.379) (-2091.011) (-2078.500) [-2075.227] * (-2076.196) [-2078.822] (-2078.757) (-2075.934) -- 0:04:16
Average standard deviation of split frequencies: 0.023940
69100 -- (-2080.151) (-2098.822) (-2084.997) [-2072.018] * (-2071.637) [-2080.419] (-2084.516) (-2079.121) -- 0:04:15
69200 -- (-2082.459) (-2095.963) [-2083.631] (-2084.112) * (-2075.008) [-2074.312] (-2090.118) (-2080.984) -- 0:04:15
69300 -- (-2079.197) (-2095.956) (-2076.098) [-2078.491] * (-2079.703) [-2079.720] (-2082.496) (-2079.930) -- 0:04:15
69400 -- (-2079.116) (-2089.658) (-2075.507) [-2075.371] * (-2075.143) (-2079.613) (-2082.667) [-2077.348] -- 0:04:14
69500 -- (-2089.424) (-2091.929) [-2080.822] (-2078.614) * (-2073.951) (-2092.327) (-2080.758) [-2076.681] -- 0:04:14
69600 -- [-2076.872] (-2086.297) (-2077.977) (-2079.562) * (-2076.482) [-2077.332] (-2080.880) (-2076.008) -- 0:04:27
69700 -- [-2077.391] (-2088.485) (-2078.105) (-2084.245) * (-2088.233) [-2075.370] (-2076.842) (-2080.307) -- 0:04:26
69800 -- (-2082.426) (-2084.674) (-2083.093) [-2075.769] * (-2080.453) (-2085.873) [-2078.868] (-2083.541) -- 0:04:26
69900 -- (-2073.947) (-2083.081) [-2075.252] (-2077.026) * (-2078.812) [-2085.267] (-2081.317) (-2082.004) -- 0:04:26
70000 -- [-2081.204] (-2079.713) (-2081.122) (-2075.547) * (-2084.392) (-2081.270) (-2076.675) [-2077.755] -- 0:04:25
Average standard deviation of split frequencies: 0.023045
70100 -- (-2084.984) [-2079.118] (-2079.496) (-2081.006) * (-2075.546) (-2077.749) [-2073.292] (-2088.964) -- 0:04:25
70200 -- [-2076.549] (-2076.625) (-2075.932) (-2085.515) * [-2078.205] (-2087.147) (-2082.540) (-2090.309) -- 0:04:24
70300 -- (-2083.866) [-2077.803] (-2073.705) (-2077.809) * (-2091.158) (-2088.367) [-2085.817] (-2079.178) -- 0:04:24
70400 -- (-2076.663) (-2075.816) (-2080.547) [-2077.686] * [-2078.989] (-2085.448) (-2080.681) (-2078.512) -- 0:04:24
70500 -- [-2073.131] (-2077.286) (-2078.967) (-2082.544) * (-2074.780) (-2077.092) [-2079.428] (-2080.468) -- 0:04:23
70600 -- [-2076.794] (-2077.668) (-2077.757) (-2079.980) * (-2079.686) [-2075.690] (-2080.044) (-2084.939) -- 0:04:23
70700 -- (-2076.506) (-2076.286) [-2084.473] (-2081.187) * (-2084.387) (-2076.354) [-2077.957] (-2085.418) -- 0:04:22
70800 -- (-2080.180) [-2076.351] (-2086.800) (-2083.251) * [-2075.803] (-2075.352) (-2082.481) (-2084.077) -- 0:04:22
70900 -- [-2075.025] (-2088.699) (-2089.618) (-2083.748) * (-2079.802) (-2076.696) [-2075.641] (-2085.372) -- 0:04:22
71000 -- [-2076.673] (-2079.076) (-2080.041) (-2085.225) * [-2072.726] (-2084.748) (-2076.729) (-2086.077) -- 0:04:21
Average standard deviation of split frequencies: 0.022511
71100 -- [-2080.232] (-2080.939) (-2080.625) (-2094.599) * (-2081.797) (-2077.786) [-2076.536] (-2075.442) -- 0:04:21
71200 -- [-2083.389] (-2081.836) (-2080.789) (-2087.768) * (-2081.948) (-2087.754) [-2077.348] (-2073.525) -- 0:04:20
71300 -- [-2079.356] (-2075.511) (-2089.937) (-2081.215) * (-2072.374) (-2084.613) (-2080.869) [-2074.832] -- 0:04:20
71400 -- [-2078.355] (-2078.666) (-2083.992) (-2080.863) * [-2070.099] (-2087.953) (-2087.694) (-2072.618) -- 0:04:20
71500 -- [-2075.053] (-2091.595) (-2092.180) (-2086.674) * [-2072.284] (-2078.590) (-2087.353) (-2083.625) -- 0:04:19
71600 -- [-2077.851] (-2081.101) (-2081.588) (-2081.632) * [-2072.035] (-2088.408) (-2090.812) (-2074.531) -- 0:04:19
71700 -- (-2073.230) [-2075.649] (-2079.805) (-2082.391) * (-2073.981) (-2079.338) (-2097.097) [-2074.724] -- 0:04:18
71800 -- (-2080.747) (-2078.580) [-2074.660] (-2077.690) * (-2078.739) [-2076.277] (-2077.337) (-2075.782) -- 0:04:18
71900 -- (-2080.828) (-2074.212) (-2087.712) [-2078.124] * (-2079.078) [-2074.926] (-2093.692) (-2077.179) -- 0:04:18
72000 -- [-2076.542] (-2083.383) (-2081.501) (-2080.031) * (-2080.550) [-2076.690] (-2090.384) (-2077.932) -- 0:04:17
Average standard deviation of split frequencies: 0.021846
72100 -- [-2076.526] (-2074.257) (-2080.029) (-2078.781) * (-2080.579) [-2073.671] (-2082.167) (-2079.489) -- 0:04:17
72200 -- (-2081.266) (-2088.204) [-2083.195] (-2081.764) * (-2082.659) [-2071.918] (-2089.149) (-2080.528) -- 0:04:17
72300 -- (-2077.578) (-2084.377) (-2081.809) [-2077.104] * (-2077.330) [-2075.847] (-2085.485) (-2090.026) -- 0:04:16
72400 -- (-2075.059) (-2087.050) (-2089.478) [-2072.784] * (-2083.543) (-2081.431) [-2074.141] (-2079.948) -- 0:04:16
72500 -- (-2087.078) (-2086.112) [-2078.314] (-2084.506) * (-2082.481) (-2081.280) [-2074.060] (-2074.477) -- 0:04:15
72600 -- [-2086.194] (-2092.882) (-2074.733) (-2077.201) * (-2089.647) (-2082.776) (-2076.147) [-2074.077] -- 0:04:15
72700 -- (-2076.844) (-2092.361) (-2080.608) [-2083.265] * (-2079.340) [-2074.072] (-2085.774) (-2076.033) -- 0:04:15
72800 -- (-2079.930) (-2082.836) [-2082.576] (-2079.220) * (-2079.213) (-2079.108) (-2080.694) [-2077.476] -- 0:04:14
72900 -- (-2090.606) (-2092.878) (-2079.851) [-2079.139] * (-2081.709) (-2075.994) (-2086.238) [-2072.442] -- 0:04:14
73000 -- (-2080.249) (-2091.297) (-2080.875) [-2075.564] * (-2089.296) (-2076.238) (-2080.851) [-2074.791] -- 0:04:13
Average standard deviation of split frequencies: 0.022448
73100 -- (-2080.839) (-2092.483) (-2085.171) [-2079.089] * (-2088.885) [-2079.195] (-2083.532) (-2075.770) -- 0:04:13
73200 -- [-2076.105] (-2083.811) (-2081.362) (-2083.626) * (-2089.568) (-2077.882) (-2083.151) [-2076.527] -- 0:04:25
73300 -- [-2074.965] (-2080.912) (-2075.181) (-2082.086) * [-2072.133] (-2086.176) (-2085.771) (-2072.232) -- 0:04:25
73400 -- (-2077.484) (-2083.527) [-2074.911] (-2075.876) * (-2069.336) (-2085.512) (-2080.062) [-2078.047] -- 0:04:25
73500 -- (-2082.380) (-2082.637) (-2073.440) [-2076.325] * [-2065.330] (-2074.512) (-2082.927) (-2080.204) -- 0:04:24
73600 -- (-2075.017) (-2082.381) (-2086.507) [-2077.556] * [-2067.487] (-2075.653) (-2083.103) (-2089.449) -- 0:04:24
73700 -- (-2075.659) (-2080.065) (-2094.461) [-2076.076] * [-2070.059] (-2077.572) (-2085.787) (-2087.973) -- 0:04:23
73800 -- [-2074.586] (-2088.956) (-2084.199) (-2074.943) * (-2077.925) [-2075.272] (-2083.481) (-2084.584) -- 0:04:23
73900 -- [-2075.019] (-2076.056) (-2087.426) (-2077.391) * (-2067.637) (-2079.369) (-2093.193) [-2079.840] -- 0:04:23
74000 -- (-2077.500) (-2080.884) (-2081.951) [-2076.255] * [-2074.829] (-2082.125) (-2079.498) (-2079.381) -- 0:04:22
Average standard deviation of split frequencies: 0.020530
74100 -- (-2082.184) (-2082.855) (-2078.362) [-2073.477] * [-2080.061] (-2076.903) (-2083.299) (-2079.999) -- 0:04:22
74200 -- (-2081.038) (-2076.168) (-2079.026) [-2082.026] * (-2077.058) [-2079.347] (-2088.797) (-2085.726) -- 0:04:22
74300 -- (-2077.076) [-2074.351] (-2088.826) (-2080.725) * (-2072.271) [-2074.629] (-2081.662) (-2084.234) -- 0:04:21
74400 -- (-2080.756) (-2077.262) (-2078.330) [-2080.503] * [-2075.217] (-2084.278) (-2082.144) (-2076.888) -- 0:04:21
74500 -- (-2084.251) [-2073.156] (-2075.160) (-2081.352) * (-2072.557) (-2084.706) [-2078.400] (-2082.166) -- 0:04:20
74600 -- (-2081.935) (-2076.093) (-2075.679) [-2075.369] * (-2073.344) (-2079.187) [-2075.233] (-2085.063) -- 0:04:20
74700 -- (-2083.994) [-2070.754] (-2078.815) (-2074.835) * [-2072.877] (-2087.056) (-2083.151) (-2082.677) -- 0:04:20
74800 -- (-2087.084) [-2074.547] (-2083.243) (-2078.221) * (-2077.275) (-2085.764) [-2078.280] (-2082.546) -- 0:04:19
74900 -- (-2080.675) [-2081.719] (-2086.849) (-2080.044) * (-2089.678) (-2085.300) [-2083.287] (-2088.304) -- 0:04:19
75000 -- (-2092.899) [-2082.174] (-2087.324) (-2081.506) * [-2074.219] (-2094.113) (-2073.074) (-2082.808) -- 0:04:19
Average standard deviation of split frequencies: 0.020418
75100 -- [-2080.597] (-2084.278) (-2086.694) (-2076.816) * (-2089.197) (-2083.585) [-2074.104] (-2097.973) -- 0:04:18
75200 -- (-2087.468) (-2085.981) (-2080.015) [-2075.687] * (-2093.157) [-2080.746] (-2082.584) (-2087.482) -- 0:04:18
75300 -- (-2083.426) (-2081.858) [-2078.385] (-2075.124) * (-2080.994) [-2086.675] (-2082.848) (-2091.265) -- 0:04:17
75400 -- (-2082.721) (-2083.784) (-2081.059) [-2080.695] * [-2075.711] (-2078.304) (-2074.941) (-2087.463) -- 0:04:17
75500 -- [-2075.733] (-2078.817) (-2082.047) (-2087.930) * [-2075.809] (-2081.357) (-2074.029) (-2089.467) -- 0:04:17
75600 -- [-2075.630] (-2078.748) (-2077.602) (-2093.733) * [-2069.100] (-2079.813) (-2069.159) (-2089.327) -- 0:04:16
75700 -- (-2077.373) (-2079.621) [-2076.759] (-2093.181) * [-2070.017] (-2075.245) (-2073.251) (-2081.793) -- 0:04:16
75800 -- (-2087.482) (-2080.637) [-2076.165] (-2081.517) * [-2076.875] (-2077.987) (-2078.749) (-2089.129) -- 0:04:16
75900 -- [-2074.782] (-2086.247) (-2072.811) (-2079.227) * (-2084.001) (-2077.870) [-2076.265] (-2080.665) -- 0:04:15
76000 -- [-2079.885] (-2083.374) (-2076.700) (-2078.063) * [-2073.779] (-2079.960) (-2088.020) (-2089.970) -- 0:04:15
Average standard deviation of split frequencies: 0.021406
76100 -- (-2084.651) (-2090.469) (-2086.254) [-2080.757] * [-2072.098] (-2080.767) (-2084.185) (-2080.951) -- 0:04:14
76200 -- (-2077.672) (-2084.726) (-2081.924) [-2079.139] * (-2078.027) [-2076.028] (-2087.918) (-2082.729) -- 0:04:14
76300 -- [-2079.374] (-2091.853) (-2087.391) (-2074.703) * (-2073.126) (-2085.671) (-2086.205) [-2080.263] -- 0:04:14
76400 -- (-2071.002) [-2086.699] (-2093.051) (-2077.749) * (-2072.653) [-2077.014] (-2084.839) (-2081.469) -- 0:04:13
76500 -- (-2075.765) (-2081.769) [-2085.407] (-2076.203) * [-2074.083] (-2083.067) (-2091.875) (-2078.652) -- 0:04:13
76600 -- (-2080.056) (-2083.358) (-2079.710) [-2074.778] * [-2073.994] (-2083.507) (-2085.101) (-2080.128) -- 0:04:13
76700 -- (-2085.580) (-2081.806) (-2078.749) [-2073.298] * [-2072.137] (-2089.016) (-2084.102) (-2076.911) -- 0:04:12
76800 -- [-2077.478] (-2078.654) (-2073.959) (-2080.230) * (-2073.090) [-2080.810] (-2083.626) (-2077.974) -- 0:04:24
76900 -- (-2070.460) [-2080.642] (-2076.816) (-2079.439) * [-2070.405] (-2077.275) (-2079.531) (-2076.089) -- 0:04:24
77000 -- (-2081.076) (-2085.620) [-2073.253] (-2078.526) * [-2069.997] (-2083.137) (-2079.660) (-2080.363) -- 0:04:23
Average standard deviation of split frequencies: 0.021110
77100 -- [-2070.662] (-2079.048) (-2074.588) (-2077.110) * [-2079.864] (-2078.840) (-2074.463) (-2084.032) -- 0:04:23
77200 -- (-2078.420) (-2084.496) [-2074.813] (-2076.561) * (-2080.060) (-2085.575) [-2074.092] (-2089.009) -- 0:04:22
77300 -- [-2068.083] (-2084.465) (-2072.821) (-2075.329) * [-2075.043] (-2080.785) (-2074.834) (-2085.956) -- 0:04:22
77400 -- [-2072.637] (-2080.210) (-2076.228) (-2077.629) * (-2076.343) [-2078.608] (-2076.783) (-2094.639) -- 0:04:22
77500 -- [-2077.107] (-2074.366) (-2081.061) (-2086.238) * [-2069.606] (-2077.890) (-2080.767) (-2080.396) -- 0:04:21
77600 -- (-2070.676) (-2080.326) (-2080.915) [-2074.755] * [-2071.157] (-2078.064) (-2088.078) (-2080.620) -- 0:04:21
77700 -- (-2074.165) (-2075.865) [-2081.502] (-2076.115) * [-2070.597] (-2089.717) (-2087.349) (-2084.869) -- 0:04:21
77800 -- (-2090.283) (-2077.772) (-2085.401) [-2081.900] * [-2074.535] (-2079.003) (-2081.520) (-2090.382) -- 0:04:20
77900 -- (-2085.903) [-2074.937] (-2081.694) (-2093.249) * [-2076.411] (-2085.260) (-2079.869) (-2092.525) -- 0:04:20
78000 -- [-2080.786] (-2078.291) (-2081.570) (-2077.379) * [-2073.277] (-2087.747) (-2081.367) (-2079.998) -- 0:04:20
Average standard deviation of split frequencies: 0.020686
78100 -- [-2071.455] (-2078.345) (-2077.814) (-2090.663) * (-2076.225) (-2083.428) (-2081.961) [-2073.806] -- 0:04:19
78200 -- (-2080.977) (-2076.494) [-2076.394] (-2084.254) * (-2083.715) (-2079.710) [-2078.875] (-2077.760) -- 0:04:19
78300 -- (-2082.925) (-2078.989) [-2074.252] (-2087.206) * (-2088.934) (-2089.345) (-2087.839) [-2079.361] -- 0:04:18
78400 -- (-2081.829) (-2077.112) (-2081.177) [-2082.955] * (-2079.227) (-2103.856) (-2082.891) [-2077.258] -- 0:04:18
78500 -- (-2079.835) (-2075.738) [-2078.086] (-2086.892) * (-2082.799) (-2089.186) (-2079.782) [-2076.184] -- 0:04:18
78600 -- [-2080.955] (-2077.031) (-2091.122) (-2084.564) * (-2077.156) (-2090.776) (-2077.582) [-2075.640] -- 0:04:17
78700 -- [-2073.287] (-2078.621) (-2090.425) (-2084.146) * [-2081.430] (-2085.075) (-2074.024) (-2080.098) -- 0:04:17
78800 -- (-2076.455) [-2078.098] (-2091.858) (-2080.315) * (-2087.474) (-2085.964) [-2075.743] (-2082.355) -- 0:04:17
78900 -- (-2075.187) (-2083.213) (-2097.957) [-2074.755] * (-2086.457) (-2087.822) (-2073.541) [-2075.532] -- 0:04:16
79000 -- (-2073.715) (-2086.215) (-2092.252) [-2075.871] * (-2079.536) (-2077.745) (-2073.461) [-2072.848] -- 0:04:16
Average standard deviation of split frequencies: 0.022788
79100 -- (-2077.128) (-2085.781) (-2101.506) [-2074.284] * (-2071.368) (-2090.617) [-2073.048] (-2076.692) -- 0:04:16
79200 -- (-2081.026) [-2084.958] (-2089.766) (-2076.150) * [-2074.205] (-2088.069) (-2071.102) (-2073.752) -- 0:04:15
79300 -- (-2079.602) (-2080.887) [-2079.991] (-2085.316) * (-2073.023) (-2082.482) (-2074.925) [-2075.309] -- 0:04:15
79400 -- (-2078.452) (-2089.593) [-2075.244] (-2085.688) * (-2075.268) (-2075.202) (-2072.802) [-2075.250] -- 0:04:15
79500 -- [-2075.124] (-2088.175) (-2077.725) (-2081.806) * [-2073.225] (-2086.384) (-2076.860) (-2074.181) -- 0:04:14
79600 -- [-2073.513] (-2085.870) (-2078.910) (-2085.370) * [-2069.417] (-2086.931) (-2080.150) (-2075.498) -- 0:04:14
79700 -- [-2078.614] (-2082.983) (-2081.690) (-2083.609) * (-2072.003) [-2076.012] (-2084.947) (-2079.888) -- 0:04:14
79800 -- (-2079.981) (-2087.091) (-2081.088) [-2079.945] * [-2070.656] (-2080.777) (-2092.061) (-2079.263) -- 0:04:13
79900 -- [-2071.539] (-2082.689) (-2083.156) (-2077.371) * [-2066.314] (-2075.176) (-2079.153) (-2074.967) -- 0:04:13
80000 -- [-2074.765] (-2085.448) (-2087.332) (-2074.711) * [-2072.192] (-2074.918) (-2085.528) (-2075.348) -- 0:04:13
Average standard deviation of split frequencies: 0.024035
80100 -- (-2078.658) (-2083.664) (-2089.239) [-2075.922] * (-2074.971) (-2081.179) (-2078.120) [-2075.554] -- 0:04:12
80200 -- (-2073.607) (-2080.977) (-2090.756) [-2078.433] * [-2071.298] (-2084.214) (-2088.555) (-2079.941) -- 0:04:12
80300 -- [-2073.229] (-2078.741) (-2083.061) (-2076.785) * [-2069.425] (-2088.332) (-2080.941) (-2084.874) -- 0:04:11
80400 -- (-2073.819) [-2084.721] (-2080.671) (-2080.312) * [-2074.627] (-2087.781) (-2086.648) (-2078.896) -- 0:04:23
80500 -- [-2071.311] (-2086.537) (-2078.706) (-2082.636) * (-2072.375) (-2076.180) [-2076.536] (-2080.001) -- 0:04:22
80600 -- [-2073.865] (-2083.792) (-2080.004) (-2074.486) * [-2075.365] (-2076.505) (-2083.585) (-2080.462) -- 0:04:22
80700 -- [-2068.533] (-2084.117) (-2080.833) (-2076.339) * (-2079.892) [-2074.786] (-2081.143) (-2077.871) -- 0:04:22
80800 -- (-2072.638) (-2086.737) (-2077.685) [-2079.608] * (-2078.762) (-2082.898) (-2090.429) [-2076.626] -- 0:04:21
80900 -- [-2069.792] (-2081.492) (-2082.566) (-2082.809) * (-2080.114) (-2080.388) (-2081.719) [-2073.741] -- 0:04:21
81000 -- [-2068.408] (-2086.069) (-2090.724) (-2080.028) * (-2082.082) (-2081.458) (-2089.402) [-2078.580] -- 0:04:20
Average standard deviation of split frequencies: 0.022558
81100 -- [-2066.233] (-2087.105) (-2085.915) (-2075.675) * (-2077.525) (-2095.443) (-2083.453) [-2071.926] -- 0:04:20
81200 -- (-2070.323) (-2081.954) [-2077.404] (-2089.059) * [-2071.637] (-2079.110) (-2074.965) (-2083.859) -- 0:04:20
81300 -- [-2068.826] (-2080.184) (-2081.286) (-2079.033) * [-2068.305] (-2080.921) (-2085.852) (-2078.245) -- 0:04:19
81400 -- [-2069.516] (-2082.957) (-2076.245) (-2077.059) * (-2071.525) (-2085.539) [-2089.016] (-2089.983) -- 0:04:19
81500 -- (-2076.402) (-2083.561) (-2074.314) [-2073.999] * (-2075.825) [-2078.413] (-2089.440) (-2091.817) -- 0:04:19
81600 -- [-2078.008] (-2091.804) (-2080.545) (-2077.227) * (-2077.185) (-2082.650) [-2074.815] (-2080.989) -- 0:04:18
81700 -- (-2078.844) (-2089.491) (-2082.394) [-2076.957] * [-2073.112] (-2082.087) (-2075.840) (-2079.786) -- 0:04:18
81800 -- (-2077.135) (-2082.231) (-2086.437) [-2077.863] * [-2070.736] (-2085.096) (-2079.284) (-2080.313) -- 0:04:18
81900 -- (-2075.488) (-2082.632) (-2076.998) [-2080.920] * [-2071.117] (-2086.887) (-2091.172) (-2080.769) -- 0:04:17
82000 -- (-2078.224) (-2081.356) [-2080.986] (-2084.034) * [-2071.144] (-2089.900) (-2093.406) (-2075.568) -- 0:04:17
Average standard deviation of split frequencies: 0.023450
82100 -- (-2084.872) [-2078.519] (-2074.970) (-2082.542) * [-2071.977] (-2091.565) (-2095.122) (-2078.600) -- 0:04:17
82200 -- (-2072.443) (-2080.121) [-2077.859] (-2081.347) * (-2073.705) (-2084.089) (-2091.409) [-2073.187] -- 0:04:16
82300 -- (-2077.352) [-2080.213] (-2087.605) (-2086.939) * (-2073.464) (-2084.815) (-2091.333) [-2075.844] -- 0:04:16
82400 -- [-2075.557] (-2085.282) (-2097.095) (-2083.246) * [-2075.642] (-2076.632) (-2085.944) (-2077.370) -- 0:04:16
82500 -- (-2073.916) [-2076.617] (-2086.419) (-2086.195) * (-2078.660) [-2072.773] (-2079.177) (-2085.840) -- 0:04:15
82600 -- [-2075.188] (-2090.053) (-2087.898) (-2087.475) * (-2074.315) (-2084.140) (-2085.867) [-2075.496] -- 0:04:15
82700 -- [-2076.820] (-2085.627) (-2090.702) (-2080.379) * (-2077.067) (-2089.686) (-2082.557) [-2084.806] -- 0:04:15
82800 -- [-2069.520] (-2082.888) (-2090.245) (-2075.909) * [-2068.845] (-2075.181) (-2083.303) (-2080.545) -- 0:04:14
82900 -- (-2070.546) (-2088.328) (-2086.288) [-2075.591] * [-2070.752] (-2075.015) (-2079.935) (-2075.622) -- 0:04:14
83000 -- [-2067.629] (-2077.862) (-2079.961) (-2074.791) * (-2077.398) [-2078.575] (-2082.999) (-2074.987) -- 0:04:14
Average standard deviation of split frequencies: 0.022664
83100 -- [-2070.515] (-2075.216) (-2079.834) (-2076.705) * [-2070.721] (-2081.594) (-2086.162) (-2083.482) -- 0:04:13
83200 -- [-2071.413] (-2081.088) (-2081.627) (-2086.709) * [-2071.816] (-2088.765) (-2085.111) (-2081.485) -- 0:04:13
83300 -- [-2074.459] (-2083.777) (-2081.416) (-2094.076) * [-2069.845] (-2084.274) (-2082.829) (-2078.602) -- 0:04:13
83400 -- [-2075.525] (-2079.830) (-2082.617) (-2081.816) * (-2071.969) (-2084.115) (-2096.050) [-2080.833] -- 0:04:12
83500 -- [-2070.177] (-2086.724) (-2081.641) (-2079.485) * [-2072.879] (-2081.357) (-2090.858) (-2076.907) -- 0:04:12
83600 -- [-2069.733] (-2078.003) (-2080.932) (-2083.653) * [-2073.701] (-2079.773) (-2087.666) (-2084.651) -- 0:04:12
83700 -- (-2070.234) (-2087.139) [-2077.712] (-2093.967) * [-2073.325] (-2077.579) (-2087.816) (-2089.741) -- 0:04:11
83800 -- (-2070.530) (-2091.127) [-2076.038] (-2077.904) * [-2070.329] (-2078.890) (-2077.808) (-2085.518) -- 0:04:11
83900 -- [-2072.825] (-2087.840) (-2080.541) (-2082.866) * [-2070.713] (-2084.808) (-2081.281) (-2083.771) -- 0:04:11
84000 -- [-2079.220] (-2088.693) (-2086.162) (-2080.792) * (-2071.537) (-2089.876) (-2084.213) [-2078.165] -- 0:04:21
Average standard deviation of split frequencies: 0.022572
84100 -- (-2072.606) [-2079.574] (-2084.886) (-2080.023) * [-2073.395] (-2083.686) (-2090.566) (-2077.090) -- 0:04:21
84200 -- (-2076.778) (-2081.633) (-2090.456) [-2075.284] * [-2070.837] (-2078.800) (-2084.205) (-2083.734) -- 0:04:21
84300 -- (-2075.340) [-2077.218] (-2078.426) (-2076.200) * (-2072.775) (-2073.554) [-2079.243] (-2081.848) -- 0:04:20
84400 -- (-2070.870) (-2099.759) [-2079.192] (-2085.704) * [-2069.710] (-2074.845) (-2081.447) (-2091.753) -- 0:04:20
84500 -- [-2069.836] (-2100.118) (-2076.940) (-2077.345) * (-2070.088) [-2073.905] (-2079.239) (-2095.336) -- 0:04:20
84600 -- [-2071.722] (-2093.611) (-2083.700) (-2079.388) * [-2067.077] (-2076.114) (-2078.231) (-2081.121) -- 0:04:19
84700 -- [-2070.916] (-2089.451) (-2086.467) (-2078.340) * (-2074.668) (-2075.140) [-2077.758] (-2082.642) -- 0:04:19
84800 -- [-2069.200] (-2085.834) (-2086.054) (-2074.402) * [-2067.317] (-2076.552) (-2077.271) (-2090.427) -- 0:04:19
84900 -- [-2070.195] (-2080.759) (-2086.478) (-2080.065) * [-2069.838] (-2079.146) (-2077.075) (-2080.159) -- 0:04:18
85000 -- [-2077.005] (-2079.151) (-2085.840) (-2075.265) * [-2070.430] (-2073.275) (-2074.131) (-2074.946) -- 0:04:18
Average standard deviation of split frequencies: 0.021341
85100 -- [-2073.373] (-2090.288) (-2087.348) (-2088.425) * (-2070.674) (-2074.782) [-2073.559] (-2076.112) -- 0:04:18
85200 -- [-2072.371] (-2084.856) (-2086.691) (-2081.398) * [-2069.747] (-2080.256) (-2080.239) (-2079.388) -- 0:04:17
85300 -- (-2087.398) (-2086.998) [-2082.779] (-2077.816) * [-2071.273] (-2082.955) (-2081.286) (-2074.567) -- 0:04:17
85400 -- (-2075.698) (-2081.940) (-2089.397) [-2080.010] * (-2073.005) (-2085.328) [-2076.716] (-2087.800) -- 0:04:17
85500 -- (-2079.168) [-2078.712] (-2098.625) (-2083.470) * [-2074.630] (-2075.843) (-2081.070) (-2077.427) -- 0:04:16
85600 -- [-2074.721] (-2079.741) (-2092.635) (-2083.041) * [-2074.259] (-2079.812) (-2082.774) (-2074.177) -- 0:04:16
85700 -- [-2074.246] (-2083.362) (-2089.711) (-2079.021) * [-2070.263] (-2080.713) (-2079.048) (-2073.811) -- 0:04:16
85800 -- (-2089.138) (-2082.130) [-2088.056] (-2074.588) * (-2070.281) [-2084.083] (-2078.390) (-2078.045) -- 0:04:15
85900 -- (-2085.564) [-2078.757] (-2081.317) (-2072.323) * (-2068.573) (-2083.086) (-2085.241) [-2074.163] -- 0:04:15
86000 -- (-2080.346) (-2074.173) (-2086.879) [-2075.392] * [-2070.191] (-2083.411) (-2084.142) (-2079.049) -- 0:04:15
Average standard deviation of split frequencies: 0.020015
86100 -- (-2087.557) [-2075.308] (-2076.291) (-2073.926) * (-2073.806) [-2076.614] (-2082.801) (-2084.299) -- 0:04:14
86200 -- [-2077.555] (-2081.183) (-2078.782) (-2072.060) * [-2071.226] (-2079.538) (-2082.806) (-2076.148) -- 0:04:14
86300 -- (-2081.999) [-2078.260] (-2080.365) (-2074.470) * (-2069.162) [-2076.734] (-2087.632) (-2090.361) -- 0:04:14
86400 -- (-2082.915) (-2077.769) (-2077.260) [-2073.447] * [-2067.312] (-2078.581) (-2084.280) (-2092.821) -- 0:04:13
86500 -- (-2080.893) (-2077.469) [-2076.559] (-2074.532) * [-2074.336] (-2077.045) (-2083.804) (-2085.910) -- 0:04:13
86600 -- [-2077.641] (-2075.578) (-2078.891) (-2082.853) * [-2072.141] (-2078.821) (-2083.851) (-2085.849) -- 0:04:13
86700 -- (-2079.954) (-2086.524) (-2092.004) [-2088.262] * [-2071.223] (-2078.772) (-2078.309) (-2094.757) -- 0:04:12
86800 -- (-2074.798) (-2086.349) (-2085.010) [-2077.951] * [-2069.540] (-2088.363) (-2079.486) (-2085.058) -- 0:04:12
86900 -- [-2075.770] (-2079.612) (-2081.361) (-2076.218) * [-2080.836] (-2082.325) (-2080.982) (-2082.918) -- 0:04:12
87000 -- (-2085.326) (-2076.544) (-2090.845) [-2075.381] * (-2083.493) (-2080.742) (-2084.944) [-2081.504] -- 0:04:11
Average standard deviation of split frequencies: 0.021315
87100 -- [-2071.509] (-2080.297) (-2088.378) (-2073.698) * [-2076.810] (-2089.139) (-2088.415) (-2080.785) -- 0:04:11
87200 -- [-2074.693] (-2078.673) (-2086.250) (-2077.773) * [-2073.326] (-2082.583) (-2083.042) (-2078.209) -- 0:04:11
87300 -- (-2075.036) (-2078.878) (-2093.404) [-2075.225] * [-2075.365] (-2083.429) (-2082.277) (-2075.349) -- 0:04:10
87400 -- (-2082.795) (-2084.137) (-2091.246) [-2074.385] * (-2075.590) [-2075.918] (-2087.234) (-2082.387) -- 0:04:10
87500 -- (-2080.632) (-2082.251) (-2078.283) [-2081.842] * [-2074.635] (-2076.486) (-2075.309) (-2078.019) -- 0:04:20
87600 -- [-2070.960] (-2081.646) (-2079.228) (-2082.075) * (-2075.549) [-2074.818] (-2087.384) (-2077.338) -- 0:04:20
87700 -- [-2071.733] (-2083.105) (-2090.262) (-2087.256) * [-2069.776] (-2079.265) (-2082.055) (-2079.768) -- 0:04:20
87800 -- [-2072.829] (-2078.283) (-2082.316) (-2081.113) * [-2068.768] (-2077.650) (-2078.450) (-2079.628) -- 0:04:19
87900 -- [-2072.359] (-2080.220) (-2080.732) (-2084.923) * [-2068.483] (-2090.011) (-2080.622) (-2090.478) -- 0:04:19
88000 -- (-2073.298) [-2077.499] (-2091.049) (-2078.102) * (-2068.359) (-2099.175) [-2077.897] (-2085.421) -- 0:04:19
Average standard deviation of split frequencies: 0.018797
88100 -- (-2069.989) (-2084.554) (-2084.121) [-2074.740] * [-2071.472] (-2100.517) (-2091.004) (-2077.672) -- 0:04:18
88200 -- (-2071.558) (-2077.184) [-2077.775] (-2077.653) * [-2075.261] (-2082.158) (-2079.482) (-2087.008) -- 0:04:18
88300 -- [-2070.752] (-2079.101) (-2082.059) (-2074.033) * [-2075.911] (-2086.415) (-2075.393) (-2089.335) -- 0:04:18
88400 -- [-2069.071] (-2077.929) (-2081.873) (-2075.271) * (-2075.384) (-2086.589) [-2077.996] (-2080.687) -- 0:04:17
88500 -- (-2073.988) (-2080.027) (-2081.005) [-2074.828] * (-2073.191) (-2082.080) [-2073.423] (-2081.628) -- 0:04:17
88600 -- (-2081.024) (-2082.483) [-2079.330] (-2070.647) * [-2070.662] (-2083.547) (-2074.358) (-2081.387) -- 0:04:17
88700 -- (-2079.078) [-2073.405] (-2081.114) (-2072.456) * (-2071.140) (-2078.441) [-2082.297] (-2084.810) -- 0:04:16
88800 -- (-2079.821) [-2079.351] (-2088.847) (-2069.254) * (-2072.321) [-2076.595] (-2079.573) (-2081.872) -- 0:04:16
88900 -- [-2075.275] (-2081.794) (-2079.992) (-2075.388) * (-2080.943) [-2081.302] (-2079.978) (-2086.197) -- 0:04:16
89000 -- [-2069.306] (-2082.808) (-2080.616) (-2078.812) * (-2071.191) [-2078.260] (-2076.571) (-2077.270) -- 0:04:15
Average standard deviation of split frequencies: 0.017213
89100 -- (-2074.771) (-2083.536) (-2090.936) [-2068.730] * (-2078.992) [-2073.464] (-2080.317) (-2078.976) -- 0:04:15
89200 -- [-2074.347] (-2077.738) (-2084.518) (-2082.661) * [-2067.928] (-2074.692) (-2086.310) (-2078.571) -- 0:04:15
89300 -- (-2076.929) [-2077.368] (-2083.040) (-2084.036) * [-2071.352] (-2081.818) (-2080.543) (-2075.967) -- 0:04:14
89400 -- [-2073.628] (-2083.813) (-2077.576) (-2074.953) * [-2071.595] (-2076.137) (-2084.873) (-2076.111) -- 0:04:14
89500 -- (-2079.831) (-2079.152) [-2082.187] (-2083.206) * (-2079.305) (-2077.564) (-2094.320) [-2075.207] -- 0:04:14
89600 -- [-2071.182] (-2084.111) (-2081.615) (-2085.199) * (-2090.554) (-2078.214) (-2083.542) [-2074.674] -- 0:04:14
89700 -- (-2077.534) (-2077.835) [-2070.405] (-2075.369) * (-2080.708) [-2071.187] (-2083.587) (-2073.773) -- 0:04:13
89800 -- (-2073.515) (-2080.435) (-2078.982) [-2075.517] * (-2087.522) [-2077.068] (-2076.335) (-2077.017) -- 0:04:13
89900 -- [-2072.854] (-2080.918) (-2090.098) (-2078.698) * (-2088.486) [-2078.172] (-2079.188) (-2074.284) -- 0:04:13
90000 -- [-2068.193] (-2080.456) (-2083.539) (-2077.166) * (-2084.156) (-2083.477) (-2079.908) [-2076.857] -- 0:04:12
Average standard deviation of split frequencies: 0.016139
90100 -- [-2076.615] (-2078.141) (-2092.057) (-2077.627) * (-2079.679) (-2075.192) [-2077.990] (-2079.392) -- 0:04:12
90200 -- [-2079.111] (-2084.046) (-2080.161) (-2073.213) * (-2077.143) (-2084.826) [-2075.393] (-2083.637) -- 0:04:12
90300 -- (-2076.839) [-2075.815] (-2080.840) (-2083.040) * (-2081.872) (-2084.417) [-2074.216] (-2089.683) -- 0:04:11
90400 -- (-2077.545) (-2076.074) (-2080.157) [-2073.512] * (-2075.530) (-2080.597) [-2076.363] (-2088.349) -- 0:04:11
90500 -- (-2078.004) (-2078.488) (-2086.393) [-2074.522] * [-2073.409] (-2091.995) (-2079.615) (-2086.949) -- 0:04:11
90600 -- [-2073.513] (-2078.602) (-2086.993) (-2075.373) * (-2078.281) [-2077.067] (-2078.733) (-2082.167) -- 0:04:10
90700 -- (-2078.953) [-2079.925] (-2078.262) (-2071.817) * [-2073.275] (-2079.652) (-2083.529) (-2083.059) -- 0:04:10
90800 -- (-2084.617) [-2082.465] (-2082.611) (-2072.040) * (-2075.249) (-2075.293) (-2092.293) [-2073.217] -- 0:04:10
90900 -- (-2080.213) (-2075.512) (-2082.531) [-2070.371] * (-2070.630) (-2075.279) (-2085.669) [-2076.439] -- 0:04:10
91000 -- [-2077.066] (-2087.814) (-2082.044) (-2073.616) * [-2075.711] (-2079.988) (-2086.916) (-2073.757) -- 0:04:19
Average standard deviation of split frequencies: 0.015802
91100 -- (-2081.482) (-2079.881) (-2088.727) [-2071.194] * [-2081.569] (-2073.954) (-2084.275) (-2075.452) -- 0:04:19
91200 -- (-2090.932) [-2080.591] (-2084.385) (-2071.555) * [-2072.381] (-2086.225) (-2078.111) (-2074.916) -- 0:04:19
91300 -- (-2089.721) (-2074.013) (-2084.827) [-2073.359] * (-2080.061) (-2078.948) (-2076.254) [-2075.778] -- 0:04:18
91400 -- (-2089.804) (-2078.813) (-2086.940) [-2072.513] * [-2075.789] (-2082.375) (-2082.467) (-2074.501) -- 0:04:18
91500 -- (-2093.877) (-2081.377) [-2081.173] (-2072.027) * [-2074.863] (-2082.645) (-2076.970) (-2081.505) -- 0:04:18
91600 -- (-2080.642) (-2087.875) (-2081.829) [-2074.163] * (-2074.235) [-2081.203] (-2079.898) (-2083.419) -- 0:04:17
91700 -- [-2082.771] (-2084.822) (-2082.249) (-2075.917) * [-2070.507] (-2092.132) (-2076.814) (-2074.741) -- 0:04:17
91800 -- (-2080.658) (-2084.000) (-2074.985) [-2073.902] * [-2075.637] (-2093.343) (-2076.924) (-2079.449) -- 0:04:17
91900 -- (-2080.185) (-2086.363) (-2074.133) [-2071.610] * (-2075.923) [-2079.592] (-2078.287) (-2077.102) -- 0:04:16
92000 -- (-2077.235) [-2082.213] (-2077.020) (-2070.907) * (-2074.886) [-2076.156] (-2083.570) (-2082.792) -- 0:04:16
Average standard deviation of split frequencies: 0.014326
92100 -- (-2086.669) (-2081.620) (-2077.102) [-2071.293] * [-2075.419] (-2072.744) (-2088.078) (-2078.104) -- 0:04:16
92200 -- (-2081.524) (-2090.590) (-2075.553) [-2067.270] * (-2074.586) (-2081.441) (-2081.794) [-2071.697] -- 0:04:15
92300 -- (-2094.659) (-2081.061) (-2084.127) [-2072.784] * (-2073.193) (-2084.671) (-2082.335) [-2071.651] -- 0:04:15
92400 -- (-2082.955) (-2085.625) [-2074.974] (-2082.753) * (-2068.832) [-2078.134] (-2086.169) (-2075.451) -- 0:04:15
92500 -- (-2078.917) [-2082.811] (-2077.417) (-2083.420) * (-2069.891) [-2073.165] (-2090.041) (-2072.706) -- 0:04:15
92600 -- (-2085.263) (-2089.461) [-2074.036] (-2081.354) * [-2071.510] (-2079.836) (-2084.625) (-2073.811) -- 0:04:14
92700 -- (-2084.701) (-2084.318) [-2075.419] (-2086.658) * [-2069.291] (-2089.149) (-2082.814) (-2078.841) -- 0:04:14
92800 -- (-2082.032) [-2082.736] (-2078.262) (-2076.093) * (-2069.289) (-2083.280) (-2084.460) [-2074.934] -- 0:04:14
92900 -- (-2074.514) (-2087.101) [-2079.729] (-2079.697) * [-2071.392] (-2086.375) (-2083.687) (-2075.797) -- 0:04:13
93000 -- [-2075.449] (-2084.198) (-2084.741) (-2072.393) * (-2080.350) (-2083.007) (-2084.751) [-2077.904] -- 0:04:13
Average standard deviation of split frequencies: 0.014885
93100 -- (-2078.768) (-2092.124) (-2090.072) [-2073.952] * [-2077.674] (-2080.302) (-2086.985) (-2075.387) -- 0:04:13
93200 -- (-2082.804) (-2095.394) (-2079.338) [-2072.333] * (-2087.213) (-2081.724) (-2078.193) [-2073.918] -- 0:04:12
93300 -- (-2082.032) (-2092.472) (-2078.429) [-2075.935] * (-2085.295) (-2081.010) [-2086.201] (-2079.698) -- 0:04:12
93400 -- [-2079.720] (-2081.217) (-2086.757) (-2085.893) * [-2072.286] (-2091.195) (-2083.488) (-2083.816) -- 0:04:12
93500 -- (-2076.240) (-2080.855) (-2083.295) [-2076.938] * [-2073.749] (-2094.326) (-2076.920) (-2082.359) -- 0:04:12
93600 -- (-2075.382) (-2084.232) (-2081.476) [-2073.701] * (-2074.889) (-2088.653) [-2075.658] (-2081.548) -- 0:04:11
93700 -- (-2077.444) (-2079.765) (-2079.843) [-2081.064] * (-2074.135) [-2077.790] (-2076.352) (-2078.743) -- 0:04:11
93800 -- (-2080.315) [-2080.564] (-2081.903) (-2093.598) * [-2070.145] (-2084.518) (-2088.177) (-2086.287) -- 0:04:11
93900 -- [-2078.828] (-2077.346) (-2093.502) (-2085.201) * [-2075.483] (-2083.732) (-2075.901) (-2089.303) -- 0:04:20
94000 -- (-2093.921) (-2078.906) [-2075.028] (-2084.495) * [-2074.054] (-2078.469) (-2076.977) (-2086.085) -- 0:04:20
Average standard deviation of split frequencies: 0.013020
94100 -- (-2084.320) (-2081.295) [-2077.184] (-2089.193) * [-2071.452] (-2076.753) (-2075.108) (-2086.910) -- 0:04:19
94200 -- (-2093.104) (-2080.008) [-2079.325] (-2089.326) * [-2076.348] (-2081.575) (-2080.513) (-2086.252) -- 0:04:19
94300 -- (-2082.402) [-2073.774] (-2080.193) (-2091.319) * [-2073.372] (-2075.979) (-2095.526) (-2082.468) -- 0:04:19
94400 -- [-2076.689] (-2076.437) (-2080.708) (-2085.239) * [-2073.165] (-2073.936) (-2093.556) (-2081.341) -- 0:04:19
94500 -- [-2073.518] (-2075.874) (-2075.019) (-2080.921) * [-2072.611] (-2074.280) (-2086.993) (-2083.796) -- 0:04:18
94600 -- (-2081.136) (-2073.173) [-2074.534] (-2083.707) * (-2075.029) (-2085.059) [-2079.610] (-2081.060) -- 0:04:18
94700 -- (-2078.745) [-2075.438] (-2079.882) (-2074.394) * [-2074.469] (-2084.843) (-2076.169) (-2080.557) -- 0:04:18
94800 -- (-2088.316) (-2078.217) (-2079.866) [-2075.250] * [-2076.064] (-2082.404) (-2082.113) (-2082.000) -- 0:04:17
94900 -- (-2081.226) (-2078.737) (-2087.904) [-2069.362] * [-2069.079] (-2084.255) (-2074.557) (-2085.899) -- 0:04:17
95000 -- (-2083.533) (-2085.268) (-2079.063) [-2066.778] * [-2071.204] (-2082.819) (-2079.100) (-2081.439) -- 0:04:17
Average standard deviation of split frequencies: 0.013440
95100 -- (-2089.739) (-2081.786) (-2084.382) [-2068.361] * [-2073.817] (-2092.036) (-2083.571) (-2084.610) -- 0:04:16
95200 -- (-2092.510) (-2077.990) (-2079.355) [-2070.585] * [-2068.822] (-2081.990) (-2089.153) (-2081.512) -- 0:04:16
95300 -- (-2086.112) (-2075.439) (-2079.690) [-2072.540] * [-2070.950] (-2080.978) (-2079.248) (-2077.931) -- 0:04:16
95400 -- (-2084.341) (-2073.622) (-2084.538) [-2068.667] * (-2078.727) (-2077.689) (-2087.056) [-2076.760] -- 0:04:16
95500 -- (-2090.107) (-2079.070) (-2085.963) [-2068.305] * (-2075.691) (-2078.700) (-2082.100) [-2078.190] -- 0:04:15
95600 -- (-2079.283) (-2077.500) (-2084.088) [-2074.152] * (-2079.930) (-2082.080) [-2078.841] (-2086.128) -- 0:04:15
95700 -- (-2081.880) [-2075.769] (-2080.737) (-2072.781) * (-2074.782) (-2083.797) (-2088.375) [-2071.080] -- 0:04:15
95800 -- (-2088.381) (-2080.288) [-2081.461] (-2080.404) * (-2076.921) (-2081.318) (-2079.033) [-2073.596] -- 0:04:14
95900 -- (-2082.415) (-2074.685) (-2076.410) [-2079.690] * (-2081.893) (-2082.460) [-2078.157] (-2075.459) -- 0:04:14
96000 -- (-2082.999) [-2076.645] (-2073.233) (-2085.158) * [-2072.874] (-2089.477) (-2075.382) (-2076.916) -- 0:04:14
Average standard deviation of split frequencies: 0.012189
96100 -- (-2074.013) (-2081.706) (-2077.229) [-2079.930] * [-2069.132] (-2091.465) (-2082.024) (-2080.501) -- 0:04:13
96200 -- (-2082.269) (-2079.627) [-2078.158] (-2081.037) * [-2070.184] (-2080.817) (-2091.606) (-2081.700) -- 0:04:13
96300 -- (-2083.178) (-2074.945) (-2081.095) [-2070.868] * [-2070.714] (-2083.145) (-2080.926) (-2086.366) -- 0:04:13
96400 -- (-2077.258) [-2073.855] (-2097.248) (-2073.347) * [-2070.293] (-2088.533) (-2083.096) (-2080.906) -- 0:04:13
96500 -- (-2080.306) (-2077.586) (-2085.541) [-2072.820] * (-2074.596) (-2083.568) [-2076.090] (-2079.444) -- 0:04:12
96600 -- (-2075.239) (-2077.687) (-2094.231) [-2077.321] * [-2074.461] (-2082.671) (-2083.643) (-2082.444) -- 0:04:12
96700 -- (-2083.675) [-2088.061] (-2092.290) (-2083.734) * (-2072.346) (-2089.788) (-2080.422) [-2076.428] -- 0:04:12
96800 -- [-2077.638] (-2082.827) (-2084.910) (-2072.602) * [-2080.068] (-2087.488) (-2081.458) (-2074.249) -- 0:04:11
96900 -- [-2080.715] (-2083.830) (-2080.405) (-2073.463) * (-2079.272) (-2087.896) (-2079.666) [-2075.823] -- 0:04:11
97000 -- (-2074.364) (-2089.341) (-2088.813) [-2070.569] * [-2079.591] (-2090.568) (-2085.412) (-2081.601) -- 0:04:11
Average standard deviation of split frequencies: 0.010808
97100 -- (-2082.481) (-2077.503) (-2086.977) [-2072.111] * (-2080.755) (-2087.378) (-2076.062) [-2077.480] -- 0:04:11
97200 -- (-2075.401) (-2077.239) (-2077.590) [-2071.654] * [-2075.736] (-2084.271) (-2082.377) (-2080.560) -- 0:04:10
97300 -- [-2080.818] (-2081.002) (-2078.575) (-2081.244) * (-2076.922) (-2087.070) [-2075.224] (-2077.137) -- 0:04:10
97400 -- (-2084.948) [-2077.004] (-2085.714) (-2074.374) * (-2080.174) (-2078.278) (-2076.713) [-2077.716] -- 0:04:10
97500 -- (-2078.430) (-2076.981) [-2073.225] (-2076.044) * (-2085.290) [-2080.145] (-2074.508) (-2079.083) -- 0:04:19
97600 -- (-2075.736) (-2081.637) [-2074.370] (-2076.585) * (-2082.414) (-2089.941) (-2080.896) [-2077.609] -- 0:04:18
97700 -- [-2075.731] (-2082.077) (-2076.588) (-2081.409) * (-2077.334) (-2085.066) (-2087.476) [-2076.265] -- 0:04:18
97800 -- (-2076.317) (-2083.428) (-2076.186) [-2074.038] * (-2082.397) (-2079.242) [-2077.222] (-2076.256) -- 0:04:18
97900 -- (-2080.550) (-2078.834) [-2079.298] (-2070.774) * (-2080.153) (-2082.350) (-2072.436) [-2073.060] -- 0:04:18
98000 -- (-2078.046) (-2080.465) (-2080.856) [-2069.689] * (-2077.320) (-2083.283) (-2077.418) [-2073.152] -- 0:04:17
Average standard deviation of split frequencies: 0.010843
98100 -- (-2077.771) (-2084.636) (-2078.803) [-2073.392] * (-2076.766) [-2077.363] (-2073.255) (-2080.817) -- 0:04:17
98200 -- (-2081.178) [-2072.576] (-2084.309) (-2078.442) * [-2069.824] (-2077.515) (-2074.460) (-2088.952) -- 0:04:17
98300 -- (-2077.710) (-2081.131) (-2083.552) [-2073.649] * (-2071.310) (-2080.376) (-2088.383) [-2077.333] -- 0:04:16
98400 -- (-2082.243) (-2087.559) [-2085.381] (-2075.113) * [-2074.390] (-2077.484) (-2082.754) (-2078.391) -- 0:04:16
98500 -- (-2079.238) [-2076.424] (-2092.472) (-2076.443) * [-2074.031] (-2076.357) (-2080.979) (-2085.480) -- 0:04:16
98600 -- (-2074.388) (-2075.575) (-2086.569) [-2071.114] * [-2077.620] (-2077.562) (-2076.315) (-2088.911) -- 0:04:15
98700 -- (-2081.068) (-2079.172) (-2080.960) [-2070.156] * (-2081.647) (-2078.938) (-2084.351) [-2075.075] -- 0:04:15
98800 -- (-2083.429) (-2081.737) (-2085.692) [-2071.542] * [-2075.856] (-2077.839) (-2080.256) (-2079.457) -- 0:04:15
98900 -- (-2083.431) (-2077.713) (-2088.457) [-2070.600] * (-2087.322) [-2075.084] (-2082.805) (-2080.751) -- 0:04:15
99000 -- (-2089.945) (-2089.053) (-2083.115) [-2082.975] * (-2077.013) (-2077.824) [-2080.397] (-2083.631) -- 0:04:14
Average standard deviation of split frequencies: 0.010183
99100 -- (-2085.571) [-2080.079] (-2089.034) (-2075.636) * (-2086.470) (-2081.712) (-2084.702) [-2074.543] -- 0:04:14
99200 -- (-2080.895) (-2075.496) (-2093.537) [-2073.560] * (-2078.003) (-2080.197) [-2081.257] (-2080.742) -- 0:04:14
99300 -- (-2081.636) (-2080.589) (-2097.949) [-2075.965] * (-2074.657) (-2080.803) (-2078.971) [-2077.652] -- 0:04:13
99400 -- (-2076.601) (-2083.365) (-2089.667) [-2072.949] * (-2080.374) (-2074.998) [-2077.730] (-2086.741) -- 0:04:13
99500 -- (-2086.123) [-2082.356] (-2093.350) (-2075.921) * (-2077.594) (-2081.946) [-2081.629] (-2078.905) -- 0:04:13
99600 -- (-2086.461) (-2081.992) [-2087.094] (-2077.920) * (-2075.891) [-2080.075] (-2081.040) (-2075.886) -- 0:04:13
99700 -- (-2091.901) [-2077.933] (-2083.029) (-2079.717) * [-2080.223] (-2084.196) (-2085.038) (-2090.862) -- 0:04:12
99800 -- (-2084.275) (-2077.289) (-2080.517) [-2079.147] * (-2080.418) (-2078.150) (-2087.290) [-2074.931] -- 0:04:12
99900 -- [-2080.368] (-2081.684) (-2083.170) (-2081.567) * [-2084.308] (-2076.581) (-2091.151) (-2078.175) -- 0:04:12
100000 -- [-2073.031] (-2075.709) (-2083.192) (-2087.692) * (-2083.104) [-2075.445] (-2082.703) (-2073.570) -- 0:04:11
Average standard deviation of split frequencies: 0.009012
100100 -- [-2072.911] (-2084.433) (-2094.709) (-2086.314) * (-2078.482) (-2079.660) [-2072.819] (-2074.797) -- 0:04:11
100200 -- [-2076.706] (-2081.715) (-2082.996) (-2078.334) * (-2074.605) (-2084.245) [-2074.260] (-2078.183) -- 0:04:11
100300 -- (-2080.797) (-2079.240) [-2083.967] (-2076.138) * [-2071.141] (-2082.625) (-2080.234) (-2076.963) -- 0:04:11
100400 -- [-2076.360] (-2081.997) (-2088.501) (-2072.930) * (-2067.762) (-2074.597) [-2075.843] (-2076.536) -- 0:04:10
100500 -- (-2089.547) (-2077.505) (-2086.559) [-2081.000] * [-2071.162] (-2089.554) (-2078.913) (-2084.457) -- 0:04:10
100600 -- (-2084.453) (-2082.034) (-2079.164) [-2075.574] * [-2068.145] (-2081.877) (-2081.888) (-2080.915) -- 0:04:10
100700 -- (-2077.810) (-2081.641) (-2075.860) [-2072.982] * (-2071.743) (-2083.419) [-2079.270] (-2085.452) -- 0:04:10
100800 -- [-2077.058] (-2084.629) (-2081.509) (-2083.227) * [-2080.062] (-2087.612) (-2073.207) (-2081.063) -- 0:04:09
100900 -- (-2083.684) (-2091.462) (-2076.586) [-2071.443] * (-2084.012) (-2084.825) (-2073.042) [-2077.121] -- 0:04:09
101000 -- (-2078.178) (-2076.825) [-2078.233] (-2073.426) * (-2073.317) (-2076.447) [-2075.901] (-2081.595) -- 0:04:09
Average standard deviation of split frequencies: 0.008917
101100 -- (-2082.034) [-2081.978] (-2077.775) (-2077.449) * (-2076.632) (-2077.128) (-2077.061) [-2072.540] -- 0:04:17
101200 -- (-2078.664) (-2080.482) [-2074.081] (-2078.646) * (-2084.016) [-2079.530] (-2080.712) (-2075.637) -- 0:04:17
101300 -- (-2074.720) [-2082.179] (-2073.868) (-2085.590) * (-2074.177) (-2078.874) (-2085.764) [-2075.348] -- 0:04:17
101400 -- (-2076.506) [-2070.467] (-2074.073) (-2090.492) * (-2073.385) (-2076.567) (-2085.019) [-2072.679] -- 0:04:16
101500 -- [-2074.361] (-2080.457) (-2081.323) (-2080.889) * (-2078.456) (-2074.114) [-2079.341] (-2074.691) -- 0:04:16
101600 -- [-2075.415] (-2075.058) (-2078.042) (-2084.149) * (-2079.507) (-2081.943) [-2076.934] (-2072.035) -- 0:04:16
101700 -- (-2076.570) (-2076.015) (-2074.525) [-2073.553] * (-2076.726) (-2076.334) (-2077.158) [-2076.060] -- 0:04:16
101800 -- (-2079.188) (-2070.602) (-2075.729) [-2071.708] * (-2072.906) [-2070.995] (-2082.928) (-2084.249) -- 0:04:15
101900 -- (-2079.363) [-2074.947] (-2075.659) (-2072.503) * (-2074.066) (-2077.649) [-2076.044] (-2082.802) -- 0:04:15
102000 -- (-2082.790) (-2081.725) (-2078.568) [-2072.548] * [-2073.017] (-2085.215) (-2077.241) (-2079.884) -- 0:04:15
Average standard deviation of split frequencies: 0.008967
102100 -- (-2089.891) (-2073.893) (-2076.882) [-2075.276] * (-2078.226) (-2084.113) [-2080.089] (-2082.206) -- 0:04:15
102200 -- (-2077.567) (-2078.400) (-2086.634) [-2069.800] * (-2077.977) [-2085.352] (-2086.311) (-2084.146) -- 0:04:14
102300 -- (-2092.957) [-2078.619] (-2081.755) (-2071.736) * (-2079.767) (-2084.459) [-2076.044] (-2084.913) -- 0:04:14
102400 -- (-2089.699) [-2075.235] (-2075.001) (-2074.264) * (-2077.749) [-2077.099] (-2075.878) (-2084.439) -- 0:04:14
102500 -- [-2078.437] (-2089.220) (-2079.978) (-2077.371) * (-2080.974) [-2080.098] (-2072.545) (-2083.038) -- 0:04:13
102600 -- [-2077.973] (-2080.043) (-2080.108) (-2078.006) * (-2082.436) (-2085.436) [-2072.716] (-2081.144) -- 0:04:13
102700 -- (-2096.681) (-2079.857) [-2077.321] (-2078.651) * (-2077.470) (-2076.111) [-2073.425] (-2084.899) -- 0:04:13
102800 -- (-2097.078) [-2078.523] (-2077.369) (-2086.888) * (-2080.680) [-2074.870] (-2077.083) (-2083.699) -- 0:04:13
102900 -- (-2091.514) (-2081.113) (-2079.357) [-2074.403] * [-2073.445] (-2077.342) (-2082.709) (-2083.021) -- 0:04:12
103000 -- (-2086.762) (-2088.145) (-2076.113) [-2077.000] * [-2068.536] (-2079.778) (-2071.857) (-2086.888) -- 0:04:12
Average standard deviation of split frequencies: 0.009397
103100 -- (-2081.760) (-2085.124) [-2074.161] (-2077.679) * (-2073.978) [-2074.190] (-2083.852) (-2082.388) -- 0:04:12
103200 -- (-2076.639) (-2082.710) (-2080.855) [-2076.043] * (-2071.919) [-2078.487] (-2078.668) (-2076.307) -- 0:04:12
103300 -- [-2078.489] (-2082.572) (-2074.750) (-2076.039) * [-2070.893] (-2089.423) (-2082.505) (-2080.192) -- 0:04:11
103400 -- (-2078.672) (-2083.163) (-2084.090) [-2072.823] * [-2072.153] (-2078.807) (-2093.117) (-2088.203) -- 0:04:11
103500 -- (-2078.385) (-2082.850) (-2084.984) [-2075.310] * (-2073.982) [-2077.449] (-2086.432) (-2084.336) -- 0:04:11
103600 -- (-2083.594) [-2085.987] (-2078.744) (-2075.754) * (-2070.589) (-2077.066) (-2086.115) [-2076.464] -- 0:04:10
103700 -- [-2077.441] (-2082.543) (-2078.795) (-2071.397) * (-2069.219) (-2089.613) (-2080.713) [-2080.878] -- 0:04:10
103800 -- (-2086.181) [-2081.766] (-2075.133) (-2069.833) * [-2069.403] (-2088.237) (-2078.916) (-2085.160) -- 0:04:10
103900 -- (-2091.946) (-2087.607) [-2080.046] (-2075.853) * (-2076.310) [-2078.111] (-2082.161) (-2084.520) -- 0:04:10
104000 -- (-2083.026) (-2075.592) (-2077.060) [-2070.276] * [-2069.682] (-2082.648) (-2076.232) (-2090.535) -- 0:04:09
Average standard deviation of split frequencies: 0.010606
104100 -- (-2083.031) (-2080.465) (-2076.201) [-2076.466] * [-2068.307] (-2077.553) (-2077.527) (-2084.489) -- 0:04:09
104200 -- (-2082.260) (-2086.064) (-2085.622) [-2075.299] * (-2073.212) [-2078.106] (-2076.609) (-2079.752) -- 0:04:09
104300 -- [-2081.717] (-2085.310) (-2082.748) (-2078.399) * [-2073.779] (-2081.921) (-2083.102) (-2077.618) -- 0:04:09
104400 -- (-2079.248) (-2088.461) (-2082.763) [-2073.349] * [-2076.289] (-2081.376) (-2079.211) (-2083.590) -- 0:04:08
104500 -- (-2091.590) (-2089.269) (-2082.978) [-2070.158] * (-2077.653) [-2073.953] (-2076.174) (-2076.720) -- 0:04:08
104600 -- (-2086.130) (-2081.807) (-2080.965) [-2069.265] * (-2077.646) [-2073.859] (-2072.827) (-2076.075) -- 0:04:16
104700 -- (-2096.125) [-2079.169] (-2082.176) (-2075.400) * (-2075.940) [-2073.394] (-2077.662) (-2074.869) -- 0:04:16
104800 -- (-2097.345) (-2086.474) (-2074.954) [-2071.292] * (-2081.347) [-2071.528] (-2076.904) (-2081.166) -- 0:04:16
104900 -- (-2085.990) (-2085.684) (-2080.177) [-2069.786] * (-2078.489) [-2081.064] (-2084.230) (-2078.799) -- 0:04:15
105000 -- (-2092.104) (-2088.484) (-2074.515) [-2072.788] * (-2073.407) (-2077.948) (-2082.357) [-2076.233] -- 0:04:15
Average standard deviation of split frequencies: 0.010498
105100 -- (-2092.191) (-2090.630) (-2078.817) [-2073.202] * [-2072.813] (-2080.627) (-2086.200) (-2078.930) -- 0:04:15
105200 -- (-2082.963) (-2079.004) [-2076.086] (-2076.861) * (-2074.268) [-2083.718] (-2085.134) (-2078.324) -- 0:04:15
105300 -- (-2082.014) (-2085.292) (-2078.775) [-2072.274] * [-2066.853] (-2081.689) (-2079.514) (-2082.265) -- 0:04:14
105400 -- (-2079.022) (-2087.020) (-2073.986) [-2070.106] * [-2067.534] (-2076.412) (-2087.031) (-2075.206) -- 0:04:14
105500 -- (-2078.634) (-2083.086) (-2072.788) [-2070.014] * (-2079.148) [-2073.525] (-2090.989) (-2075.461) -- 0:04:14
105600 -- (-2083.281) (-2083.997) [-2070.777] (-2069.732) * [-2083.700] (-2082.045) (-2078.016) (-2076.713) -- 0:04:14
105700 -- (-2081.903) (-2089.164) (-2080.195) [-2072.995] * [-2077.091] (-2080.793) (-2086.632) (-2074.382) -- 0:04:13
105800 -- (-2078.643) (-2084.954) (-2081.585) [-2071.607] * (-2070.139) (-2076.860) [-2074.164] (-2073.287) -- 0:04:13
105900 -- (-2078.755) (-2086.044) (-2077.580) [-2071.153] * (-2070.435) [-2078.782] (-2088.309) (-2084.557) -- 0:04:13
106000 -- (-2080.641) (-2087.519) [-2072.706] (-2069.807) * [-2068.664] (-2073.578) (-2086.069) (-2082.285) -- 0:04:13
Average standard deviation of split frequencies: 0.010406
106100 -- (-2082.155) (-2088.046) [-2073.265] (-2075.923) * [-2072.984] (-2072.060) (-2096.705) (-2080.055) -- 0:04:12
106200 -- (-2080.670) (-2083.893) [-2068.804] (-2083.419) * [-2072.487] (-2078.376) (-2099.513) (-2080.527) -- 0:04:12
106300 -- (-2080.508) [-2083.435] (-2074.316) (-2073.505) * (-2072.061) [-2077.955] (-2091.137) (-2086.064) -- 0:04:12
106400 -- (-2076.045) (-2085.818) (-2073.425) [-2075.135] * [-2080.371] (-2073.810) (-2081.663) (-2081.415) -- 0:04:11
106500 -- (-2083.505) (-2085.460) [-2073.418] (-2074.036) * (-2071.488) [-2071.911] (-2081.258) (-2075.507) -- 0:04:11
106600 -- (-2079.767) (-2087.208) [-2074.943] (-2069.576) * (-2087.652) (-2074.815) [-2077.826] (-2072.553) -- 0:04:11
106700 -- [-2072.960] (-2091.966) (-2076.098) (-2083.690) * (-2081.039) [-2071.973] (-2082.106) (-2087.392) -- 0:04:11
106800 -- [-2079.690] (-2081.177) (-2081.373) (-2080.349) * [-2071.861] (-2078.248) (-2074.760) (-2090.269) -- 0:04:10
106900 -- (-2077.801) (-2088.086) (-2081.859) [-2075.064] * (-2080.259) (-2076.648) (-2079.458) [-2079.819] -- 0:04:10
107000 -- (-2075.753) (-2089.444) (-2080.609) [-2076.629] * (-2085.330) (-2079.764) (-2073.378) [-2079.138] -- 0:04:10
Average standard deviation of split frequencies: 0.009549
107100 -- (-2078.821) (-2084.585) (-2083.018) [-2069.529] * (-2081.237) [-2070.799] (-2074.363) (-2077.818) -- 0:04:10
107200 -- [-2076.979] (-2078.735) (-2085.587) (-2070.668) * [-2075.732] (-2078.925) (-2081.592) (-2083.568) -- 0:04:09
107300 -- [-2075.852] (-2078.738) (-2090.131) (-2067.690) * (-2079.251) (-2074.258) (-2087.833) [-2080.939] -- 0:04:09
107400 -- [-2078.689] (-2077.194) (-2082.714) (-2066.055) * [-2076.364] (-2077.178) (-2079.203) (-2085.654) -- 0:04:09
107500 -- (-2080.429) (-2087.552) (-2076.191) [-2069.453] * [-2073.589] (-2077.964) (-2079.611) (-2090.168) -- 0:04:09
107600 -- (-2071.533) (-2086.055) [-2076.417] (-2069.457) * (-2075.015) [-2076.225] (-2081.745) (-2086.353) -- 0:04:08
107700 -- (-2074.080) (-2085.229) (-2073.925) [-2071.836] * (-2080.920) [-2076.121] (-2075.093) (-2086.787) -- 0:04:08
107800 -- (-2080.008) (-2089.199) [-2077.373] (-2082.158) * (-2083.128) (-2077.294) [-2078.460] (-2090.844) -- 0:04:08
107900 -- [-2073.952] (-2087.406) (-2088.083) (-2078.315) * (-2082.677) [-2071.937] (-2081.704) (-2087.871) -- 0:04:08
108000 -- (-2066.908) [-2086.657] (-2076.394) (-2077.020) * [-2076.897] (-2073.997) (-2082.839) (-2087.889) -- 0:04:07
Average standard deviation of split frequencies: 0.008594
108100 -- (-2076.479) (-2085.907) (-2084.045) [-2072.900] * (-2075.486) [-2073.560] (-2086.466) (-2080.557) -- 0:04:07
108200 -- (-2072.542) (-2081.963) [-2077.001] (-2078.573) * (-2079.668) (-2075.340) [-2076.057] (-2087.394) -- 0:04:15
108300 -- [-2072.636] (-2081.279) (-2073.967) (-2077.435) * (-2088.002) (-2074.195) (-2086.208) [-2080.318] -- 0:04:15
108400 -- (-2076.377) (-2075.154) [-2073.377] (-2076.158) * (-2079.394) [-2071.735] (-2081.243) (-2079.739) -- 0:04:14
108500 -- (-2081.908) (-2082.509) (-2076.946) [-2069.946] * (-2088.075) (-2077.833) [-2086.277] (-2089.564) -- 0:04:14
108600 -- [-2072.783] (-2083.932) (-2074.419) (-2071.925) * [-2079.173] (-2074.418) (-2079.073) (-2089.643) -- 0:04:14
108700 -- (-2082.191) (-2078.879) [-2076.257] (-2078.670) * (-2076.975) (-2084.589) [-2081.987] (-2078.169) -- 0:04:14
108800 -- (-2080.672) (-2081.823) [-2070.993] (-2083.587) * (-2080.698) [-2081.052] (-2075.461) (-2084.668) -- 0:04:13
108900 -- [-2077.722] (-2075.054) (-2079.471) (-2079.402) * [-2088.708] (-2077.862) (-2078.906) (-2087.657) -- 0:04:13
109000 -- (-2075.934) (-2090.490) [-2073.493] (-2082.519) * (-2088.363) (-2086.074) [-2075.903] (-2081.824) -- 0:04:13
Average standard deviation of split frequencies: 0.008510
109100 -- (-2075.310) (-2079.536) (-2079.063) [-2072.560] * (-2081.855) (-2091.263) (-2077.170) [-2080.067] -- 0:04:13
109200 -- [-2076.777] (-2084.009) (-2089.385) (-2079.579) * (-2088.782) (-2083.675) (-2079.309) [-2075.653] -- 0:04:12
109300 -- (-2078.739) (-2087.340) (-2079.458) [-2072.068] * (-2083.480) (-2085.410) (-2081.794) [-2087.466] -- 0:04:12
109400 -- (-2076.332) (-2097.564) [-2071.028] (-2074.704) * (-2095.353) (-2085.428) (-2085.537) [-2079.669] -- 0:04:12
109500 -- (-2079.012) (-2091.945) (-2072.990) [-2072.820] * (-2090.770) [-2081.999] (-2089.529) (-2079.237) -- 0:04:12
109600 -- (-2075.183) (-2086.926) [-2072.122] (-2080.958) * (-2085.618) (-2079.532) (-2081.011) [-2073.292] -- 0:04:11
109700 -- (-2073.077) (-2083.431) [-2074.190] (-2079.353) * [-2079.527] (-2080.004) (-2080.618) (-2071.750) -- 0:04:11
109800 -- (-2078.142) (-2081.964) (-2074.952) [-2080.410] * [-2083.033] (-2077.675) (-2086.159) (-2070.732) -- 0:04:11
109900 -- [-2076.014] (-2081.608) (-2073.269) (-2076.315) * (-2073.434) (-2078.311) (-2081.052) [-2070.606] -- 0:04:11
110000 -- (-2076.969) (-2075.926) (-2077.015) [-2076.729] * [-2073.766] (-2078.960) (-2082.908) (-2081.161) -- 0:04:10
Average standard deviation of split frequencies: 0.008561
110100 -- (-2077.712) [-2071.829] (-2082.070) (-2080.544) * (-2069.672) (-2079.455) (-2075.659) [-2072.245] -- 0:04:10
110200 -- [-2078.613] (-2076.394) (-2078.356) (-2077.195) * [-2069.304] (-2084.319) (-2077.923) (-2078.314) -- 0:04:10
110300 -- (-2077.284) [-2075.546] (-2082.709) (-2078.841) * [-2076.771] (-2079.517) (-2084.507) (-2083.121) -- 0:04:10
110400 -- (-2074.788) (-2081.616) [-2074.565] (-2095.406) * [-2080.300] (-2081.846) (-2077.318) (-2087.223) -- 0:04:09
110500 -- [-2083.318] (-2079.427) (-2082.399) (-2096.420) * (-2072.353) [-2074.394] (-2086.599) (-2091.865) -- 0:04:09
110600 -- [-2073.796] (-2077.133) (-2073.107) (-2080.440) * (-2076.656) [-2072.637] (-2091.673) (-2081.599) -- 0:04:09
110700 -- [-2074.089] (-2083.566) (-2076.134) (-2078.074) * (-2081.286) [-2068.525] (-2090.674) (-2076.769) -- 0:04:09
110800 -- (-2075.313) (-2081.569) (-2077.959) [-2075.039] * (-2074.048) [-2067.212] (-2089.963) (-2078.796) -- 0:04:08
110900 -- (-2074.179) (-2080.612) [-2071.115] (-2080.007) * (-2081.851) [-2071.619] (-2078.412) (-2080.769) -- 0:04:08
111000 -- (-2075.125) (-2076.430) (-2074.076) [-2079.286] * (-2076.284) [-2072.977] (-2083.523) (-2079.945) -- 0:04:08
Average standard deviation of split frequencies: 0.008478
111100 -- (-2081.835) [-2076.829] (-2076.461) (-2074.997) * (-2079.958) [-2070.215] (-2088.895) (-2076.635) -- 0:04:08
111200 -- [-2081.241] (-2078.685) (-2080.483) (-2083.449) * (-2072.647) [-2070.629] (-2092.875) (-2076.497) -- 0:04:07
111300 -- [-2079.912] (-2075.886) (-2081.552) (-2076.595) * (-2070.579) [-2072.627] (-2092.070) (-2078.544) -- 0:04:07
111400 -- [-2073.441] (-2084.170) (-2086.875) (-2088.114) * (-2078.591) (-2075.828) (-2079.533) [-2077.641] -- 0:04:07
111500 -- (-2074.469) (-2078.052) (-2094.796) [-2077.367] * (-2079.419) (-2076.620) (-2081.758) [-2075.643] -- 0:04:07
111600 -- (-2081.281) (-2076.347) (-2089.041) [-2069.468] * (-2078.128) (-2081.441) (-2077.681) [-2074.671] -- 0:04:06
111700 -- (-2080.199) (-2072.857) (-2082.107) [-2071.699] * [-2081.504] (-2083.040) (-2083.511) (-2073.181) -- 0:04:06
111800 -- (-2082.987) [-2072.134] (-2091.133) (-2078.524) * [-2073.063] (-2090.318) (-2081.779) (-2079.139) -- 0:04:14
111900 -- (-2085.289) (-2082.587) (-2080.294) [-2072.081] * [-2077.569] (-2089.682) (-2084.144) (-2080.162) -- 0:04:13
112000 -- (-2080.325) (-2082.472) [-2074.704] (-2083.380) * [-2074.551] (-2090.028) (-2078.079) (-2083.903) -- 0:04:13
Average standard deviation of split frequencies: 0.007687
112100 -- (-2083.121) (-2084.908) [-2078.239] (-2068.947) * [-2074.991] (-2091.548) (-2075.445) (-2091.717) -- 0:04:13
112200 -- (-2081.709) [-2076.768] (-2080.645) (-2078.252) * [-2079.721] (-2088.770) (-2073.362) (-2084.787) -- 0:04:13
112300 -- (-2078.752) (-2083.394) [-2073.935] (-2090.308) * (-2077.804) (-2083.439) [-2072.257] (-2087.609) -- 0:04:12
112400 -- [-2080.221] (-2076.357) (-2076.513) (-2084.566) * [-2077.068] (-2079.165) (-2076.761) (-2083.651) -- 0:04:12
112500 -- (-2078.164) (-2080.270) [-2082.491] (-2088.184) * (-2081.042) [-2077.087] (-2086.141) (-2075.765) -- 0:04:12
112600 -- (-2078.917) (-2077.611) (-2077.233) [-2079.122] * [-2075.449] (-2081.498) (-2090.498) (-2078.012) -- 0:04:12
112700 -- (-2073.854) (-2084.996) (-2073.225) [-2081.986] * (-2074.147) [-2080.729] (-2080.544) (-2088.398) -- 0:04:11
112800 -- (-2073.050) (-2074.652) [-2072.731] (-2076.475) * (-2077.866) [-2075.943] (-2076.798) (-2084.007) -- 0:04:11
112900 -- (-2072.709) (-2077.273) [-2071.001] (-2076.307) * (-2073.459) (-2086.971) [-2073.798] (-2086.967) -- 0:04:11
113000 -- [-2075.376] (-2080.243) (-2076.054) (-2080.851) * (-2081.911) [-2077.501] (-2073.281) (-2083.539) -- 0:04:11
Average standard deviation of split frequencies: 0.006901
113100 -- (-2091.072) (-2080.622) [-2074.346] (-2079.898) * [-2078.914] (-2075.505) (-2072.176) (-2080.125) -- 0:04:10
113200 -- (-2089.893) [-2079.852] (-2084.153) (-2079.367) * [-2070.111] (-2080.477) (-2072.556) (-2080.280) -- 0:04:10
113300 -- (-2094.114) [-2080.068] (-2079.827) (-2077.680) * [-2072.375] (-2078.642) (-2083.567) (-2078.594) -- 0:04:10
113400 -- (-2076.540) (-2074.835) (-2080.649) [-2081.913] * [-2073.465] (-2079.516) (-2082.577) (-2078.413) -- 0:04:10
113500 -- (-2072.842) [-2071.877] (-2084.983) (-2082.158) * (-2078.247) [-2072.717] (-2080.134) (-2079.052) -- 0:04:09
113600 -- (-2076.189) [-2071.254] (-2080.059) (-2096.496) * (-2079.386) (-2081.301) [-2074.960] (-2076.517) -- 0:04:09
113700 -- (-2071.910) (-2069.678) [-2071.381] (-2086.641) * [-2073.891] (-2076.080) (-2080.032) (-2077.530) -- 0:04:09
113800 -- [-2070.230] (-2076.554) (-2070.503) (-2079.424) * (-2078.858) [-2068.810] (-2085.870) (-2079.011) -- 0:04:09
113900 -- (-2083.743) (-2083.706) [-2072.335] (-2073.153) * [-2080.488] (-2075.331) (-2082.628) (-2085.493) -- 0:04:08
114000 -- [-2078.407] (-2079.556) (-2086.050) (-2075.514) * (-2087.619) (-2085.401) [-2075.825] (-2084.272) -- 0:04:08
Average standard deviation of split frequencies: 0.006136
114100 -- (-2083.231) (-2080.310) [-2070.230] (-2077.717) * (-2082.156) (-2077.197) [-2076.771] (-2088.997) -- 0:04:08
114200 -- (-2082.243) [-2075.388] (-2067.103) (-2077.715) * (-2077.540) [-2072.618] (-2085.592) (-2077.938) -- 0:04:08
114300 -- (-2078.278) [-2073.430] (-2070.019) (-2083.268) * [-2078.014] (-2079.611) (-2076.356) (-2075.979) -- 0:04:07
114400 -- (-2081.843) (-2078.723) (-2074.803) [-2077.363] * [-2067.692] (-2076.638) (-2081.783) (-2082.116) -- 0:04:07
114500 -- (-2079.072) (-2075.973) [-2074.014] (-2084.902) * [-2071.225] (-2076.428) (-2087.463) (-2077.196) -- 0:04:07
114600 -- (-2080.968) (-2080.635) [-2070.890] (-2087.175) * [-2072.808] (-2077.910) (-2079.098) (-2078.326) -- 0:04:07
114700 -- [-2077.973] (-2077.096) (-2078.658) (-2081.263) * (-2080.873) [-2078.432] (-2083.979) (-2078.156) -- 0:04:06
114800 -- (-2082.971) (-2077.015) [-2068.909] (-2085.219) * [-2075.529] (-2081.845) (-2080.582) (-2080.004) -- 0:04:06
114900 -- (-2083.466) [-2070.524] (-2070.471) (-2085.415) * (-2078.111) (-2075.514) (-2084.332) [-2073.952] -- 0:04:06
115000 -- (-2081.672) (-2067.771) [-2074.826] (-2080.690) * (-2078.433) (-2076.554) (-2082.151) [-2076.258] -- 0:04:06
Average standard deviation of split frequencies: 0.007015
115100 -- (-2076.117) (-2077.891) [-2071.006] (-2081.579) * [-2076.459] (-2078.750) (-2088.235) (-2077.052) -- 0:04:06
115200 -- (-2084.383) (-2072.166) [-2070.231] (-2081.542) * (-2081.482) (-2081.695) (-2086.667) [-2079.753] -- 0:04:05
115300 -- (-2087.239) (-2073.939) [-2071.647] (-2079.935) * (-2078.068) [-2080.925] (-2079.844) (-2078.971) -- 0:04:05
115400 -- (-2079.580) [-2071.811] (-2077.791) (-2078.681) * [-2075.652] (-2087.447) (-2076.320) (-2079.383) -- 0:04:12
115500 -- [-2075.676] (-2075.430) (-2075.064) (-2083.004) * [-2073.081] (-2089.987) (-2078.389) (-2079.722) -- 0:04:12
115600 -- (-2082.274) [-2069.655] (-2074.783) (-2083.670) * (-2076.752) (-2083.956) [-2080.717] (-2076.577) -- 0:04:12
115700 -- (-2087.578) (-2075.912) [-2069.321] (-2078.909) * [-2068.639] (-2094.983) (-2079.084) (-2077.556) -- 0:04:12
115800 -- (-2083.685) (-2081.745) [-2071.619] (-2075.306) * [-2068.786] (-2094.248) (-2080.076) (-2076.978) -- 0:04:11
115900 -- (-2075.848) (-2076.249) [-2072.833] (-2077.883) * [-2073.900] (-2083.537) (-2083.270) (-2076.551) -- 0:04:11
116000 -- [-2073.830] (-2076.099) (-2083.569) (-2078.342) * [-2072.712] (-2085.046) (-2082.061) (-2079.815) -- 0:04:11
Average standard deviation of split frequencies: 0.007538
116100 -- [-2075.616] (-2080.750) (-2078.865) (-2075.550) * [-2070.156] (-2082.405) (-2089.085) (-2073.002) -- 0:04:11
116200 -- (-2073.882) (-2081.829) [-2075.731] (-2078.494) * (-2074.140) [-2075.445] (-2083.576) (-2078.771) -- 0:04:10
116300 -- (-2078.360) (-2088.025) [-2072.906] (-2084.402) * (-2077.018) [-2077.218] (-2075.921) (-2085.277) -- 0:04:10
116400 -- (-2079.041) (-2083.085) [-2078.199] (-2083.934) * (-2076.432) (-2080.594) [-2081.128] (-2082.426) -- 0:04:10
116500 -- [-2073.080] (-2081.485) (-2074.294) (-2085.635) * (-2071.498) (-2087.169) [-2082.068] (-2083.565) -- 0:04:10
116600 -- (-2074.786) (-2077.350) [-2070.937] (-2081.857) * (-2070.061) (-2082.285) (-2097.816) [-2076.535] -- 0:04:10
116700 -- (-2073.462) (-2079.959) [-2069.090] (-2089.399) * (-2068.718) [-2082.386] (-2097.249) (-2078.229) -- 0:04:09
116800 -- (-2078.286) (-2081.628) [-2074.304] (-2083.993) * (-2066.250) (-2078.787) (-2100.366) [-2079.608] -- 0:04:09
116900 -- (-2076.444) (-2080.337) [-2074.480] (-2079.756) * [-2073.734] (-2080.684) (-2084.383) (-2075.827) -- 0:04:09
117000 -- (-2078.060) (-2079.198) (-2079.335) [-2073.526] * [-2077.563] (-2076.641) (-2082.564) (-2084.289) -- 0:04:09
Average standard deviation of split frequencies: 0.008849
117100 -- (-2079.956) (-2075.414) (-2078.848) [-2075.428] * [-2068.448] (-2072.411) (-2084.684) (-2083.181) -- 0:04:08
117200 -- (-2087.434) (-2073.821) [-2072.198] (-2080.302) * (-2068.542) [-2073.377] (-2083.822) (-2078.910) -- 0:04:08
117300 -- (-2083.499) (-2081.812) [-2073.166] (-2090.896) * (-2072.839) (-2075.283) (-2081.996) [-2076.214] -- 0:04:08
117400 -- (-2076.791) (-2077.643) [-2072.254] (-2087.661) * (-2080.766) [-2077.230] (-2076.878) (-2072.007) -- 0:04:08
117500 -- (-2077.685) [-2069.075] (-2072.653) (-2078.400) * (-2079.370) [-2077.337] (-2082.599) (-2080.398) -- 0:04:07
117600 -- (-2080.171) (-2077.476) [-2069.760] (-2084.568) * (-2078.857) [-2076.130] (-2086.285) (-2083.103) -- 0:04:07
117700 -- (-2084.591) [-2073.132] (-2076.770) (-2101.978) * (-2083.815) [-2080.545] (-2080.425) (-2084.021) -- 0:04:07
117800 -- (-2079.779) [-2073.455] (-2070.119) (-2090.563) * (-2077.359) (-2089.886) [-2076.043] (-2077.786) -- 0:04:07
117900 -- (-2085.241) (-2076.271) [-2074.682] (-2084.741) * [-2071.440] (-2079.708) (-2083.558) (-2072.628) -- 0:04:06
118000 -- (-2082.250) (-2075.899) (-2078.751) [-2079.359] * (-2074.919) (-2079.460) [-2078.665] (-2076.486) -- 0:04:06
Average standard deviation of split frequencies: 0.008209
118100 -- (-2092.394) (-2073.036) (-2075.022) [-2081.329] * [-2073.350] (-2082.717) (-2087.597) (-2077.259) -- 0:04:06
118200 -- (-2077.928) (-2073.351) [-2071.963] (-2079.201) * [-2069.905] (-2080.943) (-2087.286) (-2079.231) -- 0:04:06
118300 -- (-2081.744) (-2077.556) (-2073.611) [-2075.779] * [-2070.221] (-2082.003) (-2091.766) (-2079.349) -- 0:04:05
118400 -- (-2082.811) [-2071.002] (-2081.986) (-2083.602) * [-2073.578] (-2079.070) (-2080.725) (-2079.046) -- 0:04:05
118500 -- (-2088.121) [-2070.593] (-2073.985) (-2084.729) * (-2082.027) (-2086.235) (-2082.690) [-2077.315] -- 0:04:05
118600 -- (-2078.831) (-2071.770) (-2089.486) [-2078.606] * [-2077.869] (-2084.359) (-2077.288) (-2078.723) -- 0:04:05
118700 -- (-2079.073) [-2072.542] (-2089.038) (-2076.295) * (-2081.351) (-2082.124) [-2078.343] (-2080.195) -- 0:04:05
118800 -- (-2083.162) [-2073.355] (-2077.649) (-2073.076) * (-2079.926) (-2076.221) [-2074.672] (-2081.310) -- 0:04:04
118900 -- (-2081.626) (-2073.548) (-2086.432) [-2081.579] * (-2077.952) (-2078.898) [-2079.218] (-2085.022) -- 0:04:11
119000 -- (-2079.789) [-2076.194] (-2088.708) (-2083.292) * (-2073.912) (-2074.873) [-2076.511] (-2086.076) -- 0:04:11
Average standard deviation of split frequencies: 0.007570
119100 -- (-2084.963) [-2074.109] (-2083.587) (-2081.713) * (-2078.413) [-2079.080] (-2083.759) (-2085.362) -- 0:04:11
119200 -- (-2081.021) (-2076.764) (-2083.421) [-2074.613] * (-2074.295) (-2077.392) (-2090.082) [-2078.135] -- 0:04:11
119300 -- (-2087.404) [-2074.635] (-2079.432) (-2081.279) * [-2071.909] (-2076.048) (-2085.501) (-2080.504) -- 0:04:10
119400 -- [-2077.924] (-2075.913) (-2083.958) (-2079.922) * (-2074.017) [-2080.994] (-2095.767) (-2086.087) -- 0:04:10
119500 -- (-2079.099) [-2075.003] (-2076.043) (-2079.401) * [-2078.225] (-2082.987) (-2089.460) (-2082.511) -- 0:04:10
119600 -- (-2083.940) [-2076.698] (-2082.298) (-2075.904) * (-2075.363) (-2087.739) [-2084.420] (-2090.181) -- 0:04:10
119700 -- (-2082.378) (-2073.042) [-2072.716] (-2087.894) * [-2070.247] (-2090.332) (-2082.739) (-2086.735) -- 0:04:10
119800 -- (-2078.046) (-2081.216) [-2073.022] (-2099.935) * [-2070.369] (-2079.897) (-2082.327) (-2086.116) -- 0:04:09
119900 -- (-2079.345) [-2069.274] (-2073.135) (-2084.310) * (-2069.528) [-2080.865] (-2079.117) (-2081.116) -- 0:04:09
120000 -- (-2091.787) [-2075.040] (-2074.470) (-2093.856) * [-2071.862] (-2076.570) (-2078.110) (-2090.294) -- 0:04:09
Average standard deviation of split frequencies: 0.007624
120100 -- (-2081.207) (-2074.642) [-2077.971] (-2087.443) * (-2081.167) (-2077.337) (-2075.974) [-2088.079] -- 0:04:09
120200 -- [-2078.198] (-2079.455) (-2074.057) (-2085.113) * (-2084.937) (-2078.337) (-2078.336) [-2083.031] -- 0:04:08
120300 -- [-2081.534] (-2079.202) (-2078.829) (-2082.223) * (-2077.743) [-2076.210] (-2077.352) (-2077.395) -- 0:04:08
120400 -- (-2087.967) [-2069.729] (-2077.127) (-2080.814) * (-2074.343) [-2082.150] (-2083.689) (-2075.923) -- 0:04:08
120500 -- (-2085.060) (-2073.247) [-2071.460] (-2074.946) * [-2073.244] (-2084.926) (-2083.105) (-2079.914) -- 0:04:08
120600 -- (-2080.397) [-2072.401] (-2074.751) (-2076.514) * [-2067.651] (-2081.702) (-2085.692) (-2085.747) -- 0:04:07
120700 -- (-2078.426) [-2074.811] (-2078.443) (-2077.421) * [-2066.460] (-2080.978) (-2083.672) (-2082.042) -- 0:04:07
120800 -- (-2079.612) (-2074.988) [-2078.596] (-2090.603) * (-2068.208) (-2081.116) [-2080.795] (-2083.764) -- 0:04:07
120900 -- (-2076.958) (-2079.080) [-2075.160] (-2078.592) * [-2068.148] (-2083.019) (-2092.246) (-2082.930) -- 0:04:07
121000 -- (-2091.887) (-2077.370) [-2079.836] (-2078.809) * [-2071.857] (-2072.797) (-2092.856) (-2084.497) -- 0:04:06
Average standard deviation of split frequencies: 0.008668
121100 -- (-2080.987) (-2078.631) (-2077.194) [-2073.886] * (-2073.604) (-2082.105) (-2087.740) [-2076.139] -- 0:04:06
121200 -- (-2090.217) (-2075.363) [-2074.183] (-2074.431) * [-2068.199] (-2077.712) (-2082.949) (-2080.936) -- 0:04:06
121300 -- (-2087.232) [-2077.284] (-2078.947) (-2077.356) * (-2074.574) [-2076.151] (-2087.902) (-2090.396) -- 0:04:06
121400 -- (-2082.320) (-2076.158) [-2079.856] (-2089.388) * [-2067.942] (-2075.116) (-2091.769) (-2084.778) -- 0:04:06
121500 -- (-2075.967) (-2072.875) (-2087.302) [-2084.018] * [-2069.227] (-2078.971) (-2086.988) (-2082.697) -- 0:04:05
121600 -- [-2073.914] (-2075.917) (-2088.753) (-2087.592) * (-2083.724) [-2080.396] (-2077.525) (-2081.078) -- 0:04:05
121700 -- (-2074.039) [-2070.900] (-2082.267) (-2081.158) * [-2077.941] (-2077.240) (-2080.874) (-2081.013) -- 0:04:05
121800 -- [-2074.135] (-2074.653) (-2072.143) (-2084.207) * (-2074.428) [-2074.520] (-2083.272) (-2086.539) -- 0:04:05
121900 -- [-2075.982] (-2074.336) (-2081.032) (-2082.843) * [-2076.436] (-2078.021) (-2083.572) (-2083.332) -- 0:04:04
122000 -- [-2076.360] (-2070.728) (-2078.746) (-2083.475) * [-2073.224] (-2083.792) (-2088.437) (-2079.491) -- 0:04:04
Average standard deviation of split frequencies: 0.009153
122100 -- [-2074.000] (-2076.967) (-2082.113) (-2088.777) * [-2071.471] (-2084.761) (-2106.608) (-2083.766) -- 0:04:04
122200 -- [-2074.566] (-2073.858) (-2083.892) (-2082.702) * [-2072.951] (-2075.109) (-2090.310) (-2079.924) -- 0:04:04
122300 -- (-2086.218) (-2075.956) (-2078.006) [-2075.695] * [-2074.804] (-2075.916) (-2083.098) (-2075.049) -- 0:04:04
122400 -- (-2086.358) (-2072.531) (-2078.167) [-2075.677] * (-2076.484) [-2075.577] (-2080.031) (-2076.598) -- 0:04:03
122500 -- (-2086.447) (-2087.024) (-2078.004) [-2080.347] * [-2077.040] (-2079.380) (-2084.111) (-2078.050) -- 0:04:10
122600 -- (-2089.799) [-2074.501] (-2076.383) (-2086.969) * (-2070.998) (-2083.710) (-2083.502) [-2074.663] -- 0:04:10
122700 -- (-2085.246) (-2072.659) [-2073.826] (-2081.824) * (-2075.801) (-2074.847) (-2083.321) [-2081.573] -- 0:04:10
122800 -- (-2086.990) (-2080.407) [-2068.903] (-2081.526) * (-2073.017) (-2080.626) (-2078.260) [-2076.648] -- 0:04:10
122900 -- [-2080.664] (-2076.670) (-2077.896) (-2087.388) * (-2081.943) (-2082.365) [-2079.098] (-2079.479) -- 0:04:09
123000 -- (-2078.243) (-2078.154) [-2070.935] (-2085.499) * (-2075.744) (-2079.154) [-2086.144] (-2076.577) -- 0:04:09
Average standard deviation of split frequencies: 0.007762
123100 -- [-2073.492] (-2083.934) (-2068.639) (-2078.718) * (-2071.069) (-2081.326) (-2080.271) [-2076.457] -- 0:04:09
123200 -- (-2084.595) (-2085.727) [-2072.616] (-2091.757) * [-2068.274] (-2084.042) (-2087.796) (-2076.173) -- 0:04:09
123300 -- (-2081.965) (-2084.907) [-2068.742] (-2084.864) * (-2074.498) [-2076.772] (-2085.422) (-2076.784) -- 0:04:08
123400 -- (-2083.900) (-2087.650) [-2072.380] (-2085.914) * (-2074.800) (-2077.587) (-2083.154) [-2077.033] -- 0:04:08
123500 -- (-2076.356) (-2080.966) [-2073.246] (-2083.934) * (-2081.662) [-2080.298] (-2077.978) (-2078.968) -- 0:04:08
123600 -- (-2075.545) (-2078.693) [-2071.399] (-2082.280) * (-2075.517) (-2077.620) (-2080.370) [-2076.625] -- 0:04:08
123700 -- (-2078.915) (-2079.770) [-2072.211] (-2079.254) * (-2072.391) (-2082.348) [-2081.265] (-2081.505) -- 0:04:07
123800 -- [-2077.982] (-2090.174) (-2074.224) (-2078.833) * [-2068.289] (-2081.012) (-2081.261) (-2075.007) -- 0:04:07
123900 -- (-2077.639) (-2077.006) [-2071.080] (-2080.566) * [-2070.144] (-2085.564) (-2084.858) (-2077.886) -- 0:04:07
124000 -- (-2093.008) (-2084.399) (-2072.430) [-2079.619] * (-2072.468) (-2083.417) (-2094.808) [-2073.264] -- 0:04:07
Average standard deviation of split frequencies: 0.006836
124100 -- (-2090.785) (-2081.456) [-2073.981] (-2076.381) * (-2082.789) (-2095.283) (-2087.900) [-2075.172] -- 0:04:07
124200 -- (-2093.242) [-2072.497] (-2078.185) (-2075.965) * [-2070.446] (-2084.107) (-2088.024) (-2077.801) -- 0:04:06
124300 -- (-2079.742) (-2072.383) [-2073.714] (-2078.338) * (-2075.483) (-2089.248) (-2092.060) [-2076.246] -- 0:04:06
124400 -- (-2083.306) (-2082.875) [-2070.850] (-2082.202) * [-2080.465] (-2081.974) (-2090.482) (-2071.660) -- 0:04:06
124500 -- [-2080.873] (-2097.567) (-2075.271) (-2084.381) * (-2083.251) (-2081.929) (-2096.041) [-2074.396] -- 0:04:06
124600 -- (-2078.139) (-2084.047) [-2077.115] (-2087.176) * [-2073.627] (-2082.281) (-2082.748) (-2074.197) -- 0:04:05
124700 -- (-2082.166) [-2075.051] (-2076.960) (-2083.042) * (-2072.952) (-2082.680) [-2080.978] (-2075.904) -- 0:04:05
124800 -- (-2078.844) (-2085.775) [-2073.940] (-2087.802) * (-2080.338) (-2088.845) (-2082.878) [-2080.145] -- 0:04:05
124900 -- (-2075.303) [-2077.158] (-2076.608) (-2086.365) * (-2081.604) (-2080.350) (-2083.179) [-2077.647] -- 0:04:05
125000 -- (-2075.676) (-2070.858) [-2074.979] (-2086.708) * (-2086.284) [-2075.541] (-2083.376) (-2075.677) -- 0:04:04
Average standard deviation of split frequencies: 0.007208
125100 -- (-2076.689) [-2071.643] (-2074.370) (-2085.091) * (-2078.347) [-2076.745] (-2079.772) (-2078.793) -- 0:04:04
125200 -- (-2077.645) (-2070.530) (-2079.734) [-2078.215] * (-2075.082) (-2076.715) (-2085.749) [-2073.928] -- 0:04:04
125300 -- (-2082.797) (-2069.200) (-2076.101) [-2076.796] * (-2077.885) [-2075.752] (-2079.383) (-2079.812) -- 0:04:04
125400 -- (-2079.545) [-2073.660] (-2078.506) (-2075.242) * (-2078.251) [-2078.534] (-2079.106) (-2080.851) -- 0:04:04
125500 -- (-2081.944) [-2072.571] (-2088.172) (-2081.873) * (-2079.218) (-2075.116) (-2103.589) [-2070.209] -- 0:04:03
125600 -- (-2076.171) (-2072.524) (-2083.141) [-2076.402] * (-2080.228) [-2074.545] (-2080.231) (-2076.969) -- 0:04:03
125700 -- (-2075.509) (-2077.718) (-2082.183) [-2073.773] * (-2091.702) [-2071.695] (-2085.732) (-2072.761) -- 0:04:03
125800 -- (-2083.061) (-2082.011) (-2077.637) [-2078.747] * (-2077.573) [-2071.583] (-2080.275) (-2073.970) -- 0:04:03
125900 -- (-2083.605) (-2076.178) (-2079.206) [-2074.948] * (-2081.143) (-2075.742) (-2078.403) [-2076.504] -- 0:04:02
126000 -- (-2098.771) [-2076.989] (-2094.969) (-2078.950) * (-2080.699) [-2080.711] (-2079.834) (-2081.794) -- 0:04:02
Average standard deviation of split frequencies: 0.007902
126100 -- (-2100.978) [-2072.341] (-2089.225) (-2076.729) * (-2074.666) [-2076.537] (-2086.076) (-2078.944) -- 0:04:09
126200 -- (-2084.860) (-2076.085) (-2084.798) [-2074.293] * (-2076.966) (-2079.028) [-2077.520] (-2075.275) -- 0:04:09
126300 -- (-2078.509) (-2081.389) (-2090.605) [-2077.657] * [-2075.417] (-2086.443) (-2077.128) (-2080.036) -- 0:04:09
126400 -- [-2076.761] (-2086.558) (-2097.778) (-2082.278) * (-2073.458) (-2077.298) [-2076.127] (-2080.188) -- 0:04:08
126500 -- (-2084.003) (-2075.170) (-2091.277) [-2079.556] * (-2081.668) (-2079.127) [-2076.878] (-2076.956) -- 0:04:08
126600 -- (-2077.238) [-2071.729] (-2087.522) (-2087.062) * (-2077.796) (-2079.826) (-2079.998) [-2077.001] -- 0:04:08
126700 -- (-2075.775) [-2075.465] (-2089.182) (-2077.600) * (-2077.273) [-2076.651] (-2077.302) (-2081.351) -- 0:04:08
126800 -- (-2076.903) [-2075.469] (-2088.273) (-2077.458) * (-2075.323) (-2073.677) [-2079.528] (-2074.927) -- 0:04:07
126900 -- (-2086.534) (-2078.402) (-2086.243) [-2078.750] * [-2070.637] (-2079.302) (-2084.173) (-2076.086) -- 0:04:07
127000 -- (-2073.679) [-2074.535] (-2081.214) (-2082.415) * [-2073.708] (-2078.383) (-2080.859) (-2079.874) -- 0:04:07
Average standard deviation of split frequencies: 0.008153
127100 -- (-2079.677) [-2072.240] (-2082.772) (-2086.828) * [-2072.516] (-2084.247) (-2083.979) (-2073.377) -- 0:04:07
127200 -- (-2076.869) (-2074.920) [-2074.819] (-2092.605) * [-2074.564] (-2095.377) (-2075.375) (-2082.957) -- 0:04:07
127300 -- [-2076.268] (-2074.452) (-2071.466) (-2091.260) * [-2074.885] (-2081.962) (-2077.950) (-2083.429) -- 0:04:06
127400 -- (-2090.235) (-2071.833) [-2074.801] (-2082.521) * [-2075.962] (-2077.160) (-2078.054) (-2088.168) -- 0:04:06
127500 -- (-2076.293) [-2074.196] (-2077.397) (-2074.167) * (-2078.222) [-2068.709] (-2080.232) (-2081.998) -- 0:04:06
127600 -- (-2079.971) [-2074.464] (-2079.568) (-2075.817) * (-2074.676) (-2070.582) (-2080.633) [-2073.282] -- 0:04:06
127700 -- (-2077.010) [-2075.717] (-2076.427) (-2079.840) * [-2070.472] (-2078.052) (-2088.656) (-2088.328) -- 0:04:05
127800 -- (-2080.282) (-2072.826) [-2069.549] (-2087.377) * (-2079.403) (-2074.281) [-2073.770] (-2087.402) -- 0:04:05
127900 -- (-2081.452) (-2082.405) [-2072.497] (-2076.909) * (-2080.995) (-2074.891) [-2074.187] (-2085.770) -- 0:04:05
128000 -- (-2079.406) [-2075.381] (-2079.145) (-2081.798) * (-2082.089) (-2075.910) (-2078.793) [-2087.110] -- 0:04:05
Average standard deviation of split frequencies: 0.007148
128100 -- (-2086.973) [-2067.394] (-2079.464) (-2081.312) * [-2068.428] (-2080.015) (-2075.701) (-2093.092) -- 0:04:05
128200 -- (-2083.339) [-2069.846] (-2071.451) (-2076.400) * (-2073.468) (-2082.756) [-2077.993] (-2091.841) -- 0:04:04
128300 -- (-2087.258) [-2076.269] (-2076.632) (-2079.834) * [-2076.150] (-2076.082) (-2074.981) (-2083.568) -- 0:04:04
128400 -- (-2089.793) (-2074.046) [-2071.746] (-2091.180) * (-2079.164) (-2079.034) [-2074.755] (-2097.884) -- 0:04:04
128500 -- [-2079.711] (-2075.225) (-2070.363) (-2086.026) * [-2074.462] (-2076.057) (-2084.370) (-2096.768) -- 0:04:04
128600 -- (-2077.916) (-2076.823) [-2075.241] (-2078.960) * (-2073.636) [-2072.124] (-2084.433) (-2086.122) -- 0:04:03
128700 -- [-2074.045] (-2068.770) (-2070.767) (-2091.789) * [-2076.682] (-2076.385) (-2084.965) (-2090.121) -- 0:04:03
128800 -- (-2081.045) [-2069.960] (-2076.100) (-2080.910) * (-2078.137) [-2077.745] (-2086.721) (-2089.775) -- 0:04:03
128900 -- (-2087.371) (-2068.793) [-2073.804] (-2074.643) * [-2072.963] (-2077.733) (-2079.643) (-2079.069) -- 0:04:03
129000 -- (-2089.158) (-2087.223) [-2069.205] (-2074.767) * (-2072.043) (-2084.742) [-2075.233] (-2084.572) -- 0:04:03
Average standard deviation of split frequencies: 0.007193
129100 -- (-2083.320) (-2072.881) [-2067.210] (-2084.360) * [-2071.733] (-2081.647) (-2084.433) (-2093.255) -- 0:04:02
129200 -- (-2088.458) [-2074.782] (-2070.137) (-2083.358) * (-2072.001) [-2078.539] (-2087.764) (-2102.172) -- 0:04:02
129300 -- (-2078.263) (-2085.340) [-2076.944] (-2093.124) * [-2073.567] (-2072.656) (-2087.020) (-2088.799) -- 0:04:02
129400 -- [-2072.682] (-2075.796) (-2083.094) (-2079.490) * [-2080.643] (-2080.110) (-2080.996) (-2086.675) -- 0:04:02
129500 -- (-2076.791) [-2077.145] (-2070.932) (-2079.510) * (-2078.207) (-2080.445) (-2080.138) [-2082.267] -- 0:04:01
129600 -- (-2079.563) (-2080.453) (-2072.349) [-2079.021] * (-2080.251) (-2079.566) [-2080.507] (-2086.722) -- 0:04:08
129700 -- [-2073.580] (-2082.309) (-2074.457) (-2081.571) * [-2074.055] (-2078.730) (-2085.857) (-2082.112) -- 0:04:08
129800 -- (-2094.229) (-2074.246) [-2074.782] (-2082.210) * (-2076.575) (-2085.317) (-2089.338) [-2079.281] -- 0:04:08
129900 -- (-2092.618) (-2081.340) [-2071.746] (-2079.680) * [-2071.037] (-2083.691) (-2087.216) (-2077.899) -- 0:04:07
130000 -- (-2086.155) [-2069.550] (-2068.200) (-2071.304) * (-2074.862) (-2084.795) (-2087.708) [-2084.040] -- 0:04:07
Average standard deviation of split frequencies: 0.008280
130100 -- (-2084.193) [-2076.195] (-2070.054) (-2074.159) * (-2082.762) (-2090.970) (-2084.332) [-2080.630] -- 0:04:07
130200 -- (-2081.084) [-2071.084] (-2074.055) (-2080.597) * (-2074.924) [-2081.551] (-2093.133) (-2076.136) -- 0:04:07
130300 -- (-2085.246) (-2073.060) [-2074.812] (-2080.738) * (-2076.781) (-2080.790) (-2085.582) [-2074.459] -- 0:04:06
130400 -- (-2082.161) (-2073.229) [-2075.672] (-2076.432) * (-2074.474) [-2074.972] (-2088.526) (-2081.622) -- 0:04:06
130500 -- (-2082.890) (-2077.310) [-2078.592] (-2081.076) * [-2072.377] (-2078.665) (-2096.669) (-2074.713) -- 0:04:06
130600 -- (-2083.680) (-2072.967) (-2083.363) [-2076.911] * (-2071.810) (-2080.120) (-2079.037) [-2076.745] -- 0:04:06
130700 -- (-2086.403) [-2071.594] (-2076.265) (-2087.534) * [-2073.177] (-2075.629) (-2080.043) (-2079.712) -- 0:04:06
130800 -- (-2080.439) [-2076.466] (-2081.005) (-2083.871) * [-2072.649] (-2077.365) (-2077.963) (-2083.617) -- 0:04:05
130900 -- [-2073.919] (-2072.715) (-2082.356) (-2081.388) * [-2069.055] (-2085.169) (-2093.736) (-2074.456) -- 0:04:05
131000 -- (-2093.132) (-2075.203) (-2078.828) [-2075.412] * [-2070.176] (-2085.193) (-2088.862) (-2088.422) -- 0:04:05
Average standard deviation of split frequencies: 0.008315
131100 -- (-2089.202) (-2072.869) (-2078.738) [-2074.132] * (-2083.293) (-2082.901) (-2085.422) [-2075.773] -- 0:04:05
131200 -- (-2082.882) [-2075.848] (-2085.475) (-2077.012) * (-2077.772) [-2071.877] (-2086.942) (-2082.799) -- 0:04:05
131300 -- (-2081.181) [-2071.825] (-2087.016) (-2074.432) * [-2072.315] (-2079.971) (-2086.706) (-2084.844) -- 0:04:04
131400 -- (-2082.653) (-2076.540) (-2077.697) [-2080.853] * [-2073.426] (-2076.543) (-2084.717) (-2079.955) -- 0:04:04
131500 -- [-2082.432] (-2075.615) (-2085.310) (-2077.392) * (-2073.445) [-2078.200] (-2077.792) (-2078.962) -- 0:04:04
131600 -- (-2081.007) [-2069.722] (-2071.728) (-2085.562) * (-2077.389) [-2079.269] (-2080.907) (-2086.959) -- 0:04:04
131700 -- (-2079.109) [-2071.068] (-2074.611) (-2084.510) * [-2081.302] (-2083.678) (-2082.039) (-2083.196) -- 0:04:03
131800 -- (-2086.747) (-2072.951) [-2083.479] (-2088.417) * (-2071.577) (-2082.812) [-2079.095] (-2083.963) -- 0:04:03
131900 -- (-2078.900) (-2077.181) [-2078.229] (-2086.349) * [-2074.286] (-2081.869) (-2071.637) (-2081.976) -- 0:04:03
132000 -- [-2073.576] (-2081.328) (-2075.367) (-2086.058) * [-2073.612] (-2088.025) (-2074.888) (-2081.399) -- 0:04:03
Average standard deviation of split frequencies: 0.007951
132100 -- (-2074.919) (-2079.917) [-2077.030] (-2076.417) * [-2077.012] (-2078.019) (-2075.643) (-2084.997) -- 0:04:03
132200 -- (-2077.118) [-2079.941] (-2093.807) (-2086.852) * (-2081.460) [-2077.751] (-2080.421) (-2092.133) -- 0:04:02
132300 -- (-2081.788) (-2080.912) (-2084.100) [-2082.693] * [-2077.882] (-2076.990) (-2077.991) (-2090.082) -- 0:04:02
132400 -- (-2081.280) [-2086.734] (-2082.216) (-2079.533) * [-2070.951] (-2076.863) (-2079.180) (-2077.532) -- 0:04:02
132500 -- (-2081.770) (-2090.157) [-2071.191] (-2077.983) * (-2076.042) (-2083.061) (-2085.231) [-2077.659] -- 0:04:02
132600 -- (-2078.635) (-2087.190) [-2075.431] (-2075.128) * [-2069.717] (-2081.587) (-2087.032) (-2077.075) -- 0:04:02
132700 -- [-2072.214] (-2084.666) (-2081.018) (-2079.631) * (-2075.219) (-2075.861) [-2077.441] (-2082.341) -- 0:04:01
132800 -- [-2073.263] (-2086.302) (-2077.719) (-2075.284) * [-2068.217] (-2080.022) (-2085.652) (-2082.843) -- 0:04:01
132900 -- [-2075.944] (-2090.572) (-2093.685) (-2077.585) * [-2069.431] (-2076.138) (-2078.624) (-2088.692) -- 0:04:01
133000 -- (-2079.499) (-2093.751) (-2091.284) [-2076.260] * (-2075.343) [-2073.774] (-2075.423) (-2083.930) -- 0:04:01
Average standard deviation of split frequencies: 0.008393
133100 -- (-2078.987) (-2084.938) (-2082.932) [-2074.372] * [-2074.019] (-2077.268) (-2077.223) (-2075.558) -- 0:04:00
133200 -- [-2079.520] (-2091.361) (-2082.260) (-2087.340) * (-2078.129) (-2081.618) [-2075.028] (-2076.996) -- 0:04:07
133300 -- (-2083.754) (-2083.552) (-2083.800) [-2074.484] * [-2078.587] (-2080.197) (-2076.691) (-2074.749) -- 0:04:07
133400 -- (-2079.941) (-2080.300) (-2081.856) [-2073.880] * (-2079.812) [-2073.937] (-2079.897) (-2081.364) -- 0:04:06
133500 -- (-2073.970) (-2075.089) (-2077.093) [-2074.697] * [-2077.998] (-2074.594) (-2077.887) (-2080.970) -- 0:04:06
133600 -- (-2079.089) [-2077.148] (-2076.335) (-2080.887) * (-2078.427) (-2076.163) [-2073.436] (-2076.648) -- 0:04:06
133700 -- (-2085.447) [-2083.343] (-2085.702) (-2078.446) * (-2081.413) (-2077.175) [-2076.676] (-2077.920) -- 0:04:06
133800 -- [-2076.634] (-2073.555) (-2074.369) (-2080.640) * [-2074.116] (-2077.767) (-2076.824) (-2078.507) -- 0:04:06
133900 -- (-2079.542) [-2072.051] (-2074.995) (-2084.234) * [-2078.343] (-2077.483) (-2080.122) (-2078.642) -- 0:04:05
134000 -- (-2080.750) [-2071.113] (-2079.347) (-2085.605) * [-2078.240] (-2083.808) (-2081.400) (-2084.625) -- 0:04:05
Average standard deviation of split frequencies: 0.008535
134100 -- [-2084.762] (-2076.803) (-2080.781) (-2092.253) * (-2078.863) (-2085.009) (-2079.220) [-2076.352] -- 0:04:05
134200 -- (-2081.154) [-2076.736] (-2076.838) (-2084.582) * [-2075.856] (-2079.548) (-2095.428) (-2086.165) -- 0:04:05
134300 -- (-2075.380) (-2071.275) [-2069.919] (-2082.634) * [-2077.778] (-2079.253) (-2082.173) (-2081.529) -- 0:04:04
134400 -- (-2080.239) (-2075.720) [-2072.433] (-2075.259) * (-2080.292) [-2080.276] (-2082.231) (-2084.681) -- 0:04:04
134500 -- (-2085.239) (-2074.085) [-2070.568] (-2078.500) * (-2076.703) (-2074.566) [-2081.343] (-2090.777) -- 0:04:04
134600 -- (-2083.354) (-2073.205) [-2068.388] (-2079.705) * [-2076.657] (-2081.034) (-2087.124) (-2086.292) -- 0:04:04
134700 -- (-2085.553) (-2075.345) [-2070.316] (-2092.389) * [-2073.515] (-2088.794) (-2094.061) (-2086.049) -- 0:04:04
134800 -- (-2087.130) (-2072.476) [-2071.701] (-2087.824) * [-2076.323] (-2082.443) (-2092.691) (-2088.878) -- 0:04:03
134900 -- (-2094.932) [-2073.839] (-2078.019) (-2086.550) * [-2078.512] (-2083.525) (-2080.947) (-2085.838) -- 0:04:03
135000 -- (-2087.189) [-2072.422] (-2080.852) (-2084.058) * (-2084.588) (-2089.288) (-2083.059) [-2083.775] -- 0:04:03
Average standard deviation of split frequencies: 0.008866
135100 -- (-2083.142) (-2070.689) [-2076.223] (-2079.572) * [-2074.980] (-2082.172) (-2084.965) (-2086.711) -- 0:04:03
135200 -- (-2081.790) [-2072.521] (-2081.653) (-2080.542) * [-2074.352] (-2084.814) (-2084.982) (-2085.134) -- 0:04:03
135300 -- [-2078.259] (-2071.841) (-2077.333) (-2077.453) * (-2081.119) [-2081.081] (-2084.737) (-2084.072) -- 0:04:02
135400 -- (-2088.275) [-2068.334] (-2074.536) (-2075.136) * (-2078.884) (-2083.455) (-2081.262) [-2077.488] -- 0:04:02
135500 -- [-2071.672] (-2073.823) (-2073.412) (-2080.465) * [-2076.025] (-2082.482) (-2085.632) (-2083.217) -- 0:04:02
135600 -- (-2077.360) (-2078.487) (-2073.177) [-2073.883] * [-2077.363] (-2086.130) (-2092.643) (-2081.947) -- 0:04:02
135700 -- (-2078.018) (-2083.483) [-2077.275] (-2078.209) * (-2084.228) (-2083.329) (-2099.825) [-2079.166] -- 0:04:02
135800 -- (-2080.228) [-2077.127] (-2081.187) (-2085.654) * (-2077.835) (-2084.053) (-2080.166) [-2078.877] -- 0:04:01
135900 -- (-2075.829) (-2079.291) [-2072.513] (-2079.584) * [-2073.591] (-2084.723) (-2078.321) (-2082.581) -- 0:04:01
136000 -- (-2089.857) (-2079.875) [-2071.697] (-2081.153) * (-2080.526) (-2093.713) (-2076.271) [-2079.274] -- 0:04:01
Average standard deviation of split frequencies: 0.008509
136100 -- (-2082.172) [-2072.449] (-2071.095) (-2085.125) * (-2083.673) (-2083.021) [-2081.210] (-2084.813) -- 0:04:01
136200 -- [-2077.139] (-2076.024) (-2073.247) (-2086.468) * [-2084.031] (-2078.353) (-2078.427) (-2084.447) -- 0:04:01
136300 -- (-2078.586) (-2073.914) [-2072.739] (-2094.252) * (-2080.770) (-2083.484) (-2076.122) [-2075.585] -- 0:04:00
136400 -- (-2082.835) [-2069.936] (-2071.575) (-2086.398) * (-2080.943) (-2076.358) (-2075.568) [-2070.151] -- 0:04:00
136500 -- (-2089.355) [-2069.888] (-2081.363) (-2085.160) * [-2075.612] (-2081.892) (-2082.823) (-2095.308) -- 0:04:00
136600 -- (-2081.130) (-2069.812) (-2075.635) [-2078.854] * [-2076.822] (-2082.984) (-2080.806) (-2086.626) -- 0:04:00
136700 -- (-2079.213) (-2069.230) [-2073.977] (-2083.790) * (-2082.522) (-2077.463) (-2080.437) [-2076.540] -- 0:04:06
136800 -- (-2089.458) [-2073.689] (-2079.875) (-2089.381) * (-2079.175) [-2079.660] (-2084.965) (-2082.977) -- 0:04:06
136900 -- (-2085.753) [-2075.779] (-2089.831) (-2083.076) * (-2085.029) [-2080.761] (-2081.021) (-2083.853) -- 0:04:05
137000 -- (-2077.311) (-2077.868) [-2081.709] (-2088.325) * (-2088.029) (-2081.012) [-2074.200] (-2076.598) -- 0:04:05
Average standard deviation of split frequencies: 0.008835
137100 -- [-2083.123] (-2078.409) (-2077.759) (-2081.109) * (-2081.808) (-2080.872) (-2078.398) [-2074.240] -- 0:04:05
137200 -- (-2077.350) (-2075.975) (-2087.433) [-2073.954] * (-2077.972) (-2083.993) (-2076.450) [-2076.027] -- 0:04:05
137300 -- (-2086.200) [-2073.254] (-2078.006) (-2076.781) * (-2084.959) (-2081.555) [-2075.429] (-2071.348) -- 0:04:05
137400 -- (-2083.822) [-2073.103] (-2087.016) (-2080.471) * (-2086.054) (-2084.267) [-2076.518] (-2071.113) -- 0:04:04
137500 -- (-2078.320) [-2071.162] (-2082.573) (-2085.793) * (-2074.388) (-2080.010) [-2072.317] (-2073.179) -- 0:04:04
137600 -- (-2077.519) [-2068.906] (-2072.799) (-2081.978) * (-2073.821) (-2078.589) [-2080.749] (-2084.421) -- 0:04:04
137700 -- (-2077.896) (-2073.506) [-2077.074] (-2080.282) * [-2074.939] (-2082.722) (-2078.373) (-2083.687) -- 0:04:04
137800 -- (-2081.775) [-2070.761] (-2074.832) (-2077.101) * (-2073.448) (-2077.303) [-2072.880] (-2072.898) -- 0:04:04
137900 -- (-2092.947) (-2077.987) [-2069.672] (-2079.346) * (-2074.086) (-2085.447) (-2074.951) [-2077.042] -- 0:04:03
138000 -- (-2092.197) (-2079.566) [-2071.913] (-2079.434) * [-2076.763] (-2082.726) (-2090.942) (-2076.181) -- 0:04:03
Average standard deviation of split frequencies: 0.008873
138100 -- (-2076.178) (-2073.886) [-2074.137] (-2081.693) * (-2075.754) (-2081.677) (-2090.445) [-2073.586] -- 0:04:03
138200 -- (-2079.620) [-2075.931] (-2073.480) (-2084.129) * (-2077.829) (-2079.013) (-2077.000) [-2077.821] -- 0:04:03
138300 -- (-2101.501) (-2071.539) [-2069.926] (-2079.361) * (-2077.779) (-2090.012) (-2076.426) [-2072.257] -- 0:04:02
138400 -- (-2097.022) (-2071.344) [-2068.062] (-2080.690) * (-2078.773) (-2080.936) (-2074.938) [-2071.015] -- 0:04:02
138500 -- (-2078.894) [-2068.774] (-2073.616) (-2081.528) * (-2079.733) (-2078.164) (-2071.866) [-2069.318] -- 0:04:02
138600 -- (-2079.928) (-2077.636) (-2072.975) [-2079.516] * (-2083.443) (-2076.598) [-2076.617] (-2073.180) -- 0:04:02
138700 -- (-2085.870) [-2076.448] (-2075.198) (-2078.801) * [-2077.643] (-2078.368) (-2085.878) (-2076.839) -- 0:04:02
138800 -- [-2074.651] (-2075.024) (-2077.308) (-2087.800) * (-2079.500) (-2075.064) (-2082.091) [-2075.891] -- 0:04:01
138900 -- [-2075.492] (-2082.722) (-2083.943) (-2077.329) * (-2087.143) (-2078.038) (-2088.851) [-2073.934] -- 0:04:01
139000 -- (-2074.009) (-2078.006) [-2072.271] (-2083.773) * (-2087.300) (-2081.624) (-2085.697) [-2073.797] -- 0:04:01
Average standard deviation of split frequencies: 0.008611
139100 -- (-2075.412) (-2079.680) [-2073.415] (-2083.640) * (-2081.794) (-2083.811) (-2080.613) [-2072.208] -- 0:04:01
139200 -- (-2078.682) (-2077.755) [-2073.087] (-2088.321) * (-2090.404) [-2072.232] (-2077.944) (-2077.027) -- 0:04:01
139300 -- [-2079.293] (-2078.369) (-2070.351) (-2083.794) * (-2087.178) (-2077.154) [-2072.219] (-2077.491) -- 0:04:00
139400 -- (-2085.042) (-2073.032) [-2070.067] (-2079.497) * (-2080.725) [-2074.477] (-2076.829) (-2077.396) -- 0:04:00
139500 -- (-2077.122) (-2087.729) (-2071.677) [-2078.636] * (-2089.686) [-2078.239] (-2074.783) (-2071.177) -- 0:04:00
139600 -- (-2083.771) (-2088.871) [-2071.629] (-2077.847) * (-2089.431) (-2092.963) (-2075.839) [-2069.130] -- 0:04:00
139700 -- (-2085.516) (-2081.138) (-2073.910) [-2075.554] * (-2080.953) (-2076.276) (-2073.345) [-2069.338] -- 0:04:00
139800 -- (-2095.430) (-2075.326) [-2080.100] (-2082.457) * (-2081.918) (-2080.311) (-2081.557) [-2072.500] -- 0:03:59
139900 -- (-2094.511) [-2073.837] (-2078.205) (-2084.790) * [-2080.553] (-2082.977) (-2075.801) (-2071.920) -- 0:03:59
140000 -- (-2086.253) (-2077.932) [-2074.642] (-2088.132) * (-2084.836) (-2079.771) (-2080.585) [-2079.627] -- 0:03:59
Average standard deviation of split frequencies: 0.009131
140100 -- (-2076.644) (-2083.017) [-2076.699] (-2077.654) * (-2073.519) (-2077.266) (-2078.824) [-2071.367] -- 0:03:59
140200 -- [-2078.222] (-2079.018) (-2080.925) (-2076.848) * [-2075.634] (-2077.915) (-2083.682) (-2070.476) -- 0:04:05
140300 -- (-2091.842) [-2071.063] (-2080.609) (-2084.196) * (-2079.598) (-2075.499) (-2072.056) [-2070.427] -- 0:04:05
140400 -- (-2087.577) (-2070.367) [-2081.935] (-2073.059) * (-2080.009) [-2078.477] (-2074.276) (-2069.500) -- 0:04:04
140500 -- (-2080.104) [-2067.231] (-2083.321) (-2079.577) * (-2075.145) (-2086.769) [-2073.711] (-2069.298) -- 0:04:04
140600 -- (-2081.771) [-2070.736] (-2094.642) (-2078.403) * (-2080.524) (-2090.910) [-2069.852] (-2073.530) -- 0:04:04
140700 -- (-2083.997) [-2070.528] (-2092.172) (-2073.808) * (-2082.456) (-2095.446) (-2076.882) [-2070.869] -- 0:04:04
140800 -- (-2088.065) (-2075.471) [-2082.141] (-2076.160) * [-2080.851] (-2089.374) (-2078.811) (-2072.265) -- 0:04:04
140900 -- (-2085.878) [-2073.109] (-2076.998) (-2071.052) * (-2091.495) (-2083.910) [-2077.610] (-2080.803) -- 0:04:03
141000 -- (-2091.365) [-2073.509] (-2080.844) (-2073.154) * (-2080.821) (-2079.109) [-2074.242] (-2082.953) -- 0:04:03
Average standard deviation of split frequencies: 0.009157
141100 -- (-2075.888) [-2073.190] (-2083.062) (-2075.278) * (-2076.693) (-2086.249) (-2078.072) [-2082.734] -- 0:04:03
141200 -- (-2078.507) [-2069.250] (-2079.617) (-2070.066) * (-2080.809) (-2077.799) [-2072.958] (-2077.764) -- 0:04:03
141300 -- (-2085.043) (-2075.778) (-2078.442) [-2075.910] * (-2079.872) (-2076.116) [-2076.125] (-2083.266) -- 0:04:03
141400 -- (-2085.416) [-2072.405] (-2078.989) (-2076.083) * (-2084.205) (-2075.800) [-2078.197] (-2080.416) -- 0:04:02
141500 -- (-2088.148) (-2069.625) [-2076.788] (-2070.264) * (-2091.363) [-2077.241] (-2077.260) (-2084.292) -- 0:04:02
141600 -- (-2075.411) (-2079.013) (-2080.142) [-2074.100] * (-2078.280) (-2081.428) [-2072.180] (-2081.915) -- 0:04:02
141700 -- (-2073.236) [-2077.503] (-2080.319) (-2079.337) * [-2076.721] (-2081.674) (-2070.929) (-2079.214) -- 0:04:02
141800 -- (-2074.756) (-2076.274) [-2071.616] (-2084.731) * (-2084.976) (-2086.373) [-2069.475] (-2075.723) -- 0:04:02
141900 -- (-2077.831) (-2081.692) [-2074.698] (-2081.650) * [-2078.548] (-2085.937) (-2073.105) (-2076.889) -- 0:04:01
142000 -- (-2077.515) (-2072.928) (-2082.939) [-2073.550] * (-2081.072) (-2078.985) [-2071.728] (-2077.401) -- 0:04:01
Average standard deviation of split frequencies: 0.009666
142100 -- (-2081.111) (-2073.398) [-2071.004] (-2076.647) * [-2072.780] (-2083.518) (-2076.220) (-2080.609) -- 0:04:01
142200 -- [-2077.187] (-2075.376) (-2070.568) (-2074.910) * (-2082.599) (-2081.485) [-2075.105] (-2084.857) -- 0:04:01
142300 -- (-2077.705) (-2072.435) [-2073.643] (-2081.889) * (-2082.244) (-2082.506) [-2077.985] (-2091.424) -- 0:04:01
142400 -- (-2080.384) [-2071.766] (-2069.828) (-2076.218) * (-2080.109) (-2080.162) [-2076.601] (-2099.700) -- 0:04:00
142500 -- (-2082.491) (-2073.488) [-2074.196] (-2082.729) * (-2079.675) (-2076.262) [-2073.493] (-2085.378) -- 0:04:00
142600 -- (-2085.186) (-2068.911) (-2071.037) [-2079.222] * (-2100.232) (-2075.276) [-2076.115] (-2079.520) -- 0:04:00
142700 -- (-2083.053) (-2069.238) [-2074.178] (-2078.012) * (-2079.921) [-2075.946] (-2068.343) (-2081.079) -- 0:04:00
142800 -- (-2083.302) [-2068.809] (-2076.122) (-2090.766) * (-2088.377) (-2077.835) [-2069.423] (-2085.022) -- 0:04:00
142900 -- [-2076.275] (-2073.323) (-2075.883) (-2081.987) * (-2087.670) [-2079.374] (-2077.332) (-2086.217) -- 0:03:59
143000 -- (-2072.637) (-2083.016) [-2075.843] (-2083.901) * (-2079.802) [-2079.489] (-2071.253) (-2091.155) -- 0:03:59
Average standard deviation of split frequencies: 0.009123
143100 -- [-2074.830] (-2071.600) (-2081.873) (-2089.947) * (-2079.840) (-2082.826) [-2072.494] (-2092.401) -- 0:03:59
143200 -- (-2073.938) [-2070.423] (-2086.541) (-2080.313) * (-2083.329) (-2076.854) [-2071.102] (-2090.051) -- 0:03:59
143300 -- (-2073.786) (-2071.922) [-2074.439] (-2082.778) * (-2085.278) (-2078.315) [-2075.642] (-2084.388) -- 0:03:59
143400 -- (-2087.638) [-2071.606] (-2073.885) (-2082.393) * (-2088.643) (-2073.005) (-2076.832) [-2078.324] -- 0:03:58
143500 -- (-2081.476) [-2069.162] (-2070.055) (-2076.760) * (-2081.682) (-2081.486) (-2085.125) [-2072.254] -- 0:03:58
143600 -- (-2092.622) [-2075.775] (-2072.587) (-2077.555) * (-2077.537) (-2086.855) (-2076.575) [-2072.942] -- 0:03:58
143700 -- (-2084.629) (-2079.231) [-2075.381] (-2076.764) * (-2081.490) (-2085.482) (-2076.509) [-2069.414] -- 0:03:58
143800 -- (-2076.791) [-2070.114] (-2073.555) (-2079.765) * (-2081.890) (-2092.207) (-2081.785) [-2072.508] -- 0:04:04
143900 -- (-2078.678) [-2070.259] (-2095.216) (-2079.438) * (-2085.088) (-2083.554) [-2071.619] (-2080.092) -- 0:04:03
144000 -- (-2076.194) [-2074.002] (-2084.593) (-2080.863) * (-2078.388) (-2091.030) [-2073.214] (-2075.942) -- 0:04:03
Average standard deviation of split frequencies: 0.010186
144100 -- (-2078.613) [-2072.235] (-2087.951) (-2077.920) * (-2080.851) (-2082.193) (-2078.201) [-2074.795] -- 0:04:03
144200 -- (-2075.601) [-2074.021] (-2082.824) (-2080.754) * (-2084.899) (-2082.955) (-2075.136) [-2073.177] -- 0:04:03
144300 -- [-2077.579] (-2083.431) (-2071.549) (-2073.877) * (-2084.762) [-2077.965] (-2074.906) (-2087.494) -- 0:04:03
144400 -- (-2074.115) (-2077.588) [-2078.965] (-2078.876) * [-2080.925] (-2080.259) (-2076.720) (-2075.242) -- 0:04:02
144500 -- (-2079.157) (-2077.001) (-2081.032) [-2075.610] * [-2076.046] (-2087.406) (-2076.388) (-2076.676) -- 0:04:02
144600 -- (-2079.217) [-2078.179] (-2078.410) (-2075.478) * (-2081.341) (-2086.185) [-2069.908] (-2076.755) -- 0:04:02
144700 -- (-2079.248) [-2077.593] (-2075.407) (-2077.399) * (-2083.673) (-2098.074) [-2067.097] (-2074.277) -- 0:04:02
144800 -- (-2080.074) (-2070.133) (-2078.166) [-2079.459] * (-2079.090) (-2092.912) [-2073.066] (-2072.046) -- 0:04:02
144900 -- (-2081.524) [-2070.566] (-2084.980) (-2073.523) * (-2087.757) (-2082.780) (-2076.615) [-2070.775] -- 0:04:01
145000 -- (-2080.770) [-2072.005] (-2083.382) (-2076.687) * (-2091.228) (-2086.314) (-2072.798) [-2074.257] -- 0:04:01
Average standard deviation of split frequencies: 0.010575
145100 -- (-2077.468) [-2071.068] (-2078.150) (-2069.144) * (-2084.733) (-2080.144) [-2079.945] (-2069.690) -- 0:04:01
145200 -- (-2071.904) [-2071.300] (-2077.615) (-2074.998) * (-2089.463) (-2085.840) (-2072.974) [-2066.110] -- 0:04:01
145300 -- (-2079.122) (-2069.858) (-2073.517) [-2070.400] * (-2078.836) (-2090.502) [-2069.184] (-2071.892) -- 0:04:01
145400 -- [-2075.283] (-2078.125) (-2074.203) (-2075.436) * (-2087.235) (-2075.760) [-2071.541] (-2074.689) -- 0:04:00
145500 -- (-2082.376) (-2083.620) [-2072.081] (-2068.884) * (-2076.062) (-2073.588) [-2072.269] (-2083.620) -- 0:04:00
145600 -- (-2079.359) (-2073.097) [-2073.237] (-2075.711) * (-2083.160) [-2074.641] (-2081.229) (-2081.157) -- 0:04:00
145700 -- [-2074.217] (-2081.990) (-2071.143) (-2074.723) * (-2078.167) (-2078.509) (-2079.701) [-2073.894] -- 0:04:00
145800 -- (-2075.629) (-2092.455) [-2071.755] (-2079.322) * (-2079.285) (-2077.180) (-2080.857) [-2074.614] -- 0:04:00
145900 -- (-2081.034) (-2079.034) [-2078.066] (-2079.102) * (-2082.506) (-2082.605) [-2067.468] (-2073.181) -- 0:04:00
146000 -- (-2083.021) (-2071.363) [-2072.769] (-2075.685) * (-2078.964) (-2081.833) [-2068.427] (-2068.082) -- 0:03:59
Average standard deviation of split frequencies: 0.009954
146100 -- (-2088.170) (-2073.768) [-2078.743] (-2082.072) * (-2078.923) (-2076.830) [-2068.204] (-2076.602) -- 0:03:59
146200 -- (-2084.432) (-2074.574) [-2073.733] (-2071.878) * (-2082.102) (-2078.307) [-2076.019] (-2077.374) -- 0:03:59
146300 -- (-2083.688) (-2079.722) (-2079.219) [-2068.874] * (-2080.127) (-2077.753) (-2078.921) [-2071.436] -- 0:03:59
146400 -- (-2082.267) [-2072.953] (-2081.552) (-2073.735) * (-2077.844) (-2082.017) [-2073.985] (-2076.536) -- 0:03:59
146500 -- (-2077.125) (-2076.534) (-2075.886) [-2073.364] * [-2068.636] (-2082.246) (-2077.362) (-2079.523) -- 0:03:58
146600 -- (-2075.681) [-2072.458] (-2071.092) (-2078.420) * [-2068.777] (-2083.313) (-2072.049) (-2076.730) -- 0:03:58
146700 -- (-2084.298) (-2075.432) (-2084.504) [-2074.800] * (-2068.193) [-2075.130] (-2075.407) (-2074.277) -- 0:03:58
146800 -- (-2081.378) (-2072.414) [-2075.849] (-2084.466) * (-2074.470) (-2086.085) (-2080.162) [-2071.817] -- 0:03:58
146900 -- (-2080.997) (-2076.718) (-2072.195) [-2074.705] * (-2086.891) [-2077.061] (-2086.183) (-2075.128) -- 0:03:58
147000 -- [-2077.260] (-2075.257) (-2076.489) (-2084.217) * (-2076.987) [-2079.002] (-2070.648) (-2083.400) -- 0:03:57
Average standard deviation of split frequencies: 0.008692
147100 -- [-2077.392] (-2080.433) (-2085.784) (-2078.369) * (-2072.709) [-2072.426] (-2068.193) (-2085.333) -- 0:03:57
147200 -- (-2074.700) (-2078.080) [-2071.383] (-2076.999) * (-2082.091) (-2079.424) [-2068.429] (-2082.585) -- 0:03:57
147300 -- (-2079.564) (-2091.338) [-2067.824] (-2081.111) * [-2070.920] (-2082.055) (-2071.461) (-2077.866) -- 0:03:57
147400 -- [-2077.551] (-2082.836) (-2073.634) (-2076.449) * (-2077.784) (-2080.916) [-2068.826] (-2085.571) -- 0:04:02
147500 -- (-2076.346) (-2082.904) [-2074.461] (-2087.327) * (-2077.166) [-2076.005] (-2072.774) (-2085.204) -- 0:04:02
147600 -- (-2077.734) (-2078.069) [-2069.898] (-2082.113) * [-2076.236] (-2072.496) (-2071.319) (-2081.700) -- 0:04:02
147700 -- (-2080.306) (-2080.316) [-2076.307] (-2072.380) * (-2081.070) (-2077.861) (-2071.529) [-2081.008] -- 0:04:02
147800 -- (-2081.818) [-2078.726] (-2078.352) (-2071.816) * (-2074.403) (-2076.338) (-2074.560) [-2077.234] -- 0:04:02
147900 -- (-2090.550) (-2081.371) (-2077.320) [-2070.759] * [-2077.021] (-2075.187) (-2072.393) (-2081.303) -- 0:04:01
148000 -- (-2086.734) (-2079.805) (-2076.827) [-2069.374] * (-2083.798) (-2075.109) [-2074.284] (-2083.960) -- 0:04:01
Average standard deviation of split frequencies: 0.008910
148100 -- (-2085.650) (-2081.044) [-2081.838] (-2069.905) * (-2084.729) [-2077.784] (-2073.816) (-2095.133) -- 0:04:01
148200 -- (-2082.685) (-2079.967) (-2077.729) [-2068.870] * (-2083.203) (-2076.205) [-2071.833] (-2080.668) -- 0:04:01
148300 -- (-2078.498) (-2075.878) (-2083.105) [-2074.721] * (-2085.179) (-2083.170) [-2072.387] (-2086.588) -- 0:04:01
148400 -- [-2078.635] (-2078.658) (-2081.599) (-2074.883) * [-2077.217] (-2087.075) (-2084.644) (-2076.650) -- 0:04:01
148500 -- (-2083.986) (-2076.465) (-2074.831) [-2071.367] * [-2078.362] (-2083.565) (-2081.312) (-2073.471) -- 0:04:00
148600 -- (-2078.402) (-2087.085) (-2074.458) [-2069.009] * (-2076.087) (-2080.527) (-2080.833) [-2070.027] -- 0:04:00
148700 -- (-2074.835) (-2077.829) (-2074.537) [-2067.550] * (-2075.391) (-2082.322) (-2079.006) [-2076.740] -- 0:04:00
148800 -- (-2088.256) [-2072.261] (-2072.182) (-2069.175) * (-2085.371) (-2078.607) [-2077.610] (-2081.586) -- 0:04:00
148900 -- (-2080.767) [-2068.898] (-2072.492) (-2068.568) * [-2077.741] (-2077.968) (-2076.861) (-2084.507) -- 0:04:00
149000 -- (-2081.326) [-2071.097] (-2074.281) (-2072.438) * (-2075.134) [-2074.641] (-2075.676) (-2081.901) -- 0:03:59
Average standard deviation of split frequencies: 0.008034
149100 -- (-2076.674) [-2075.510] (-2080.350) (-2077.718) * (-2074.784) (-2076.742) (-2071.848) [-2080.600] -- 0:03:59
149200 -- (-2073.383) [-2073.905] (-2080.292) (-2079.875) * (-2080.523) [-2073.718] (-2070.982) (-2083.668) -- 0:03:59
149300 -- [-2075.275] (-2076.329) (-2074.144) (-2085.657) * (-2079.332) (-2074.809) (-2072.026) [-2082.273] -- 0:03:59
149400 -- [-2077.481] (-2074.053) (-2077.156) (-2079.419) * [-2073.311] (-2077.704) (-2075.663) (-2079.730) -- 0:03:59
149500 -- (-2081.979) [-2067.801] (-2076.845) (-2072.180) * [-2076.654] (-2083.808) (-2080.827) (-2078.504) -- 0:03:58
149600 -- (-2086.803) [-2070.516] (-2076.451) (-2077.043) * (-2081.917) (-2078.414) (-2074.507) [-2077.843] -- 0:03:58
149700 -- (-2084.946) [-2080.186] (-2076.219) (-2075.206) * (-2080.858) [-2077.643] (-2076.604) (-2075.852) -- 0:03:58
149800 -- (-2094.031) [-2073.260] (-2082.611) (-2075.922) * (-2071.868) (-2071.381) (-2072.829) [-2071.515] -- 0:03:58
149900 -- (-2091.312) (-2075.042) (-2085.084) [-2077.981] * (-2078.991) (-2081.341) (-2074.789) [-2069.579] -- 0:03:58
150000 -- [-2079.718] (-2077.553) (-2085.675) (-2076.980) * (-2068.522) (-2087.633) (-2076.765) [-2068.383] -- 0:03:57
Average standard deviation of split frequencies: 0.008523
150100 -- (-2082.301) (-2072.143) (-2079.015) [-2076.283] * (-2079.144) (-2088.317) (-2079.183) [-2069.661] -- 0:03:57
150200 -- (-2083.268) (-2077.945) [-2076.920] (-2075.975) * (-2079.201) [-2078.402] (-2079.602) (-2073.524) -- 0:03:57
150300 -- (-2083.183) [-2073.719] (-2084.694) (-2069.004) * [-2076.066] (-2075.726) (-2077.947) (-2073.848) -- 0:03:57
150400 -- (-2080.951) [-2075.217] (-2078.814) (-2071.749) * (-2075.543) (-2088.826) [-2076.795] (-2076.098) -- 0:03:57
150500 -- [-2078.235] (-2076.580) (-2074.065) (-2076.615) * (-2076.326) (-2079.234) (-2075.124) [-2074.379] -- 0:03:57
150600 -- [-2077.129] (-2077.858) (-2082.870) (-2071.462) * (-2087.972) (-2082.360) (-2078.125) [-2071.964] -- 0:03:56
150700 -- (-2086.418) (-2081.064) (-2071.057) [-2073.595] * [-2074.917] (-2095.372) (-2082.855) (-2070.890) -- 0:03:56
150800 -- (-2092.271) (-2080.502) [-2072.106] (-2075.978) * (-2073.615) (-2085.281) (-2084.091) [-2071.742] -- 0:03:56
150900 -- (-2090.160) (-2082.450) [-2077.380] (-2075.378) * (-2079.738) (-2089.929) (-2072.954) [-2071.824] -- 0:03:56
151000 -- (-2091.799) (-2077.068) (-2072.772) [-2076.653] * (-2077.267) (-2086.501) (-2076.182) [-2069.357] -- 0:04:01
Average standard deviation of split frequencies: 0.008552
151100 -- (-2086.414) (-2080.324) [-2069.723] (-2076.044) * [-2072.937] (-2088.085) (-2078.410) (-2071.331) -- 0:04:01
151200 -- (-2082.268) (-2078.710) (-2070.174) [-2071.253] * (-2072.683) (-2080.533) (-2089.378) [-2072.111] -- 0:04:01
151300 -- (-2083.861) (-2076.970) [-2073.434] (-2088.186) * [-2071.397] (-2078.445) (-2076.879) (-2076.020) -- 0:04:01
151400 -- (-2079.099) (-2084.943) [-2075.162] (-2073.440) * (-2071.119) (-2075.870) [-2072.517] (-2078.568) -- 0:04:01
151500 -- (-2079.192) (-2079.960) [-2073.143] (-2083.910) * [-2073.005] (-2091.022) (-2072.831) (-2076.605) -- 0:04:00
151600 -- (-2079.255) (-2079.682) [-2071.425] (-2073.933) * [-2068.335] (-2085.245) (-2077.011) (-2075.178) -- 0:04:00
151700 -- (-2089.786) (-2081.823) [-2072.938] (-2082.672) * [-2071.294] (-2080.333) (-2076.619) (-2076.868) -- 0:04:00
151800 -- (-2087.879) (-2088.562) [-2069.974] (-2075.131) * (-2070.138) (-2084.496) [-2074.174] (-2072.651) -- 0:04:00
151900 -- (-2085.212) [-2078.220] (-2079.087) (-2073.805) * [-2075.136] (-2082.782) (-2072.689) (-2074.225) -- 0:04:00
152000 -- (-2089.031) (-2080.190) (-2074.915) [-2071.080] * [-2073.728] (-2082.231) (-2074.699) (-2076.187) -- 0:03:59
Average standard deviation of split frequencies: 0.008411
152100 -- (-2087.662) (-2073.721) (-2075.783) [-2070.678] * [-2069.348] (-2079.757) (-2078.179) (-2078.224) -- 0:03:59
152200 -- (-2084.056) (-2084.582) [-2073.822] (-2071.117) * [-2070.504] (-2073.747) (-2074.919) (-2080.310) -- 0:03:59
152300 -- (-2076.803) (-2081.486) (-2079.568) [-2074.672] * (-2070.372) (-2077.370) (-2077.161) [-2067.052] -- 0:03:59
152400 -- (-2085.010) (-2080.477) (-2080.275) [-2076.331] * [-2076.210] (-2077.245) (-2070.729) (-2069.816) -- 0:03:59
152500 -- (-2082.776) (-2081.106) (-2078.512) [-2075.755] * (-2078.695) (-2077.543) (-2074.911) [-2074.459] -- 0:03:58
152600 -- (-2077.734) (-2083.083) [-2080.710] (-2075.105) * (-2086.622) (-2077.136) (-2074.302) [-2071.270] -- 0:03:58
152700 -- (-2079.527) (-2077.938) (-2090.839) [-2071.560] * (-2076.391) (-2081.550) [-2071.039] (-2068.454) -- 0:03:58
152800 -- (-2081.692) (-2078.149) (-2095.227) [-2071.008] * (-2076.244) (-2089.601) (-2075.233) [-2070.225] -- 0:03:58
152900 -- (-2083.458) (-2078.525) (-2081.549) [-2071.276] * (-2074.754) (-2086.049) [-2068.531] (-2069.173) -- 0:03:58
153000 -- (-2084.377) (-2095.405) [-2082.025] (-2070.751) * [-2076.533] (-2076.200) (-2077.997) (-2072.380) -- 0:03:58
Average standard deviation of split frequencies: 0.008528
153100 -- (-2089.952) (-2077.096) [-2074.156] (-2071.752) * (-2078.893) (-2080.788) [-2068.442] (-2078.060) -- 0:03:57
153200 -- (-2094.375) (-2076.152) [-2072.298] (-2073.689) * (-2079.868) (-2082.104) [-2071.532] (-2073.330) -- 0:03:57
153300 -- (-2080.694) (-2076.766) (-2078.835) [-2070.125] * (-2088.234) (-2085.133) (-2072.661) [-2074.734] -- 0:03:57
153400 -- (-2085.248) (-2077.114) [-2072.763] (-2079.438) * (-2080.316) (-2086.560) [-2073.077] (-2070.401) -- 0:03:57
153500 -- (-2088.091) (-2074.285) (-2067.668) [-2072.295] * (-2079.374) (-2085.132) [-2076.818] (-2072.413) -- 0:03:57
153600 -- (-2083.668) (-2076.821) [-2072.380] (-2081.079) * (-2082.038) (-2087.681) (-2082.023) [-2071.663] -- 0:03:56
153700 -- (-2077.739) (-2083.087) (-2076.981) [-2076.167] * (-2082.298) (-2078.968) (-2075.855) [-2070.097] -- 0:03:56
153800 -- (-2081.625) (-2093.215) [-2072.231] (-2077.748) * (-2083.157) (-2076.946) [-2075.695] (-2070.657) -- 0:03:56
153900 -- (-2082.939) (-2079.422) (-2074.631) [-2074.580] * [-2077.408] (-2077.847) (-2072.422) (-2078.028) -- 0:03:56
154000 -- (-2080.212) (-2074.210) [-2071.280] (-2084.066) * (-2078.811) (-2088.877) (-2076.239) [-2073.487] -- 0:03:56
Average standard deviation of split frequencies: 0.008564
154100 -- [-2077.870] (-2081.826) (-2078.627) (-2076.212) * (-2080.132) (-2082.908) (-2082.326) [-2078.077] -- 0:03:56
154200 -- (-2078.027) (-2077.834) [-2075.410] (-2077.269) * (-2082.648) (-2085.702) [-2079.887] (-2086.889) -- 0:03:55
154300 -- (-2078.610) [-2075.963] (-2079.843) (-2077.557) * [-2080.025] (-2086.859) (-2080.535) (-2096.110) -- 0:03:55
154400 -- (-2084.327) [-2073.015] (-2086.021) (-2079.966) * [-2076.042] (-2090.055) (-2077.642) (-2096.057) -- 0:03:55
154500 -- (-2085.168) [-2072.796] (-2085.147) (-2083.730) * (-2071.187) (-2078.194) [-2067.412] (-2087.086) -- 0:04:00
154600 -- (-2082.727) [-2076.182] (-2079.541) (-2082.295) * [-2072.855] (-2076.223) (-2074.156) (-2082.653) -- 0:04:00
154700 -- (-2076.909) [-2069.567] (-2072.635) (-2081.741) * (-2084.110) (-2081.681) [-2075.883] (-2082.908) -- 0:04:00
154800 -- (-2073.394) [-2072.510] (-2073.504) (-2082.338) * (-2079.616) [-2076.251] (-2076.956) (-2085.716) -- 0:04:00
154900 -- (-2073.794) (-2081.806) [-2072.928] (-2079.044) * (-2084.513) (-2075.828) (-2077.215) [-2080.972] -- 0:04:00
155000 -- [-2075.313] (-2074.960) (-2077.853) (-2075.725) * (-2085.555) [-2083.033] (-2084.005) (-2076.687) -- 0:03:59
Average standard deviation of split frequencies: 0.008939
155100 -- (-2074.881) [-2071.265] (-2073.324) (-2074.819) * (-2071.947) (-2090.762) [-2081.319] (-2078.080) -- 0:03:59
155200 -- (-2073.171) [-2072.328] (-2073.291) (-2077.618) * [-2076.114] (-2082.932) (-2075.000) (-2078.325) -- 0:03:59
155300 -- [-2072.978] (-2083.418) (-2072.532) (-2085.823) * (-2076.174) (-2084.987) [-2075.831] (-2080.693) -- 0:03:59
155400 -- (-2079.291) (-2074.734) [-2071.763] (-2087.529) * (-2074.590) (-2083.155) [-2075.273] (-2081.508) -- 0:03:59
155500 -- (-2076.371) [-2073.855] (-2072.933) (-2083.137) * (-2074.532) (-2085.101) [-2071.319] (-2080.912) -- 0:03:58
155600 -- (-2085.485) (-2080.063) (-2077.208) [-2080.427] * (-2075.047) (-2087.333) [-2076.567] (-2082.814) -- 0:03:58
155700 -- (-2081.556) (-2081.780) [-2080.099] (-2074.987) * (-2072.226) (-2081.837) [-2072.547] (-2080.892) -- 0:03:58
155800 -- (-2082.846) (-2085.298) [-2072.623] (-2088.230) * [-2073.021] (-2080.334) (-2075.734) (-2082.284) -- 0:03:58
155900 -- [-2077.339] (-2084.947) (-2067.961) (-2077.228) * (-2073.267) (-2077.398) [-2072.758] (-2074.636) -- 0:03:58
156000 -- (-2075.446) (-2088.633) [-2069.827] (-2083.839) * (-2075.800) (-2077.227) [-2071.012] (-2079.657) -- 0:03:58
Average standard deviation of split frequencies: 0.008540
156100 -- (-2080.555) (-2083.097) [-2071.119] (-2075.667) * (-2078.594) (-2088.045) [-2069.539] (-2080.914) -- 0:03:57
156200 -- [-2077.569] (-2083.460) (-2075.773) (-2076.584) * [-2070.902] (-2081.702) (-2076.543) (-2085.444) -- 0:03:57
156300 -- (-2076.780) (-2078.758) [-2070.213] (-2075.368) * (-2074.567) (-2076.062) [-2081.909] (-2082.653) -- 0:03:57
156400 -- (-2079.124) [-2073.474] (-2075.959) (-2073.187) * (-2078.725) (-2081.854) [-2079.534] (-2088.362) -- 0:03:57
156500 -- (-2086.962) (-2071.480) (-2072.169) [-2073.309] * [-2074.736] (-2079.893) (-2082.291) (-2089.846) -- 0:03:57
156600 -- (-2082.507) [-2068.413] (-2073.334) (-2073.954) * [-2070.499] (-2082.719) (-2094.260) (-2094.402) -- 0:03:56
156700 -- (-2077.913) (-2083.052) (-2072.004) [-2070.158] * [-2073.026] (-2080.182) (-2076.331) (-2086.948) -- 0:03:56
156800 -- (-2074.293) (-2074.184) [-2070.378] (-2077.593) * (-2078.545) (-2078.759) [-2079.734] (-2089.511) -- 0:03:56
156900 -- [-2072.069] (-2073.943) (-2073.918) (-2073.126) * (-2073.046) (-2089.347) (-2074.752) [-2080.772] -- 0:03:56
157000 -- (-2079.313) (-2085.203) (-2071.258) [-2074.857] * [-2074.610] (-2085.455) (-2069.960) (-2087.796) -- 0:03:56
Average standard deviation of split frequencies: 0.007797
157100 -- (-2081.763) [-2073.308] (-2076.901) (-2073.315) * [-2074.906] (-2079.534) (-2069.785) (-2084.347) -- 0:03:56
157200 -- (-2094.551) (-2076.773) (-2075.911) [-2068.614] * [-2068.534] (-2083.983) (-2073.761) (-2084.050) -- 0:03:55
157300 -- (-2083.026) [-2071.664] (-2078.139) (-2081.597) * (-2071.233) (-2077.991) [-2077.060] (-2082.117) -- 0:03:55
157400 -- (-2083.200) (-2077.644) (-2081.509) [-2075.417] * (-2073.343) (-2077.752) [-2074.755] (-2080.312) -- 0:03:55
157500 -- (-2088.462) [-2074.245] (-2079.363) (-2078.534) * [-2071.378] (-2075.881) (-2069.145) (-2088.740) -- 0:03:55
157600 -- (-2088.598) [-2068.855] (-2083.421) (-2080.051) * [-2070.604] (-2079.528) (-2072.672) (-2083.054) -- 0:03:55
157700 -- (-2083.176) [-2072.386] (-2077.199) (-2081.452) * [-2073.539] (-2081.078) (-2076.609) (-2087.201) -- 0:03:55
157800 -- (-2086.180) [-2077.049] (-2075.111) (-2078.922) * (-2072.809) [-2084.155] (-2084.535) (-2079.303) -- 0:03:54
157900 -- (-2095.568) [-2072.713] (-2081.293) (-2072.160) * [-2076.185] (-2081.856) (-2090.993) (-2076.315) -- 0:03:54
158000 -- (-2092.370) (-2076.341) (-2086.337) [-2076.164] * [-2078.236] (-2083.697) (-2084.810) (-2073.931) -- 0:03:54
Average standard deviation of split frequencies: 0.007580
158100 -- (-2078.627) [-2073.090] (-2080.185) (-2070.934) * [-2078.223] (-2087.475) (-2077.835) (-2074.641) -- 0:03:59
158200 -- (-2080.064) (-2071.619) (-2082.868) [-2069.562] * [-2068.640] (-2083.360) (-2079.949) (-2074.875) -- 0:03:59
158300 -- (-2077.543) (-2080.229) (-2083.065) [-2071.809] * (-2071.281) (-2082.320) [-2080.663] (-2073.366) -- 0:03:59
158400 -- (-2078.906) [-2068.358] (-2076.264) (-2074.350) * (-2074.290) (-2085.241) (-2081.382) [-2074.519] -- 0:03:59
158500 -- (-2080.395) (-2070.095) [-2069.381] (-2072.478) * (-2083.082) (-2080.918) [-2072.813] (-2080.637) -- 0:03:58
158600 -- (-2075.794) [-2068.236] (-2070.469) (-2072.723) * (-2082.918) (-2083.662) [-2073.414] (-2076.867) -- 0:03:58
158700 -- (-2086.848) [-2069.235] (-2069.250) (-2068.990) * [-2071.695] (-2084.810) (-2080.610) (-2076.901) -- 0:03:58
158800 -- (-2091.773) (-2076.346) [-2065.869] (-2073.320) * [-2073.875] (-2081.328) (-2075.217) (-2072.220) -- 0:03:58
158900 -- (-2094.911) (-2071.022) [-2072.477] (-2080.472) * [-2074.272] (-2083.890) (-2075.974) (-2077.558) -- 0:03:58
159000 -- (-2080.317) (-2076.782) (-2075.137) [-2075.921] * (-2075.083) (-2085.324) (-2073.275) [-2078.855] -- 0:03:58
Average standard deviation of split frequencies: 0.007276
159100 -- [-2071.575] (-2071.423) (-2074.966) (-2071.431) * (-2077.684) [-2077.845] (-2079.943) (-2080.296) -- 0:03:57
159200 -- [-2070.221] (-2080.438) (-2079.315) (-2072.265) * (-2077.695) (-2081.736) [-2080.659] (-2077.199) -- 0:03:57
159300 -- [-2074.831] (-2081.149) (-2069.561) (-2079.592) * (-2081.443) (-2074.996) [-2074.749] (-2084.631) -- 0:03:57
159400 -- (-2082.619) (-2078.530) (-2076.297) [-2072.578] * (-2082.503) (-2076.903) [-2070.195] (-2081.758) -- 0:03:57
159500 -- (-2082.633) (-2074.518) [-2081.730] (-2072.669) * (-2078.497) (-2074.595) [-2070.913] (-2083.436) -- 0:03:57
159600 -- (-2079.636) [-2067.354] (-2086.843) (-2076.046) * (-2075.002) (-2084.005) [-2072.822] (-2080.283) -- 0:03:56
159700 -- (-2083.277) (-2071.227) (-2077.952) [-2070.926] * (-2076.784) (-2078.149) [-2071.878] (-2074.379) -- 0:03:56
159800 -- (-2075.517) [-2075.602] (-2087.601) (-2080.828) * [-2070.856] (-2083.583) (-2076.000) (-2076.919) -- 0:03:56
159900 -- [-2071.422] (-2077.879) (-2077.182) (-2079.564) * [-2069.888] (-2077.330) (-2078.467) (-2081.066) -- 0:03:56
160000 -- [-2077.321] (-2083.027) (-2074.709) (-2073.606) * [-2071.222] (-2070.423) (-2075.528) (-2070.447) -- 0:03:56
Average standard deviation of split frequencies: 0.007233
160100 -- (-2076.537) (-2077.315) [-2074.029] (-2077.826) * (-2072.790) (-2076.884) (-2078.463) [-2069.627] -- 0:03:56
160200 -- (-2082.810) (-2073.286) (-2073.182) [-2083.293] * (-2070.466) (-2089.576) (-2079.202) [-2070.042] -- 0:03:55
160300 -- (-2078.649) [-2071.045] (-2076.628) (-2077.225) * (-2075.369) (-2087.308) (-2080.592) [-2071.253] -- 0:03:55
160400 -- (-2073.794) (-2074.115) [-2069.012] (-2076.892) * (-2079.886) (-2082.967) (-2073.335) [-2076.762] -- 0:03:55
160500 -- (-2084.294) (-2068.285) [-2074.620] (-2084.004) * (-2076.000) (-2078.687) [-2071.071] (-2080.434) -- 0:03:55
160600 -- (-2076.656) [-2077.524] (-2076.144) (-2079.442) * (-2072.489) (-2085.997) [-2079.857] (-2091.190) -- 0:03:55
160700 -- (-2076.160) (-2076.562) (-2083.411) [-2077.771] * [-2074.612] (-2085.233) (-2076.124) (-2078.386) -- 0:03:55
160800 -- (-2077.999) [-2071.252] (-2076.650) (-2077.035) * (-2071.222) (-2089.219) (-2086.229) [-2080.228] -- 0:03:54
160900 -- [-2079.566] (-2070.284) (-2076.215) (-2079.874) * [-2075.953] (-2081.128) (-2071.756) (-2076.796) -- 0:03:54
161000 -- (-2080.229) [-2070.650] (-2078.298) (-2075.232) * (-2078.715) (-2083.040) [-2070.663] (-2080.522) -- 0:03:54
Average standard deviation of split frequencies: 0.007269
161100 -- (-2076.419) (-2072.407) [-2074.630] (-2079.049) * [-2076.987] (-2074.531) (-2085.277) (-2089.109) -- 0:03:54
161200 -- (-2071.851) [-2076.811] (-2071.434) (-2085.896) * (-2072.154) (-2075.996) [-2074.293] (-2084.163) -- 0:03:54
161300 -- [-2067.579] (-2074.218) (-2072.487) (-2081.970) * (-2075.045) (-2075.818) [-2073.230] (-2081.789) -- 0:03:53
161400 -- (-2074.569) [-2069.036] (-2075.326) (-2077.251) * (-2076.974) (-2088.305) [-2073.266] (-2082.945) -- 0:03:53
161500 -- [-2076.150] (-2071.779) (-2077.539) (-2082.959) * (-2086.383) [-2083.564] (-2075.110) (-2088.079) -- 0:03:53
161600 -- (-2077.924) (-2076.419) [-2067.050] (-2077.302) * (-2071.773) (-2079.437) [-2070.965] (-2082.557) -- 0:03:58
161700 -- (-2073.344) [-2067.605] (-2070.560) (-2073.707) * (-2068.692) [-2082.368] (-2072.028) (-2090.494) -- 0:03:58
161800 -- (-2069.595) [-2073.302] (-2074.049) (-2088.082) * [-2069.968] (-2075.157) (-2072.334) (-2084.954) -- 0:03:58
161900 -- (-2077.115) (-2074.625) [-2072.688] (-2083.556) * [-2066.994] (-2080.642) (-2071.847) (-2094.203) -- 0:03:58
162000 -- (-2071.032) (-2068.761) [-2073.656] (-2081.973) * [-2073.243] (-2075.685) (-2073.623) (-2093.097) -- 0:03:57
Average standard deviation of split frequencies: 0.007310
162100 -- (-2079.163) (-2075.507) (-2081.101) [-2074.031] * [-2070.666] (-2070.991) (-2071.319) (-2093.678) -- 0:03:57
162200 -- (-2084.300) [-2067.368] (-2072.440) (-2070.907) * (-2075.608) (-2070.507) [-2074.484] (-2094.892) -- 0:03:57
162300 -- (-2073.399) [-2071.477] (-2070.682) (-2080.727) * (-2075.592) [-2072.898] (-2078.461) (-2087.660) -- 0:03:57
162400 -- (-2074.738) (-2073.861) [-2072.909] (-2079.142) * (-2083.593) [-2069.387] (-2074.888) (-2084.321) -- 0:03:57
162500 -- [-2069.385] (-2073.665) (-2077.072) (-2076.934) * (-2071.903) [-2067.438] (-2077.885) (-2083.452) -- 0:03:57
162600 -- [-2069.452] (-2073.031) (-2073.827) (-2087.456) * [-2070.966] (-2077.507) (-2088.044) (-2077.921) -- 0:03:56
162700 -- (-2072.131) [-2068.211] (-2077.434) (-2086.596) * [-2074.331] (-2074.834) (-2077.140) (-2082.661) -- 0:03:56
162800 -- [-2070.902] (-2072.498) (-2084.528) (-2069.624) * (-2072.652) (-2074.108) [-2073.312] (-2081.520) -- 0:03:56
162900 -- [-2073.443] (-2076.827) (-2079.260) (-2079.118) * (-2075.857) [-2072.520] (-2070.336) (-2087.116) -- 0:03:56
163000 -- [-2072.881] (-2076.052) (-2086.311) (-2082.152) * (-2077.912) [-2069.925] (-2068.115) (-2079.614) -- 0:03:56
Average standard deviation of split frequencies: 0.007180
163100 -- (-2077.700) (-2076.965) (-2082.920) [-2079.960] * (-2080.089) [-2077.351] (-2073.269) (-2076.825) -- 0:03:56
163200 -- (-2076.088) (-2072.542) (-2084.765) [-2068.419] * [-2077.984] (-2077.262) (-2077.956) (-2082.970) -- 0:03:55
163300 -- (-2076.997) (-2076.173) (-2077.948) [-2071.300] * (-2071.479) [-2071.223] (-2078.038) (-2088.758) -- 0:03:55
163400 -- (-2073.067) (-2075.175) [-2073.962] (-2076.087) * [-2069.760] (-2076.677) (-2083.240) (-2082.659) -- 0:03:55
163500 -- (-2074.755) (-2076.134) (-2080.151) [-2070.491] * [-2074.192] (-2081.549) (-2088.603) (-2085.819) -- 0:03:55
163600 -- (-2080.200) [-2075.579] (-2086.052) (-2068.343) * (-2079.300) (-2087.548) [-2082.339] (-2081.532) -- 0:03:55
163700 -- (-2073.832) [-2080.924] (-2077.205) (-2072.276) * [-2074.834] (-2077.516) (-2083.637) (-2081.992) -- 0:03:55
163800 -- [-2072.180] (-2077.516) (-2080.713) (-2074.804) * (-2076.538) [-2070.200] (-2085.929) (-2092.472) -- 0:03:54
163900 -- [-2069.468] (-2076.038) (-2073.602) (-2073.540) * (-2071.870) [-2071.817] (-2075.595) (-2087.793) -- 0:03:54
164000 -- (-2075.525) (-2073.146) (-2078.958) [-2072.285] * (-2068.763) (-2079.215) [-2073.073] (-2082.362) -- 0:03:54
Average standard deviation of split frequencies: 0.006729
164100 -- (-2075.211) (-2073.064) (-2080.482) [-2070.508] * (-2075.431) (-2079.003) [-2076.565] (-2085.292) -- 0:03:54
164200 -- (-2075.793) (-2079.590) (-2078.997) [-2070.741] * [-2074.449] (-2074.798) (-2074.061) (-2080.868) -- 0:03:54
164300 -- (-2081.380) [-2076.332] (-2082.845) (-2073.708) * [-2071.678] (-2075.101) (-2075.095) (-2082.870) -- 0:03:53
164400 -- (-2075.180) (-2080.506) [-2072.150] (-2074.623) * (-2072.954) [-2074.055] (-2069.097) (-2085.894) -- 0:03:53
164500 -- (-2075.320) (-2078.284) [-2075.675] (-2072.591) * (-2074.507) [-2072.527] (-2082.763) (-2082.374) -- 0:03:53
164600 -- (-2077.924) (-2081.406) (-2076.423) [-2072.557] * [-2071.602] (-2073.210) (-2073.232) (-2085.821) -- 0:03:53
164700 -- (-2079.672) (-2080.128) (-2080.491) [-2069.740] * [-2068.912] (-2070.230) (-2069.381) (-2077.755) -- 0:03:53
164800 -- [-2073.891] (-2085.616) (-2081.301) (-2075.169) * [-2078.610] (-2077.971) (-2072.004) (-2083.613) -- 0:03:53
164900 -- (-2078.034) (-2078.333) (-2076.346) [-2071.156] * (-2075.304) (-2069.323) [-2069.784] (-2075.941) -- 0:03:52
165000 -- (-2077.945) (-2077.063) (-2073.596) [-2075.229] * (-2069.194) [-2075.276] (-2072.124) (-2080.356) -- 0:03:52
Average standard deviation of split frequencies: 0.006604
165100 -- (-2080.053) (-2078.245) [-2075.536] (-2076.488) * (-2071.860) (-2073.673) [-2071.269] (-2076.753) -- 0:03:52
165200 -- (-2084.535) [-2075.303] (-2078.486) (-2072.986) * [-2070.522] (-2075.704) (-2073.996) (-2075.056) -- 0:03:57
165300 -- (-2085.752) [-2073.513] (-2078.205) (-2079.952) * (-2079.673) (-2081.639) [-2072.170] (-2076.674) -- 0:03:57
165400 -- (-2088.459) [-2073.834] (-2079.739) (-2086.214) * (-2083.307) [-2074.773] (-2071.959) (-2076.027) -- 0:03:57
165500 -- (-2083.964) (-2075.660) (-2084.833) [-2085.659] * (-2082.925) (-2083.611) (-2079.809) [-2083.604] -- 0:03:56
165600 -- (-2083.940) (-2073.335) (-2085.862) [-2077.494] * [-2073.468] (-2074.262) (-2077.280) (-2077.912) -- 0:03:56
165700 -- (-2086.271) [-2075.245] (-2081.812) (-2077.376) * (-2074.825) (-2076.492) (-2079.230) [-2079.057] -- 0:03:56
165800 -- (-2084.097) (-2075.786) (-2076.827) [-2072.761] * (-2073.457) [-2068.369] (-2087.345) (-2086.322) -- 0:03:56
165900 -- (-2078.789) (-2079.481) (-2081.417) [-2071.729] * (-2080.033) [-2070.797] (-2084.807) (-2084.970) -- 0:03:56
166000 -- (-2074.645) [-2071.299] (-2091.863) (-2073.458) * (-2086.634) [-2073.445] (-2081.767) (-2083.465) -- 0:03:56
Average standard deviation of split frequencies: 0.006891
166100 -- (-2082.608) [-2072.865] (-2080.439) (-2074.215) * (-2066.413) [-2071.048] (-2078.479) (-2085.556) -- 0:03:55
166200 -- (-2074.847) (-2071.235) (-2079.869) [-2072.341] * (-2068.408) [-2070.266] (-2087.533) (-2097.482) -- 0:03:55
166300 -- (-2082.001) [-2074.202] (-2084.911) (-2072.368) * (-2077.831) [-2072.902] (-2079.928) (-2100.096) -- 0:03:55
166400 -- (-2076.939) [-2072.152] (-2086.654) (-2082.875) * (-2075.021) [-2071.077] (-2074.467) (-2085.698) -- 0:03:55
166500 -- (-2077.883) (-2079.046) (-2083.883) [-2070.378] * [-2070.783] (-2072.705) (-2068.355) (-2084.578) -- 0:03:55
166600 -- (-2075.637) (-2077.076) (-2075.046) [-2069.098] * (-2078.765) [-2076.559] (-2071.341) (-2082.224) -- 0:03:55
166700 -- (-2078.483) (-2073.386) (-2082.162) [-2075.069] * [-2071.169] (-2076.230) (-2067.319) (-2086.852) -- 0:03:54
166800 -- (-2078.824) (-2070.508) (-2092.003) [-2072.709] * (-2074.460) (-2080.525) [-2075.294] (-2077.373) -- 0:03:54
166900 -- (-2074.114) (-2073.741) (-2082.651) [-2071.162] * [-2074.583] (-2078.520) (-2079.017) (-2084.341) -- 0:03:54
167000 -- (-2075.289) (-2077.950) [-2078.021] (-2074.569) * (-2077.688) (-2078.391) [-2072.672] (-2086.007) -- 0:03:54
Average standard deviation of split frequencies: 0.006203
167100 -- (-2073.611) (-2083.544) (-2073.385) [-2073.097] * (-2075.148) (-2077.499) [-2072.506] (-2080.635) -- 0:03:54
167200 -- (-2073.906) (-2083.607) (-2073.669) [-2074.519] * [-2072.515] (-2075.031) (-2071.704) (-2084.292) -- 0:03:54
167300 -- (-2079.503) (-2080.511) (-2072.139) [-2074.113] * [-2071.370] (-2085.201) (-2067.703) (-2087.855) -- 0:03:53
167400 -- (-2074.772) (-2079.151) [-2070.432] (-2077.121) * (-2083.911) (-2077.823) (-2070.929) [-2073.443] -- 0:03:53
167500 -- [-2078.952] (-2087.903) (-2075.268) (-2076.183) * (-2080.332) [-2073.996] (-2079.087) (-2076.500) -- 0:03:53
167600 -- [-2073.497] (-2082.155) (-2074.145) (-2080.342) * [-2086.885] (-2078.908) (-2076.034) (-2076.093) -- 0:03:53
167700 -- (-2068.779) [-2076.193] (-2080.203) (-2085.997) * (-2078.490) (-2073.830) [-2074.010] (-2082.005) -- 0:03:53
167800 -- (-2080.237) [-2075.871] (-2080.669) (-2081.125) * [-2078.521] (-2074.428) (-2073.609) (-2081.378) -- 0:03:53
167900 -- (-2072.843) (-2084.633) [-2072.510] (-2080.461) * (-2072.105) [-2071.644] (-2073.114) (-2081.714) -- 0:03:52
168000 -- [-2071.535] (-2073.391) (-2073.927) (-2076.570) * (-2073.838) [-2071.905] (-2072.495) (-2078.801) -- 0:03:52
Average standard deviation of split frequencies: 0.005768
168100 -- (-2078.113) (-2080.735) [-2070.239] (-2079.211) * (-2070.459) [-2070.731] (-2087.029) (-2082.754) -- 0:03:52
168200 -- (-2076.553) (-2091.890) [-2068.762] (-2081.095) * [-2073.924] (-2072.909) (-2088.881) (-2080.578) -- 0:03:52
168300 -- (-2074.987) (-2083.697) [-2075.062] (-2086.428) * (-2078.418) [-2069.569] (-2091.784) (-2089.424) -- 0:03:52
168400 -- (-2074.773) (-2084.358) [-2066.679] (-2077.870) * (-2078.666) [-2071.730] (-2088.057) (-2077.292) -- 0:03:52
168500 -- (-2069.101) (-2082.660) (-2070.604) [-2077.807] * (-2078.442) [-2072.846] (-2079.703) (-2079.777) -- 0:03:51
168600 -- [-2071.150] (-2074.862) (-2068.269) (-2081.459) * (-2076.990) (-2079.219) [-2077.569] (-2079.446) -- 0:03:51
168700 -- (-2078.886) (-2071.831) [-2068.785] (-2083.645) * [-2077.783] (-2080.043) (-2077.801) (-2086.420) -- 0:03:51
168800 -- (-2067.983) [-2075.349] (-2067.101) (-2077.585) * (-2086.547) [-2077.008] (-2076.746) (-2082.157) -- 0:03:56
168900 -- (-2072.165) (-2078.358) [-2072.213] (-2081.215) * (-2077.717) [-2076.961] (-2085.192) (-2083.830) -- 0:03:56
169000 -- (-2079.045) (-2083.489) (-2079.781) [-2078.215] * [-2076.325] (-2072.244) (-2084.988) (-2089.956) -- 0:03:56
Average standard deviation of split frequencies: 0.005811
169100 -- (-2077.311) (-2089.143) (-2076.040) [-2072.802] * (-2082.538) (-2067.139) (-2088.121) [-2085.069] -- 0:03:55
169200 -- (-2074.117) [-2071.995] (-2072.481) (-2073.376) * (-2079.043) [-2073.498] (-2082.633) (-2077.619) -- 0:03:55
169300 -- [-2073.249] (-2072.658) (-2070.282) (-2074.135) * (-2081.759) (-2083.590) (-2085.225) [-2078.570] -- 0:03:55
169400 -- (-2075.609) (-2075.460) [-2068.398] (-2083.877) * (-2078.583) [-2083.021] (-2078.040) (-2077.663) -- 0:03:55
169500 -- (-2082.534) [-2074.663] (-2070.998) (-2083.692) * (-2072.835) (-2085.491) [-2080.879] (-2076.796) -- 0:03:55
169600 -- (-2075.410) (-2076.439) [-2074.795] (-2078.067) * [-2069.745] (-2083.052) (-2076.859) (-2079.065) -- 0:03:55
169700 -- (-2071.294) (-2072.293) (-2079.509) [-2080.285] * [-2072.766] (-2080.897) (-2077.123) (-2076.116) -- 0:03:54
169800 -- (-2079.375) (-2075.650) (-2079.025) [-2075.787] * (-2077.763) (-2077.318) [-2072.904] (-2078.760) -- 0:03:54
169900 -- (-2083.755) (-2072.427) [-2072.633] (-2080.674) * [-2078.157] (-2079.910) (-2084.139) (-2079.023) -- 0:03:54
170000 -- (-2086.121) [-2073.628] (-2074.135) (-2083.129) * (-2069.113) [-2073.068] (-2076.141) (-2082.935) -- 0:03:54
Average standard deviation of split frequencies: 0.005779
170100 -- (-2078.933) (-2075.726) [-2073.403] (-2085.253) * (-2075.506) (-2075.648) (-2081.479) [-2078.202] -- 0:03:54
170200 -- (-2079.533) [-2075.837] (-2080.522) (-2087.467) * (-2072.765) (-2076.695) [-2074.588] (-2077.632) -- 0:03:54
170300 -- (-2076.123) (-2074.802) [-2073.732] (-2084.244) * [-2071.406] (-2088.700) (-2078.388) (-2077.974) -- 0:03:53
170400 -- [-2076.363] (-2072.001) (-2075.118) (-2080.650) * (-2071.592) (-2077.342) [-2079.809] (-2087.477) -- 0:03:53
170500 -- [-2077.464] (-2074.090) (-2074.386) (-2082.998) * (-2093.465) (-2072.917) [-2079.111] (-2081.222) -- 0:03:53
170600 -- [-2082.568] (-2073.863) (-2088.324) (-2080.451) * (-2074.991) (-2079.372) [-2072.450] (-2086.347) -- 0:03:53
170700 -- (-2077.050) (-2074.335) (-2083.558) [-2081.516] * (-2076.809) [-2072.505] (-2074.473) (-2075.632) -- 0:03:53
170800 -- [-2070.138] (-2078.013) (-2078.863) (-2085.238) * (-2081.391) (-2078.556) [-2075.279] (-2081.270) -- 0:03:53
170900 -- [-2069.894] (-2077.704) (-2078.475) (-2075.923) * (-2080.045) [-2076.666] (-2072.639) (-2085.631) -- 0:03:52
171000 -- (-2072.419) (-2075.040) [-2075.671] (-2082.345) * [-2073.745] (-2084.120) (-2083.593) (-2080.208) -- 0:03:52
Average standard deviation of split frequencies: 0.005586
171100 -- [-2070.246] (-2083.368) (-2073.049) (-2089.190) * (-2075.818) [-2077.042] (-2073.605) (-2086.598) -- 0:03:52
171200 -- [-2068.093] (-2076.512) (-2074.560) (-2083.047) * (-2075.623) [-2078.503] (-2073.037) (-2089.325) -- 0:03:52
171300 -- [-2071.442] (-2083.101) (-2079.992) (-2091.924) * (-2078.533) (-2081.809) [-2075.004] (-2086.902) -- 0:03:52
171400 -- (-2077.522) [-2077.146] (-2081.885) (-2093.141) * (-2077.856) [-2068.887] (-2070.138) (-2083.655) -- 0:03:52
171500 -- (-2075.978) (-2078.170) [-2079.125] (-2097.339) * (-2073.655) (-2071.807) [-2070.212] (-2081.429) -- 0:03:51
171600 -- (-2075.800) [-2081.276] (-2078.695) (-2083.523) * (-2080.628) (-2073.469) [-2068.473] (-2088.002) -- 0:03:51
171700 -- [-2071.800] (-2074.594) (-2083.011) (-2098.441) * (-2071.798) [-2072.318] (-2083.045) (-2093.139) -- 0:03:51
171800 -- [-2069.463] (-2079.766) (-2078.231) (-2082.678) * (-2075.535) [-2074.139] (-2082.066) (-2081.284) -- 0:03:51
171900 -- (-2070.125) (-2078.613) [-2076.749] (-2079.588) * (-2079.534) [-2071.159] (-2076.467) (-2079.999) -- 0:03:51
172000 -- (-2070.657) [-2070.835] (-2077.624) (-2088.127) * (-2080.497) [-2073.217] (-2078.676) (-2079.367) -- 0:03:51
Average standard deviation of split frequencies: 0.006103
172100 -- (-2077.888) [-2072.299] (-2090.497) (-2085.246) * [-2076.399] (-2085.016) (-2078.691) (-2080.930) -- 0:03:50
172200 -- (-2080.774) [-2070.362] (-2084.230) (-2080.020) * (-2080.613) (-2074.202) [-2075.401] (-2082.685) -- 0:03:50
172300 -- (-2078.670) [-2072.925] (-2076.483) (-2076.977) * (-2078.843) [-2076.220] (-2069.118) (-2085.083) -- 0:03:55
172400 -- (-2079.624) (-2077.996) (-2080.255) [-2078.672] * (-2076.860) (-2079.418) [-2068.682] (-2082.789) -- 0:03:55
172500 -- (-2078.179) (-2081.128) (-2082.062) [-2072.816] * (-2077.849) (-2072.482) [-2068.711] (-2083.684) -- 0:03:55
172600 -- [-2071.682] (-2077.183) (-2080.576) (-2079.040) * (-2076.809) [-2079.714] (-2081.810) (-2081.869) -- 0:03:54
172700 -- (-2069.972) [-2076.066] (-2078.283) (-2079.482) * (-2079.395) (-2080.890) [-2073.032] (-2078.116) -- 0:03:54
172800 -- [-2075.457] (-2071.305) (-2082.826) (-2079.797) * (-2078.224) [-2071.841] (-2073.932) (-2076.740) -- 0:03:54
172900 -- (-2073.905) (-2069.578) [-2081.416] (-2080.672) * (-2081.135) (-2074.257) [-2071.301] (-2074.219) -- 0:03:54
173000 -- (-2070.964) [-2070.355] (-2082.981) (-2087.710) * (-2080.873) (-2080.492) [-2070.937] (-2082.267) -- 0:03:54
Average standard deviation of split frequencies: 0.006454
173100 -- (-2075.724) [-2073.610] (-2085.180) (-2078.273) * [-2074.245] (-2077.865) (-2072.776) (-2084.672) -- 0:03:54
173200 -- (-2086.633) (-2076.034) (-2088.739) [-2077.338] * (-2076.160) (-2072.362) (-2073.944) [-2082.046] -- 0:03:53
173300 -- (-2093.450) [-2073.014] (-2081.511) (-2078.319) * (-2072.452) (-2074.859) [-2072.567] (-2076.025) -- 0:03:53
173400 -- (-2086.424) (-2077.237) (-2068.660) [-2074.358] * (-2077.040) (-2073.853) (-2075.078) [-2078.181] -- 0:03:53
173500 -- [-2076.751] (-2076.522) (-2071.628) (-2077.825) * [-2066.326] (-2074.321) (-2073.595) (-2086.463) -- 0:03:53
173600 -- (-2089.820) (-2075.537) (-2078.193) [-2074.228] * (-2074.281) (-2072.572) [-2077.850] (-2082.393) -- 0:03:53
173700 -- (-2100.672) (-2083.827) (-2078.925) [-2073.036] * (-2074.185) (-2082.846) (-2078.651) [-2078.152] -- 0:03:53
173800 -- (-2099.916) (-2083.539) [-2076.387] (-2076.489) * [-2066.536] (-2081.052) (-2078.475) (-2080.683) -- 0:03:52
173900 -- (-2085.734) (-2079.261) (-2075.168) [-2073.551] * (-2071.694) (-2075.250) [-2075.832] (-2087.874) -- 0:03:52
174000 -- (-2076.352) [-2073.865] (-2077.912) (-2073.117) * (-2071.335) (-2079.399) [-2070.130] (-2087.733) -- 0:03:52
Average standard deviation of split frequencies: 0.006497
174100 -- (-2077.122) [-2076.584] (-2071.432) (-2081.845) * (-2078.847) [-2080.914] (-2071.907) (-2087.020) -- 0:03:52
174200 -- (-2080.132) (-2074.251) [-2071.944] (-2082.502) * (-2082.475) [-2076.910] (-2072.416) (-2082.819) -- 0:03:52
174300 -- (-2079.474) (-2076.888) [-2070.449] (-2081.065) * (-2081.947) (-2072.869) [-2069.268] (-2090.162) -- 0:03:52
174400 -- [-2072.345] (-2083.186) (-2081.040) (-2078.885) * (-2088.468) (-2071.214) [-2067.402] (-2093.970) -- 0:03:51
174500 -- (-2074.554) (-2082.331) [-2079.967] (-2081.489) * (-2085.684) (-2072.150) [-2074.682] (-2082.899) -- 0:03:51
174600 -- (-2080.160) (-2080.195) [-2078.679] (-2075.251) * (-2079.271) [-2078.403] (-2069.886) (-2089.654) -- 0:03:51
174700 -- (-2077.521) (-2087.541) [-2072.124] (-2081.811) * [-2083.811] (-2080.722) (-2075.610) (-2088.577) -- 0:03:51
174800 -- [-2069.968] (-2082.569) (-2074.983) (-2078.829) * (-2079.216) (-2070.989) [-2072.639] (-2086.605) -- 0:03:51
174900 -- [-2076.522] (-2077.466) (-2075.354) (-2077.136) * (-2076.200) (-2072.152) [-2072.409] (-2089.691) -- 0:03:51
175000 -- [-2071.686] (-2081.583) (-2078.466) (-2092.205) * (-2070.997) (-2082.468) [-2072.464] (-2086.260) -- 0:03:50
Average standard deviation of split frequencies: 0.006227
175100 -- (-2079.268) (-2085.917) [-2073.506] (-2087.408) * [-2076.534] (-2071.154) (-2079.377) (-2080.868) -- 0:03:50
175200 -- [-2072.688] (-2083.787) (-2078.705) (-2083.732) * [-2070.932] (-2084.718) (-2086.070) (-2089.359) -- 0:03:50
175300 -- [-2073.448] (-2084.354) (-2076.892) (-2083.756) * [-2072.646] (-2072.866) (-2078.734) (-2081.928) -- 0:03:50
175400 -- (-2074.530) [-2076.151] (-2075.003) (-2081.189) * (-2083.741) [-2069.963] (-2073.813) (-2091.385) -- 0:03:50
175500 -- [-2071.270] (-2085.156) (-2081.513) (-2085.771) * (-2083.960) [-2073.375] (-2080.348) (-2088.722) -- 0:03:50
175600 -- [-2069.074] (-2085.491) (-2079.421) (-2087.114) * (-2074.298) [-2076.793] (-2077.860) (-2095.573) -- 0:03:50
175700 -- [-2075.592] (-2089.413) (-2080.906) (-2093.405) * [-2074.888] (-2075.028) (-2087.075) (-2088.030) -- 0:03:49
175800 -- (-2078.242) (-2094.462) [-2079.162] (-2090.141) * (-2077.171) (-2071.596) [-2077.002] (-2079.077) -- 0:03:49
175900 -- [-2073.069] (-2094.951) (-2074.540) (-2080.394) * (-2073.641) [-2073.317] (-2070.154) (-2084.742) -- 0:03:54
176000 -- [-2075.177] (-2088.360) (-2074.689) (-2077.509) * [-2071.373] (-2074.474) (-2075.801) (-2086.901) -- 0:03:54
Average standard deviation of split frequencies: 0.006270
176100 -- [-2071.127] (-2091.803) (-2081.928) (-2074.581) * (-2069.304) (-2072.804) [-2069.057] (-2089.543) -- 0:03:53
176200 -- [-2075.759] (-2082.319) (-2081.649) (-2080.343) * (-2073.122) [-2072.891] (-2077.059) (-2086.622) -- 0:03:53
176300 -- (-2080.552) (-2081.035) (-2083.786) [-2078.912] * [-2071.945] (-2070.315) (-2071.329) (-2097.037) -- 0:03:53
176400 -- (-2076.090) (-2091.726) (-2086.815) [-2079.989] * (-2074.810) [-2069.628] (-2075.516) (-2090.410) -- 0:03:53
176500 -- (-2074.938) (-2098.372) [-2079.392] (-2078.508) * [-2068.904] (-2074.929) (-2075.272) (-2085.541) -- 0:03:53
176600 -- (-2075.610) (-2085.124) (-2075.640) [-2074.149] * [-2069.805] (-2082.398) (-2072.695) (-2082.749) -- 0:03:53
176700 -- (-2088.498) [-2082.284] (-2080.312) (-2081.850) * [-2071.104] (-2078.266) (-2078.862) (-2077.774) -- 0:03:52
176800 -- (-2083.369) (-2074.038) (-2076.547) [-2080.031] * (-2083.520) (-2078.058) (-2081.014) [-2075.662] -- 0:03:52
176900 -- (-2078.452) (-2085.036) [-2073.573] (-2074.568) * (-2073.700) [-2074.320] (-2071.982) (-2077.328) -- 0:03:52
177000 -- (-2077.614) (-2079.255) (-2075.609) [-2076.771] * (-2070.537) [-2072.174] (-2071.516) (-2079.540) -- 0:03:52
Average standard deviation of split frequencies: 0.007221
177100 -- [-2072.940] (-2086.492) (-2081.769) (-2073.868) * [-2073.314] (-2071.953) (-2085.406) (-2080.346) -- 0:03:52
177200 -- (-2077.713) (-2079.832) (-2078.888) [-2074.630] * [-2070.285] (-2070.545) (-2079.697) (-2078.495) -- 0:03:52
177300 -- (-2079.249) (-2083.576) [-2080.659] (-2076.582) * [-2071.637] (-2073.609) (-2083.310) (-2082.424) -- 0:03:52
177400 -- (-2076.795) (-2081.405) [-2073.991] (-2087.267) * (-2077.148) [-2074.125] (-2093.521) (-2081.231) -- 0:03:51
177500 -- (-2076.675) (-2085.279) [-2075.283] (-2088.023) * (-2076.101) [-2071.260] (-2080.393) (-2085.881) -- 0:03:51
177600 -- [-2076.930] (-2081.883) (-2081.283) (-2085.061) * [-2079.159] (-2070.799) (-2077.050) (-2089.662) -- 0:03:51
177700 -- (-2072.421) [-2074.858] (-2077.019) (-2094.854) * [-2076.357] (-2073.633) (-2086.904) (-2085.733) -- 0:03:51
177800 -- (-2074.162) [-2076.699] (-2084.350) (-2088.089) * (-2074.885) [-2077.166] (-2081.135) (-2085.331) -- 0:03:51
177900 -- [-2073.425] (-2091.572) (-2079.597) (-2082.659) * (-2068.854) (-2069.679) [-2069.577] (-2084.509) -- 0:03:51
178000 -- (-2072.544) [-2076.588] (-2081.268) (-2084.220) * [-2068.463] (-2074.423) (-2075.609) (-2090.424) -- 0:03:50
Average standard deviation of split frequencies: 0.007183
178100 -- [-2076.068] (-2081.435) (-2082.401) (-2080.799) * [-2070.151] (-2069.690) (-2076.336) (-2085.806) -- 0:03:50
178200 -- (-2072.473) (-2077.086) (-2078.895) [-2077.707] * [-2071.144] (-2077.041) (-2074.341) (-2077.497) -- 0:03:50
178300 -- [-2072.410] (-2078.975) (-2078.324) (-2074.726) * (-2074.527) (-2078.220) [-2073.012] (-2076.197) -- 0:03:50
178400 -- [-2074.191] (-2077.968) (-2078.645) (-2072.516) * (-2075.994) [-2074.417] (-2087.852) (-2080.795) -- 0:03:50
178500 -- [-2071.666] (-2082.097) (-2087.167) (-2081.410) * (-2090.122) [-2071.367] (-2082.062) (-2084.193) -- 0:03:50
178600 -- (-2076.937) (-2081.754) (-2080.279) [-2077.419] * (-2088.987) (-2076.467) [-2072.600] (-2086.610) -- 0:03:49
178700 -- [-2073.874] (-2074.701) (-2080.171) (-2081.391) * (-2080.361) (-2074.127) [-2068.356] (-2088.442) -- 0:03:49
178800 -- [-2077.467] (-2085.438) (-2077.251) (-2078.528) * (-2076.206) [-2073.635] (-2077.068) (-2084.178) -- 0:03:49
178900 -- (-2077.751) [-2075.736] (-2077.817) (-2081.510) * (-2072.641) [-2073.649] (-2073.142) (-2082.271) -- 0:03:49
179000 -- [-2074.052] (-2078.429) (-2072.749) (-2083.449) * (-2074.015) (-2073.702) [-2069.601] (-2083.768) -- 0:03:49
Average standard deviation of split frequencies: 0.007817
179100 -- (-2078.155) (-2075.613) [-2074.613] (-2093.734) * (-2070.300) (-2079.091) [-2068.664] (-2090.721) -- 0:03:49
179200 -- (-2074.968) (-2080.549) [-2076.721] (-2077.812) * [-2071.326] (-2073.362) (-2074.879) (-2077.862) -- 0:03:49
179300 -- (-2075.217) (-2088.097) (-2075.029) [-2075.791] * [-2074.345] (-2083.371) (-2069.384) (-2082.885) -- 0:03:48
179400 -- (-2079.332) (-2082.741) [-2072.759] (-2077.493) * (-2072.754) (-2082.359) [-2076.940] (-2077.787) -- 0:03:48
179500 -- [-2079.898] (-2078.368) (-2076.485) (-2075.746) * [-2072.008] (-2085.530) (-2078.384) (-2079.023) -- 0:03:53
179600 -- (-2093.084) [-2079.616] (-2077.577) (-2082.161) * (-2074.216) (-2076.459) (-2083.023) [-2085.293] -- 0:03:52
179700 -- [-2077.365] (-2079.049) (-2079.177) (-2078.438) * (-2071.762) [-2073.627] (-2071.660) (-2084.582) -- 0:03:52
179800 -- [-2077.394] (-2079.283) (-2072.899) (-2084.417) * (-2081.617) [-2070.620] (-2078.381) (-2081.696) -- 0:03:52
179900 -- (-2080.000) (-2087.528) (-2080.101) [-2083.756] * (-2080.946) [-2068.009] (-2083.060) (-2090.948) -- 0:03:52
180000 -- (-2077.732) (-2083.046) [-2073.741] (-2087.575) * (-2072.882) (-2072.569) [-2081.960] (-2093.457) -- 0:03:52
Average standard deviation of split frequencies: 0.007926
180100 -- [-2079.167] (-2075.102) (-2080.786) (-2081.175) * (-2071.735) (-2070.452) [-2070.670] (-2088.398) -- 0:03:52
180200 -- (-2077.105) [-2072.065] (-2074.764) (-2082.454) * [-2076.044] (-2074.111) (-2074.127) (-2082.464) -- 0:03:52
180300 -- (-2077.233) (-2076.362) [-2073.302] (-2076.987) * (-2076.749) (-2075.189) [-2071.991] (-2074.350) -- 0:03:51
180400 -- (-2080.259) (-2077.470) [-2069.812] (-2074.095) * (-2071.579) [-2074.100] (-2071.247) (-2092.611) -- 0:03:51
180500 -- [-2072.797] (-2082.436) (-2072.193) (-2082.106) * (-2080.703) [-2076.786] (-2077.340) (-2079.824) -- 0:03:51
180600 -- (-2073.168) (-2087.106) [-2069.673] (-2077.357) * [-2068.727] (-2069.314) (-2077.317) (-2087.073) -- 0:03:51
180700 -- (-2072.397) (-2083.918) [-2077.842] (-2078.173) * [-2069.925] (-2075.062) (-2079.238) (-2081.661) -- 0:03:51
180800 -- [-2068.662] (-2090.769) (-2075.217) (-2079.866) * [-2071.994] (-2074.322) (-2080.980) (-2082.120) -- 0:03:51
180900 -- [-2073.654] (-2086.840) (-2083.964) (-2073.947) * (-2070.860) (-2075.113) [-2075.531] (-2084.587) -- 0:03:50
181000 -- (-2072.637) (-2083.515) [-2072.730] (-2077.016) * (-2078.394) (-2068.863) (-2072.760) [-2077.151] -- 0:03:50
Average standard deviation of split frequencies: 0.008325
181100 -- (-2073.369) (-2079.445) (-2079.048) [-2074.082] * (-2079.743) [-2073.396] (-2070.739) (-2072.642) -- 0:03:50
181200 -- [-2074.578] (-2076.005) (-2073.077) (-2079.263) * (-2079.946) [-2068.829] (-2076.463) (-2079.254) -- 0:03:50
181300 -- (-2076.451) [-2072.263] (-2077.481) (-2083.700) * (-2077.934) [-2069.599] (-2078.686) (-2085.047) -- 0:03:50
181400 -- [-2075.738] (-2077.536) (-2073.641) (-2077.001) * (-2071.901) [-2073.852] (-2088.466) (-2074.789) -- 0:03:50
181500 -- [-2073.633] (-2074.486) (-2073.838) (-2081.058) * (-2073.103) [-2071.835] (-2075.963) (-2083.393) -- 0:03:49
181600 -- [-2069.580] (-2075.914) (-2073.497) (-2084.521) * (-2080.183) (-2067.884) [-2075.525] (-2082.070) -- 0:03:49
181700 -- [-2068.565] (-2080.368) (-2082.668) (-2083.051) * (-2078.794) (-2076.822) (-2078.088) [-2076.495] -- 0:03:49
181800 -- [-2072.970] (-2082.524) (-2076.449) (-2092.154) * (-2092.232) (-2072.845) [-2074.544] (-2081.612) -- 0:03:49
181900 -- [-2070.375] (-2086.879) (-2072.915) (-2094.647) * (-2081.064) [-2068.958] (-2078.051) (-2084.729) -- 0:03:49
182000 -- [-2070.931] (-2081.667) (-2079.910) (-2091.066) * (-2085.398) [-2069.989] (-2074.758) (-2092.432) -- 0:03:49
Average standard deviation of split frequencies: 0.008282
182100 -- [-2072.954] (-2078.969) (-2084.257) (-2082.424) * (-2080.110) [-2073.951] (-2082.451) (-2086.780) -- 0:03:49
182200 -- [-2072.568] (-2075.040) (-2078.919) (-2081.665) * (-2078.304) [-2066.117] (-2081.077) (-2084.387) -- 0:03:48
182300 -- (-2071.970) (-2071.350) (-2081.220) [-2079.921] * [-2072.568] (-2068.962) (-2080.749) (-2078.713) -- 0:03:48
182400 -- [-2073.362] (-2081.579) (-2079.648) (-2081.680) * (-2074.653) [-2071.536] (-2073.501) (-2083.186) -- 0:03:48
182500 -- (-2075.048) [-2074.381] (-2076.672) (-2079.873) * (-2081.170) (-2072.077) [-2075.560] (-2078.241) -- 0:03:48
182600 -- [-2071.380] (-2075.827) (-2075.155) (-2079.688) * [-2078.075] (-2069.588) (-2072.714) (-2084.549) -- 0:03:48
182700 -- (-2071.909) [-2070.483] (-2077.541) (-2078.700) * (-2079.525) [-2070.214] (-2071.756) (-2083.054) -- 0:03:48
182800 -- (-2071.891) (-2069.853) (-2079.371) [-2076.140] * (-2081.681) [-2069.332] (-2082.187) (-2087.463) -- 0:03:47
182900 -- (-2077.320) [-2073.687] (-2081.820) (-2078.746) * [-2070.879] (-2069.385) (-2085.522) (-2086.468) -- 0:03:47
183000 -- [-2081.214] (-2075.845) (-2075.255) (-2086.708) * [-2072.325] (-2073.322) (-2085.621) (-2089.038) -- 0:03:52
Average standard deviation of split frequencies: 0.008234
183100 -- (-2079.275) (-2075.018) [-2071.536] (-2084.619) * [-2075.078] (-2081.868) (-2080.016) (-2084.035) -- 0:03:51
183200 -- [-2080.262] (-2070.375) (-2081.656) (-2087.571) * (-2087.485) [-2070.356] (-2082.578) (-2087.218) -- 0:03:51
183300 -- (-2077.736) [-2066.858] (-2079.737) (-2082.224) * (-2083.812) [-2072.878] (-2081.548) (-2080.573) -- 0:03:51
183400 -- (-2069.624) (-2067.903) [-2077.741] (-2082.470) * (-2082.347) (-2074.569) (-2072.324) [-2076.963] -- 0:03:51
183500 -- (-2077.625) [-2078.869] (-2081.441) (-2077.406) * (-2081.034) [-2070.070] (-2076.196) (-2074.625) -- 0:03:51
183600 -- (-2075.671) [-2074.788] (-2077.479) (-2078.264) * (-2075.476) [-2073.509] (-2075.143) (-2081.337) -- 0:03:51
183700 -- (-2072.569) (-2070.610) [-2073.040] (-2080.319) * (-2082.996) (-2075.970) (-2078.669) [-2082.834] -- 0:03:51
183800 -- (-2077.499) (-2074.052) [-2070.906] (-2086.159) * (-2082.491) (-2089.722) [-2075.248] (-2080.107) -- 0:03:50
183900 -- (-2076.408) [-2072.445] (-2078.865) (-2082.443) * (-2080.130) [-2076.589] (-2077.337) (-2089.680) -- 0:03:50
184000 -- (-2072.104) [-2070.795] (-2082.472) (-2082.974) * (-2083.073) (-2085.095) (-2078.713) [-2076.745] -- 0:03:50
Average standard deviation of split frequencies: 0.008704
184100 -- (-2070.581) [-2073.573] (-2076.671) (-2074.923) * (-2079.190) (-2087.441) [-2077.371] (-2088.691) -- 0:03:50
184200 -- [-2068.972] (-2076.195) (-2080.162) (-2085.334) * (-2073.289) (-2086.585) [-2067.688] (-2079.203) -- 0:03:50
184300 -- [-2076.570] (-2079.189) (-2079.619) (-2079.543) * (-2072.601) (-2084.146) [-2068.220] (-2080.334) -- 0:03:50
184400 -- [-2069.066] (-2078.819) (-2072.275) (-2077.900) * (-2073.298) (-2084.924) [-2073.941] (-2077.641) -- 0:03:49
184500 -- (-2071.066) (-2078.558) (-2075.352) [-2079.515] * (-2076.206) (-2081.548) (-2073.781) [-2073.608] -- 0:03:49
184600 -- (-2069.450) (-2084.990) [-2075.604] (-2081.657) * (-2078.203) (-2078.761) [-2071.347] (-2073.806) -- 0:03:49
184700 -- [-2069.645] (-2083.312) (-2076.139) (-2075.994) * [-2074.556] (-2078.038) (-2075.614) (-2076.389) -- 0:03:49
184800 -- (-2075.897) (-2079.042) [-2073.732] (-2080.550) * (-2078.620) (-2072.795) [-2075.913] (-2080.034) -- 0:03:49
184900 -- [-2076.006] (-2075.101) (-2071.354) (-2095.415) * [-2074.485] (-2072.391) (-2074.602) (-2085.725) -- 0:03:49
185000 -- (-2077.894) (-2085.237) [-2070.182] (-2075.870) * (-2077.949) (-2075.402) [-2072.943] (-2086.574) -- 0:03:49
Average standard deviation of split frequencies: 0.008509
185100 -- (-2076.848) [-2079.515] (-2073.701) (-2084.233) * [-2075.708] (-2080.157) (-2069.540) (-2084.990) -- 0:03:48
185200 -- (-2080.178) [-2081.000] (-2070.168) (-2081.199) * (-2079.684) (-2082.136) [-2069.193] (-2078.505) -- 0:03:48
185300 -- (-2072.733) (-2080.019) [-2068.308] (-2083.714) * [-2083.675] (-2080.964) (-2067.264) (-2077.758) -- 0:03:48
185400 -- (-2078.113) (-2081.259) [-2070.895] (-2090.932) * (-2079.168) (-2077.995) (-2071.594) [-2079.023] -- 0:03:48
185500 -- [-2073.707] (-2086.236) (-2079.808) (-2084.407) * (-2077.658) (-2084.354) (-2071.279) [-2073.883] -- 0:03:48
185600 -- [-2076.662] (-2087.642) (-2077.616) (-2078.350) * [-2074.167] (-2090.565) (-2073.550) (-2078.311) -- 0:03:48
185700 -- (-2081.036) (-2085.360) [-2076.382] (-2075.085) * [-2074.833] (-2078.557) (-2076.295) (-2077.902) -- 0:03:48
185800 -- (-2079.384) (-2078.450) (-2076.354) [-2074.991] * (-2075.575) (-2081.275) [-2073.413] (-2081.417) -- 0:03:47
185900 -- [-2075.647] (-2076.943) (-2079.744) (-2083.797) * [-2078.694] (-2080.829) (-2076.810) (-2081.227) -- 0:03:47
186000 -- (-2072.494) (-2080.382) [-2072.694] (-2085.017) * (-2082.575) (-2083.118) (-2074.791) [-2078.340] -- 0:03:47
Average standard deviation of split frequencies: 0.008683
186100 -- [-2075.636] (-2083.476) (-2073.336) (-2086.255) * [-2083.348] (-2086.599) (-2077.461) (-2077.379) -- 0:03:47
186200 -- (-2075.890) [-2069.310] (-2075.983) (-2086.807) * [-2078.308] (-2083.876) (-2078.588) (-2075.060) -- 0:03:47
186300 -- (-2077.115) (-2070.265) [-2076.854] (-2084.874) * (-2081.788) (-2072.434) (-2082.130) [-2082.486] -- 0:03:47
186400 -- (-2074.083) (-2069.705) (-2083.562) [-2079.054] * (-2087.309) (-2075.600) (-2089.207) [-2079.019] -- 0:03:46
186500 -- (-2077.420) [-2068.440] (-2082.671) (-2080.515) * (-2080.501) [-2075.867] (-2090.662) (-2084.245) -- 0:03:46
186600 -- [-2074.447] (-2072.450) (-2076.083) (-2080.563) * (-2076.731) [-2073.439] (-2078.925) (-2084.290) -- 0:03:51
186700 -- (-2076.130) (-2083.560) [-2070.087] (-2079.921) * [-2076.310] (-2069.210) (-2081.275) (-2081.799) -- 0:03:50
186800 -- (-2079.946) (-2075.913) [-2070.253] (-2079.047) * (-2082.734) [-2068.303] (-2083.224) (-2079.248) -- 0:03:50
186900 -- (-2081.991) [-2066.604] (-2076.358) (-2082.812) * (-2079.207) [-2070.558] (-2078.306) (-2077.424) -- 0:03:50
187000 -- (-2089.227) [-2074.327] (-2073.670) (-2079.626) * (-2088.227) [-2070.114] (-2075.192) (-2080.551) -- 0:03:50
Average standard deviation of split frequencies: 0.008706
187100 -- (-2080.819) (-2074.065) [-2071.118] (-2076.546) * (-2079.262) [-2070.205] (-2073.668) (-2076.480) -- 0:03:50
187200 -- (-2077.982) (-2068.696) [-2069.781] (-2076.777) * (-2079.318) [-2071.966] (-2072.197) (-2077.973) -- 0:03:50
187300 -- (-2078.848) (-2067.239) [-2070.522] (-2082.879) * (-2080.487) (-2077.096) [-2074.144] (-2084.006) -- 0:03:49
187400 -- (-2079.911) [-2069.694] (-2075.121) (-2081.016) * (-2082.048) [-2069.517] (-2076.273) (-2081.906) -- 0:03:49
187500 -- (-2086.312) (-2074.232) (-2073.135) [-2074.655] * (-2085.447) (-2074.392) [-2082.575] (-2082.387) -- 0:03:49
187600 -- (-2080.224) [-2071.154] (-2071.762) (-2075.623) * (-2087.750) [-2068.766] (-2081.660) (-2073.283) -- 0:03:49
187700 -- (-2089.552) [-2070.261] (-2077.424) (-2075.636) * (-2088.998) (-2074.087) [-2075.653] (-2073.320) -- 0:03:49
187800 -- (-2092.735) [-2072.719] (-2077.211) (-2077.820) * (-2083.162) (-2078.720) [-2075.210] (-2080.415) -- 0:03:49
187900 -- (-2082.600) [-2067.498] (-2071.530) (-2076.390) * (-2086.214) (-2077.088) (-2083.498) [-2073.287] -- 0:03:49
188000 -- (-2077.592) (-2069.303) [-2069.081] (-2077.752) * (-2082.688) (-2083.046) [-2072.116] (-2075.074) -- 0:03:48
Average standard deviation of split frequencies: 0.008233
188100 -- [-2072.735] (-2070.129) (-2076.493) (-2074.653) * (-2091.749) (-2080.450) [-2074.235] (-2082.562) -- 0:03:48
188200 -- (-2078.335) (-2074.246) (-2075.941) [-2072.284] * (-2087.835) [-2074.699] (-2073.465) (-2083.746) -- 0:03:48
188300 -- (-2086.045) (-2079.176) (-2075.170) [-2074.258] * (-2079.348) (-2084.047) [-2075.001] (-2081.045) -- 0:03:48
188400 -- [-2076.412] (-2074.984) (-2072.098) (-2075.743) * (-2075.473) (-2078.477) [-2070.066] (-2083.711) -- 0:03:48
188500 -- (-2078.879) [-2074.831] (-2069.241) (-2076.510) * (-2077.186) (-2079.114) [-2070.291] (-2080.627) -- 0:03:48
188600 -- (-2083.902) (-2075.784) [-2067.269] (-2082.964) * (-2084.832) [-2075.023] (-2070.352) (-2080.479) -- 0:03:48
188700 -- (-2077.420) (-2078.512) [-2070.744] (-2080.269) * (-2083.977) [-2075.093] (-2083.614) (-2076.043) -- 0:03:47
188800 -- (-2098.188) [-2079.370] (-2070.877) (-2084.864) * (-2079.617) (-2071.471) [-2077.775] (-2070.974) -- 0:03:47
188900 -- (-2098.078) (-2069.464) [-2076.002] (-2079.849) * (-2083.846) (-2082.601) (-2078.487) [-2079.842] -- 0:03:47
189000 -- (-2102.072) [-2072.137] (-2082.190) (-2075.661) * (-2080.547) (-2081.810) (-2079.096) [-2075.108] -- 0:03:47
Average standard deviation of split frequencies: 0.007688
189100 -- (-2086.532) (-2074.435) [-2073.644] (-2076.260) * (-2084.506) [-2077.461] (-2071.564) (-2082.963) -- 0:03:47
189200 -- (-2091.547) [-2069.402] (-2072.902) (-2086.125) * (-2087.106) (-2073.808) (-2073.761) [-2077.719] -- 0:03:47
189300 -- (-2088.788) (-2077.703) [-2070.867] (-2081.906) * (-2078.368) (-2075.328) [-2067.897] (-2079.044) -- 0:03:46
189400 -- (-2083.655) (-2075.463) [-2070.675] (-2077.152) * (-2086.154) (-2079.575) [-2071.677] (-2082.641) -- 0:03:46
189500 -- (-2087.244) (-2072.807) [-2067.089] (-2080.473) * (-2079.252) (-2072.910) [-2066.999] (-2077.777) -- 0:03:46
189600 -- (-2090.711) (-2075.162) [-2068.381] (-2078.941) * (-2082.294) (-2084.251) [-2074.421] (-2075.405) -- 0:03:46
189700 -- (-2079.226) [-2072.707] (-2069.469) (-2076.711) * [-2077.950] (-2072.824) (-2069.847) (-2077.251) -- 0:03:46
189800 -- (-2082.118) (-2080.882) [-2069.161] (-2074.364) * (-2080.636) (-2071.611) [-2074.897] (-2084.906) -- 0:03:46
189900 -- (-2081.374) (-2077.821) [-2070.320] (-2079.721) * (-2077.578) (-2067.910) [-2077.328] (-2082.461) -- 0:03:46
190000 -- [-2077.574] (-2075.850) (-2077.848) (-2086.639) * (-2077.658) (-2070.705) (-2083.106) [-2073.603] -- 0:03:45
Average standard deviation of split frequencies: 0.007934
190100 -- (-2073.524) (-2081.407) [-2072.022] (-2092.890) * [-2081.474] (-2070.259) (-2075.801) (-2077.599) -- 0:03:50
190200 -- (-2077.845) (-2092.512) [-2069.623] (-2091.664) * (-2083.530) [-2067.795] (-2072.421) (-2084.096) -- 0:03:49
190300 -- (-2077.179) (-2075.418) [-2071.480] (-2084.954) * (-2085.061) [-2067.774] (-2075.827) (-2079.435) -- 0:03:49
190400 -- (-2084.028) [-2073.951] (-2079.722) (-2082.496) * (-2085.757) [-2071.085] (-2077.324) (-2083.425) -- 0:03:49
190500 -- (-2080.203) (-2076.633) (-2081.930) [-2079.443] * (-2086.052) [-2070.080] (-2076.230) (-2083.414) -- 0:03:49
190600 -- (-2085.186) [-2076.561] (-2074.473) (-2085.208) * (-2083.348) [-2068.244] (-2075.537) (-2088.511) -- 0:03:49
190700 -- (-2088.888) [-2077.719] (-2071.402) (-2088.995) * (-2079.426) [-2077.010] (-2074.132) (-2102.840) -- 0:03:49
190800 -- (-2085.261) (-2077.170) [-2071.054] (-2095.436) * (-2078.088) (-2074.571) [-2070.008] (-2087.848) -- 0:03:49
190900 -- (-2086.406) [-2073.065] (-2077.253) (-2089.227) * (-2079.740) [-2072.760] (-2071.309) (-2088.191) -- 0:03:48
191000 -- (-2092.597) [-2073.679] (-2079.355) (-2098.542) * (-2078.995) [-2079.794] (-2076.541) (-2088.425) -- 0:03:48
Average standard deviation of split frequencies: 0.008031
191100 -- (-2090.478) [-2073.059] (-2074.435) (-2098.273) * [-2074.069] (-2079.985) (-2074.790) (-2092.101) -- 0:03:48
191200 -- (-2096.029) [-2074.773] (-2071.008) (-2091.881) * (-2080.534) [-2069.231] (-2075.888) (-2094.406) -- 0:03:48
191300 -- (-2087.288) [-2079.467] (-2071.480) (-2089.630) * (-2077.620) (-2070.090) [-2070.067] (-2090.342) -- 0:03:48
191400 -- (-2087.828) (-2079.049) [-2074.178] (-2080.912) * (-2085.179) [-2072.659] (-2077.919) (-2084.296) -- 0:03:48
191500 -- (-2089.790) [-2071.039] (-2069.530) (-2075.361) * (-2081.916) [-2074.919] (-2075.399) (-2083.074) -- 0:03:47
191600 -- (-2080.896) [-2071.727] (-2076.308) (-2077.330) * (-2083.410) [-2077.689] (-2079.347) (-2080.020) -- 0:03:47
191700 -- (-2092.630) (-2070.534) [-2067.086] (-2075.884) * (-2079.026) (-2073.068) [-2074.790] (-2073.161) -- 0:03:47
191800 -- (-2083.988) (-2071.548) [-2074.516] (-2080.051) * (-2076.923) [-2067.700] (-2077.097) (-2080.827) -- 0:03:47
191900 -- (-2085.841) (-2076.457) [-2071.739] (-2080.348) * (-2076.804) [-2070.212] (-2093.074) (-2075.674) -- 0:03:47
192000 -- (-2088.160) (-2071.242) [-2069.728] (-2095.512) * (-2078.422) [-2076.964] (-2081.338) (-2080.784) -- 0:03:47
Average standard deviation of split frequencies: 0.007921
192100 -- (-2076.201) [-2069.200] (-2074.414) (-2089.603) * [-2070.634] (-2078.110) (-2081.538) (-2080.936) -- 0:03:47
192200 -- (-2071.896) [-2074.936] (-2076.730) (-2078.877) * [-2074.485] (-2077.164) (-2073.885) (-2089.143) -- 0:03:46
192300 -- (-2073.460) [-2071.740] (-2076.306) (-2079.650) * [-2075.858] (-2083.892) (-2077.082) (-2085.138) -- 0:03:46
192400 -- [-2074.277] (-2069.116) (-2073.834) (-2093.285) * (-2076.333) (-2085.109) (-2077.842) [-2078.053] -- 0:03:46
192500 -- (-2075.424) (-2075.447) [-2078.675] (-2084.344) * [-2074.834] (-2081.181) (-2083.321) (-2090.354) -- 0:03:46
192600 -- (-2079.522) [-2074.815] (-2084.842) (-2083.537) * (-2072.528) (-2076.180) [-2076.157] (-2082.823) -- 0:03:46
192700 -- (-2076.695) [-2074.449] (-2079.810) (-2084.861) * (-2073.978) (-2079.452) [-2073.156] (-2095.448) -- 0:03:46
192800 -- (-2076.344) [-2069.093] (-2077.436) (-2077.856) * [-2072.438] (-2083.545) (-2073.389) (-2091.554) -- 0:03:46
192900 -- (-2077.803) (-2072.606) [-2076.441] (-2089.138) * (-2075.948) (-2088.248) [-2070.946] (-2086.098) -- 0:03:45
193000 -- (-2072.187) [-2069.380] (-2076.866) (-2074.432) * (-2072.941) (-2080.315) [-2071.346] (-2078.903) -- 0:03:45
Average standard deviation of split frequencies: 0.008226
193100 -- (-2070.188) [-2071.670] (-2075.277) (-2082.674) * (-2081.815) (-2083.977) [-2075.938] (-2086.238) -- 0:03:45
193200 -- [-2071.492] (-2082.104) (-2080.165) (-2080.192) * [-2080.694] (-2083.906) (-2073.572) (-2086.030) -- 0:03:45
193300 -- (-2073.866) (-2080.177) (-2078.471) [-2081.369] * (-2088.069) (-2090.159) [-2072.541] (-2082.782) -- 0:03:45
193400 -- (-2075.644) (-2079.512) (-2077.675) [-2079.960] * (-2086.416) (-2081.198) [-2074.347] (-2080.863) -- 0:03:45
193500 -- (-2083.850) [-2072.455] (-2079.578) (-2078.992) * (-2083.132) [-2074.693] (-2073.451) (-2077.923) -- 0:03:45
193600 -- (-2075.106) [-2073.905] (-2082.506) (-2080.456) * (-2081.790) (-2083.791) [-2065.559] (-2074.097) -- 0:03:44
193700 -- [-2076.580] (-2070.851) (-2078.726) (-2081.125) * (-2081.319) (-2090.778) [-2069.212] (-2078.754) -- 0:03:48
193800 -- (-2073.283) [-2071.863] (-2074.162) (-2076.599) * (-2084.387) (-2081.652) [-2069.781] (-2089.077) -- 0:03:48
193900 -- (-2075.544) (-2073.392) (-2084.897) [-2080.111] * (-2084.681) (-2077.283) [-2073.206] (-2088.002) -- 0:03:48
194000 -- [-2072.845] (-2069.458) (-2077.398) (-2085.954) * (-2079.555) (-2079.498) [-2075.703] (-2077.517) -- 0:03:48
Average standard deviation of split frequencies: 0.008464
194100 -- (-2080.440) [-2070.370] (-2082.354) (-2079.767) * [-2078.172] (-2089.215) (-2073.703) (-2079.946) -- 0:03:48
194200 -- (-2080.064) (-2076.868) (-2088.606) [-2070.292] * (-2074.770) (-2080.479) (-2085.475) [-2073.703] -- 0:03:48
194300 -- (-2079.721) [-2080.473] (-2087.723) (-2077.602) * (-2077.970) (-2085.910) [-2077.075] (-2073.379) -- 0:03:48
194400 -- (-2079.763) [-2074.508] (-2082.842) (-2071.927) * (-2080.779) (-2086.153) [-2075.413] (-2076.395) -- 0:03:47
194500 -- (-2078.136) (-2070.723) (-2096.205) [-2076.582] * (-2080.487) (-2089.480) [-2084.016] (-2087.291) -- 0:03:47
194600 -- (-2079.623) [-2069.332] (-2082.772) (-2075.738) * (-2083.615) (-2090.889) [-2075.253] (-2081.411) -- 0:03:47
194700 -- [-2080.237] (-2075.105) (-2072.947) (-2077.416) * (-2078.120) (-2084.420) [-2083.566] (-2085.183) -- 0:03:47
194800 -- (-2086.078) [-2074.102] (-2078.654) (-2080.274) * (-2075.874) (-2083.961) [-2071.540] (-2083.271) -- 0:03:47
194900 -- (-2075.608) (-2071.603) [-2076.515] (-2077.760) * (-2084.659) (-2076.469) (-2078.504) [-2077.294] -- 0:03:47
195000 -- (-2077.419) (-2082.023) (-2077.751) [-2072.897] * [-2077.163] (-2081.143) (-2076.454) (-2077.524) -- 0:03:47
Average standard deviation of split frequencies: 0.008280
195100 -- (-2078.302) (-2073.194) (-2071.911) [-2075.689] * (-2072.679) (-2077.448) [-2072.017] (-2089.339) -- 0:03:46
195200 -- (-2073.796) (-2075.581) (-2075.364) [-2081.730] * [-2076.731] (-2083.568) (-2075.946) (-2086.968) -- 0:03:46
195300 -- (-2084.320) [-2070.818] (-2080.200) (-2081.508) * [-2074.921] (-2082.069) (-2073.359) (-2080.674) -- 0:03:46
195400 -- (-2089.295) [-2069.890] (-2089.264) (-2079.716) * (-2085.654) (-2081.207) [-2073.489] (-2087.261) -- 0:03:46
195500 -- (-2090.561) [-2075.065] (-2085.961) (-2078.488) * (-2079.610) (-2088.239) [-2071.779] (-2080.458) -- 0:03:46
195600 -- (-2085.419) (-2071.667) (-2084.582) [-2079.514] * (-2075.866) (-2089.135) [-2071.093] (-2077.557) -- 0:03:46
195700 -- (-2083.319) [-2075.493] (-2079.170) (-2082.471) * (-2074.535) (-2086.418) [-2077.909] (-2084.344) -- 0:03:46
195800 -- (-2083.745) [-2075.749] (-2082.745) (-2082.696) * [-2075.218] (-2086.015) (-2076.065) (-2083.164) -- 0:03:45
195900 -- (-2083.359) [-2069.767] (-2081.181) (-2078.583) * (-2080.582) (-2080.719) [-2078.288] (-2081.624) -- 0:03:45
196000 -- (-2095.740) (-2073.800) [-2077.070] (-2077.924) * [-2075.797] (-2089.848) (-2075.465) (-2077.837) -- 0:03:45
Average standard deviation of split frequencies: 0.007622
196100 -- (-2082.925) [-2079.528] (-2083.787) (-2082.493) * (-2079.290) (-2087.204) [-2077.127] (-2084.588) -- 0:03:45
196200 -- (-2077.440) [-2075.410] (-2083.306) (-2083.058) * (-2077.089) (-2087.212) [-2075.448] (-2082.599) -- 0:03:45
196300 -- [-2082.027] (-2070.972) (-2082.300) (-2083.213) * (-2084.308) (-2086.356) [-2077.134] (-2088.801) -- 0:03:45
196400 -- (-2088.473) (-2078.175) [-2073.072] (-2079.953) * (-2084.087) [-2080.897] (-2087.590) (-2082.320) -- 0:03:45
196500 -- (-2091.531) [-2070.651] (-2077.263) (-2077.069) * (-2084.875) (-2073.799) [-2079.167] (-2082.977) -- 0:03:44
196600 -- (-2093.733) (-2071.886) [-2080.392] (-2078.737) * (-2085.812) [-2074.853] (-2074.498) (-2081.722) -- 0:03:44
196700 -- (-2085.081) (-2072.899) (-2078.609) [-2083.530] * (-2083.222) [-2081.682] (-2084.038) (-2083.030) -- 0:03:44
196800 -- (-2083.181) (-2076.823) (-2084.967) [-2078.678] * (-2084.024) (-2081.985) (-2079.831) [-2073.949] -- 0:03:44
196900 -- (-2083.691) (-2081.815) (-2083.502) [-2079.140] * (-2082.106) (-2076.156) (-2084.102) [-2075.109] -- 0:03:44
197000 -- [-2073.425] (-2070.266) (-2085.350) (-2087.659) * (-2081.850) (-2079.495) (-2087.827) [-2077.064] -- 0:03:44
Average standard deviation of split frequencies: 0.007581
197100 -- (-2073.336) [-2078.842] (-2091.643) (-2083.335) * [-2081.715] (-2081.333) (-2091.593) (-2078.125) -- 0:03:44
197200 -- (-2082.901) [-2074.427] (-2090.873) (-2083.362) * (-2086.676) [-2079.456] (-2084.032) (-2078.861) -- 0:03:43
197300 -- (-2079.763) [-2073.948] (-2090.374) (-2080.441) * (-2084.230) (-2075.643) [-2074.287] (-2078.485) -- 0:03:47
197400 -- [-2071.149] (-2076.884) (-2099.871) (-2084.650) * (-2088.937) (-2078.230) [-2077.231] (-2077.396) -- 0:03:47
197500 -- [-2081.809] (-2074.964) (-2095.249) (-2078.247) * (-2096.272) [-2077.952] (-2082.407) (-2075.551) -- 0:03:47
197600 -- (-2085.738) (-2078.022) (-2089.304) [-2075.668] * (-2078.715) [-2078.094] (-2083.961) (-2076.507) -- 0:03:47
197700 -- (-2082.960) (-2079.687) (-2085.922) [-2075.487] * (-2078.872) [-2079.808] (-2084.969) (-2080.201) -- 0:03:47
197800 -- (-2083.069) (-2081.993) (-2087.398) [-2075.409] * (-2085.484) [-2081.497] (-2085.338) (-2077.544) -- 0:03:47
197900 -- (-2083.586) [-2070.538] (-2084.986) (-2080.800) * (-2083.055) (-2080.247) (-2077.425) [-2073.390] -- 0:03:46
198000 -- (-2077.160) [-2068.540] (-2089.678) (-2084.024) * [-2075.371] (-2083.727) (-2081.085) (-2089.366) -- 0:03:46
Average standard deviation of split frequencies: 0.007614
198100 -- (-2083.245) [-2070.832] (-2090.982) (-2082.978) * (-2088.620) (-2085.151) (-2081.222) [-2080.631] -- 0:03:46
198200 -- (-2078.584) [-2072.612] (-2088.291) (-2082.928) * (-2095.580) [-2075.449] (-2081.753) (-2084.103) -- 0:03:46
198300 -- (-2074.190) [-2073.741] (-2093.707) (-2076.620) * [-2081.008] (-2083.108) (-2079.538) (-2083.791) -- 0:03:46
198400 -- (-2077.968) (-2082.977) (-2088.277) [-2079.631] * (-2079.008) (-2082.663) [-2075.311] (-2083.279) -- 0:03:46
198500 -- (-2082.712) (-2083.727) (-2083.553) [-2081.570] * (-2084.683) [-2072.413] (-2078.386) (-2082.298) -- 0:03:46
198600 -- [-2072.662] (-2073.897) (-2086.763) (-2085.253) * (-2083.301) (-2077.433) [-2078.680] (-2076.774) -- 0:03:45
198700 -- (-2078.573) [-2070.206] (-2088.137) (-2081.707) * (-2078.609) (-2076.738) (-2080.024) [-2080.968] -- 0:03:45
198800 -- (-2077.454) [-2068.799] (-2085.238) (-2085.621) * [-2077.006] (-2085.699) (-2089.377) (-2076.449) -- 0:03:45
198900 -- [-2081.275] (-2072.740) (-2088.963) (-2079.210) * (-2085.180) [-2077.705] (-2091.543) (-2082.526) -- 0:03:45
199000 -- (-2088.320) [-2076.146] (-2085.123) (-2083.065) * (-2084.117) [-2078.888] (-2097.004) (-2080.073) -- 0:03:45
Average standard deviation of split frequencies: 0.007505
199100 -- (-2084.812) [-2072.567] (-2085.116) (-2075.902) * [-2078.537] (-2085.593) (-2092.398) (-2084.047) -- 0:03:45
199200 -- (-2080.880) (-2078.825) [-2086.119] (-2081.927) * (-2075.618) [-2081.443] (-2089.223) (-2083.646) -- 0:03:45
199300 -- [-2072.635] (-2078.117) (-2082.485) (-2077.084) * (-2076.868) (-2095.045) (-2082.091) [-2074.150] -- 0:03:44
199400 -- (-2077.418) [-2077.648] (-2083.355) (-2079.968) * (-2087.390) [-2086.209] (-2083.520) (-2075.937) -- 0:03:44
199500 -- (-2080.582) (-2081.567) [-2079.896] (-2081.696) * (-2081.859) (-2084.631) [-2084.265] (-2077.866) -- 0:03:44
199600 -- [-2080.256] (-2077.315) (-2083.167) (-2079.421) * (-2077.489) (-2081.335) (-2086.699) [-2074.744] -- 0:03:44
199700 -- [-2072.673] (-2069.973) (-2096.299) (-2079.476) * (-2079.742) (-2074.930) (-2086.674) [-2075.949] -- 0:03:44
199800 -- (-2080.946) (-2074.307) (-2092.928) [-2081.237] * (-2078.221) [-2076.681] (-2087.006) (-2079.014) -- 0:03:44
199900 -- [-2076.475] (-2072.232) (-2080.168) (-2077.067) * [-2078.204] (-2076.739) (-2085.241) (-2078.329) -- 0:03:44
200000 -- (-2078.691) [-2077.216] (-2085.142) (-2078.784) * (-2077.314) (-2082.688) (-2091.642) [-2081.028] -- 0:03:43
Average standard deviation of split frequencies: 0.008143
200100 -- (-2091.051) [-2077.419] (-2084.336) (-2083.582) * [-2074.141] (-2081.430) (-2079.989) (-2078.415) -- 0:03:43
200200 -- [-2081.209] (-2076.727) (-2094.309) (-2092.447) * [-2074.968] (-2082.545) (-2071.469) (-2075.627) -- 0:03:43
200300 -- (-2086.592) (-2074.061) [-2078.836] (-2081.282) * (-2079.981) (-2081.172) (-2075.584) [-2073.918] -- 0:03:43
200400 -- (-2080.285) (-2077.801) [-2078.533] (-2078.570) * [-2081.761] (-2078.195) (-2074.120) (-2083.779) -- 0:03:43
200500 -- (-2086.691) (-2079.298) [-2081.867] (-2082.143) * (-2083.831) [-2077.714] (-2075.219) (-2076.687) -- 0:03:43
200600 -- (-2090.151) (-2084.669) [-2076.789] (-2081.660) * (-2081.956) [-2075.898] (-2076.717) (-2073.235) -- 0:03:43
200700 -- [-2084.199] (-2079.511) (-2084.948) (-2076.374) * (-2079.995) (-2077.290) [-2075.827] (-2086.052) -- 0:03:43
200800 -- [-2079.935] (-2078.868) (-2091.807) (-2079.862) * (-2080.026) (-2083.460) (-2075.842) [-2080.095] -- 0:03:46
200900 -- (-2077.448) (-2076.444) (-2092.022) [-2077.129] * (-2083.726) (-2084.153) (-2076.857) [-2078.545] -- 0:03:46
201000 -- (-2084.815) [-2074.092] (-2096.202) (-2082.461) * [-2088.113] (-2083.358) (-2077.780) (-2078.205) -- 0:03:46
Average standard deviation of split frequencies: 0.007899
201100 -- (-2084.787) (-2076.576) (-2086.504) [-2081.114] * (-2086.436) [-2080.650] (-2080.048) (-2081.605) -- 0:03:46
201200 -- (-2081.261) [-2068.639] (-2089.916) (-2074.556) * [-2076.590] (-2083.131) (-2071.083) (-2075.393) -- 0:03:46
201300 -- (-2078.433) [-2068.890] (-2083.924) (-2077.453) * (-2075.352) (-2082.387) [-2073.988] (-2075.092) -- 0:03:46
201400 -- (-2090.677) (-2081.446) [-2079.459] (-2089.070) * [-2076.200] (-2081.197) (-2074.338) (-2082.027) -- 0:03:46
201500 -- (-2085.984) [-2080.833] (-2075.650) (-2084.732) * (-2076.047) (-2080.232) (-2082.235) [-2074.649] -- 0:03:45
201600 -- (-2074.714) [-2078.100] (-2083.081) (-2078.612) * (-2074.327) (-2079.515) [-2076.376] (-2078.210) -- 0:03:45
201700 -- (-2076.111) [-2070.376] (-2077.782) (-2081.171) * [-2075.153] (-2075.848) (-2073.273) (-2088.035) -- 0:03:45
201800 -- (-2073.578) [-2073.471] (-2079.754) (-2080.489) * (-2077.565) (-2076.846) [-2071.443] (-2077.949) -- 0:03:45
201900 -- (-2084.612) (-2073.726) (-2087.534) [-2078.749] * (-2080.055) (-2077.060) (-2082.143) [-2077.314] -- 0:03:45
202000 -- (-2086.284) (-2076.954) (-2084.650) [-2080.959] * (-2081.591) (-2081.052) (-2082.991) [-2076.936] -- 0:03:45
Average standard deviation of split frequencies: 0.007796
202100 -- (-2078.427) (-2078.938) (-2078.392) [-2075.909] * (-2080.713) [-2073.804] (-2077.481) (-2073.346) -- 0:03:45
202200 -- (-2082.492) (-2076.547) (-2076.632) [-2075.132] * [-2081.822] (-2079.490) (-2074.969) (-2086.771) -- 0:03:44
202300 -- (-2083.768) (-2070.907) (-2083.926) [-2077.233] * (-2080.388) (-2078.099) (-2076.990) [-2080.382] -- 0:03:44
202400 -- (-2072.414) [-2075.621] (-2076.056) (-2083.297) * (-2085.003) [-2076.715] (-2076.625) (-2076.261) -- 0:03:44
202500 -- (-2075.623) (-2074.085) [-2074.678] (-2077.685) * (-2085.203) (-2079.412) [-2077.718] (-2079.213) -- 0:03:44
202600 -- [-2075.900] (-2082.228) (-2078.106) (-2080.505) * (-2090.286) (-2081.488) [-2071.486] (-2086.276) -- 0:03:44
202700 -- [-2080.237] (-2074.673) (-2087.398) (-2084.229) * (-2093.705) [-2078.335] (-2076.664) (-2078.307) -- 0:03:44
202800 -- (-2076.787) [-2075.322] (-2081.555) (-2084.772) * (-2087.898) (-2077.466) [-2077.993] (-2079.143) -- 0:03:44
202900 -- (-2079.097) (-2076.509) [-2086.273] (-2084.036) * (-2077.821) (-2079.033) [-2069.602] (-2079.139) -- 0:03:43
203000 -- (-2078.550) [-2069.660] (-2080.410) (-2080.413) * (-2078.283) [-2074.640] (-2073.638) (-2082.825) -- 0:03:43
Average standard deviation of split frequencies: 0.008087
203100 -- (-2079.810) [-2075.263] (-2088.799) (-2077.683) * (-2079.140) (-2079.343) [-2067.215] (-2093.582) -- 0:03:43
203200 -- (-2081.602) [-2074.554] (-2082.128) (-2083.673) * (-2083.051) [-2072.577] (-2074.282) (-2073.863) -- 0:03:43
203300 -- (-2083.645) [-2070.038] (-2079.823) (-2087.910) * [-2078.117] (-2078.212) (-2075.470) (-2079.879) -- 0:03:43
203400 -- (-2082.579) [-2074.656] (-2078.336) (-2082.105) * (-2089.053) (-2081.381) [-2075.118] (-2089.929) -- 0:03:43
203500 -- (-2083.195) [-2075.090] (-2078.947) (-2086.565) * (-2088.286) (-2080.659) [-2073.338] (-2087.650) -- 0:03:43
203600 -- (-2078.956) [-2069.097] (-2079.284) (-2082.069) * (-2091.667) (-2081.550) (-2079.202) [-2077.298] -- 0:03:42
203700 -- (-2079.466) [-2075.376] (-2087.366) (-2087.477) * (-2084.556) (-2074.530) [-2076.894] (-2079.269) -- 0:03:42
203800 -- (-2080.983) [-2074.444] (-2081.791) (-2087.937) * (-2089.157) [-2075.623] (-2079.161) (-2071.558) -- 0:03:42
203900 -- [-2077.297] (-2075.512) (-2080.751) (-2081.975) * (-2089.778) (-2072.188) (-2078.701) [-2073.143] -- 0:03:42
204000 -- (-2079.594) [-2072.962] (-2076.988) (-2079.512) * (-2087.737) (-2075.602) [-2075.164] (-2076.876) -- 0:03:42
Average standard deviation of split frequencies: 0.007192
204100 -- (-2089.425) [-2072.284] (-2098.140) (-2084.145) * (-2086.882) (-2078.177) (-2083.425) [-2072.210] -- 0:03:42
204200 -- [-2085.456] (-2077.903) (-2088.928) (-2081.157) * (-2087.735) [-2077.188] (-2080.564) (-2073.181) -- 0:03:42
204300 -- (-2092.179) (-2079.455) (-2078.592) [-2077.237] * (-2090.346) (-2079.776) (-2079.867) [-2070.527] -- 0:03:42
204400 -- (-2080.812) (-2072.484) [-2077.832] (-2080.974) * (-2085.513) (-2078.141) (-2071.769) [-2077.051] -- 0:03:45
204500 -- (-2092.845) (-2076.203) [-2079.167] (-2087.290) * (-2093.852) (-2075.480) [-2074.076] (-2079.654) -- 0:03:45
204600 -- (-2077.891) (-2076.782) [-2075.861] (-2081.607) * (-2088.438) [-2079.211] (-2072.934) (-2083.466) -- 0:03:45
204700 -- (-2081.703) (-2090.701) (-2076.240) [-2081.478] * (-2084.988) (-2082.858) [-2072.832] (-2072.934) -- 0:03:45
204800 -- (-2078.539) (-2083.978) (-2084.991) [-2080.015] * (-2078.361) (-2081.940) (-2069.392) [-2078.834] -- 0:03:45
204900 -- (-2075.412) [-2075.376] (-2089.427) (-2083.215) * (-2079.349) (-2079.908) [-2069.502] (-2076.375) -- 0:03:45
205000 -- [-2075.432] (-2075.176) (-2086.274) (-2088.330) * (-2087.281) (-2082.333) [-2071.543] (-2081.146) -- 0:03:44
Average standard deviation of split frequencies: 0.007089
205100 -- (-2080.255) (-2086.908) (-2089.672) [-2071.529] * (-2092.086) [-2080.134] (-2082.918) (-2070.773) -- 0:03:44
205200 -- (-2092.402) [-2070.013] (-2080.914) (-2072.036) * (-2080.413) (-2079.456) (-2079.574) [-2070.777] -- 0:03:44
205300 -- (-2087.068) (-2084.128) (-2086.718) [-2074.091] * (-2084.428) (-2079.515) (-2079.304) [-2071.086] -- 0:03:44
205400 -- (-2083.317) (-2084.539) (-2081.626) [-2078.550] * [-2076.336] (-2076.272) (-2076.107) (-2078.697) -- 0:03:44
205500 -- (-2080.394) [-2079.134] (-2081.743) (-2076.367) * [-2075.137] (-2080.406) (-2074.025) (-2078.385) -- 0:03:44
205600 -- (-2086.247) [-2071.822] (-2087.198) (-2081.014) * (-2078.477) (-2082.827) [-2076.252] (-2079.215) -- 0:03:44
205700 -- (-2081.168) [-2069.259] (-2080.323) (-2078.928) * (-2080.634) (-2085.567) (-2078.497) [-2072.298] -- 0:03:43
205800 -- (-2080.929) [-2073.410] (-2079.967) (-2080.513) * (-2098.062) (-2083.542) [-2074.151] (-2076.985) -- 0:03:43
205900 -- (-2078.610) (-2071.093) [-2082.073] (-2085.646) * (-2090.236) (-2089.281) [-2078.653] (-2082.790) -- 0:03:43
206000 -- (-2093.611) (-2071.056) (-2090.525) [-2078.627] * (-2086.492) (-2083.580) [-2070.958] (-2075.205) -- 0:03:43
Average standard deviation of split frequencies: 0.007187
206100 -- (-2080.923) [-2072.602] (-2097.518) (-2080.570) * (-2078.188) (-2093.956) [-2078.032] (-2080.723) -- 0:03:43
206200 -- (-2080.384) (-2075.607) (-2081.596) [-2075.465] * (-2084.578) [-2084.761] (-2074.893) (-2074.441) -- 0:03:43
206300 -- (-2080.930) (-2079.761) [-2081.563] (-2085.510) * [-2077.142] (-2090.378) (-2073.297) (-2071.072) -- 0:03:43
206400 -- (-2083.636) (-2085.148) [-2076.459] (-2078.272) * (-2077.755) (-2080.470) (-2070.577) [-2068.298] -- 0:03:43
206500 -- [-2080.783] (-2079.705) (-2076.984) (-2077.798) * (-2079.366) (-2089.969) (-2074.083) [-2071.140] -- 0:03:42
206600 -- (-2083.072) (-2092.950) [-2078.213] (-2088.686) * (-2079.067) (-2081.388) [-2072.488] (-2070.267) -- 0:03:42
206700 -- [-2076.789] (-2090.525) (-2079.852) (-2087.317) * (-2078.276) (-2078.294) (-2072.476) [-2071.349] -- 0:03:42
206800 -- [-2081.469] (-2090.965) (-2077.293) (-2078.709) * (-2083.894) (-2079.311) (-2076.784) [-2075.070] -- 0:03:42
206900 -- (-2083.760) [-2074.156] (-2078.163) (-2094.298) * (-2075.537) [-2076.767] (-2076.288) (-2078.118) -- 0:03:42
207000 -- (-2076.217) (-2076.660) [-2079.390] (-2084.770) * (-2079.817) (-2079.808) [-2077.852] (-2085.939) -- 0:03:42
Average standard deviation of split frequencies: 0.007280
207100 -- (-2084.564) (-2078.417) (-2078.567) [-2075.144] * (-2084.541) (-2084.945) [-2070.277] (-2075.578) -- 0:03:42
207200 -- (-2078.933) (-2076.360) [-2074.839] (-2080.305) * (-2079.616) (-2081.052) [-2073.496] (-2070.732) -- 0:03:41
207300 -- (-2084.848) [-2075.555] (-2078.090) (-2082.790) * [-2078.050] (-2092.866) (-2072.682) (-2077.212) -- 0:03:41
207400 -- (-2080.327) [-2073.334] (-2079.509) (-2081.441) * (-2073.052) (-2092.826) [-2069.096] (-2075.382) -- 0:03:41
207500 -- (-2088.569) [-2076.147] (-2075.666) (-2076.457) * (-2075.241) (-2089.514) (-2070.098) [-2076.339] -- 0:03:41
207600 -- (-2081.182) [-2072.131] (-2072.975) (-2085.516) * [-2076.672] (-2084.740) (-2075.298) (-2073.455) -- 0:03:41
207700 -- (-2073.450) [-2071.539] (-2074.888) (-2079.468) * (-2075.188) (-2087.823) [-2076.082] (-2079.137) -- 0:03:41
207800 -- (-2073.809) (-2076.283) [-2080.335] (-2084.294) * [-2074.047] (-2084.226) (-2074.130) (-2086.663) -- 0:03:41
207900 -- [-2070.692] (-2074.288) (-2076.832) (-2076.786) * (-2075.084) (-2086.756) [-2074.903] (-2081.327) -- 0:03:44
208000 -- [-2071.503] (-2076.320) (-2081.099) (-2089.380) * (-2074.114) (-2081.931) [-2073.340] (-2092.245) -- 0:03:44
Average standard deviation of split frequencies: 0.006924
208100 -- (-2077.309) (-2072.015) (-2080.764) [-2078.004] * (-2076.744) (-2080.796) [-2077.894] (-2081.937) -- 0:03:44
208200 -- (-2075.742) [-2071.969] (-2087.358) (-2082.055) * (-2088.399) [-2075.169] (-2075.489) (-2086.379) -- 0:03:44
208300 -- (-2073.459) (-2074.122) [-2077.454] (-2079.181) * (-2078.848) (-2077.961) [-2073.995] (-2079.226) -- 0:03:44
208400 -- (-2070.789) [-2078.227] (-2075.299) (-2084.987) * [-2074.789] (-2078.649) (-2082.666) (-2084.119) -- 0:03:44
208500 -- [-2068.293] (-2082.092) (-2081.966) (-2078.885) * [-2073.365] (-2077.288) (-2066.521) (-2090.830) -- 0:03:43
208600 -- (-2071.928) (-2081.963) (-2075.516) [-2082.398] * [-2075.825] (-2080.546) (-2074.099) (-2081.347) -- 0:03:43
208700 -- (-2070.038) (-2080.991) [-2076.996] (-2083.435) * [-2079.718] (-2089.378) (-2075.603) (-2075.608) -- 0:03:43
208800 -- [-2072.762] (-2087.106) (-2076.457) (-2080.700) * (-2074.595) (-2083.943) [-2072.760] (-2074.397) -- 0:03:43
208900 -- (-2078.677) (-2077.283) [-2075.400] (-2078.115) * (-2081.036) (-2086.359) [-2075.822] (-2083.129) -- 0:03:43
209000 -- [-2070.569] (-2075.968) (-2074.223) (-2082.380) * (-2082.809) (-2078.767) [-2071.944] (-2077.059) -- 0:03:43
Average standard deviation of split frequencies: 0.006696
209100 -- [-2074.943] (-2089.519) (-2075.692) (-2085.590) * (-2113.674) [-2075.910] (-2080.230) (-2076.620) -- 0:03:43
209200 -- (-2072.387) (-2075.520) [-2076.505] (-2078.535) * (-2103.709) (-2084.044) [-2072.193] (-2075.438) -- 0:03:43
209300 -- [-2074.127] (-2074.154) (-2082.426) (-2087.939) * (-2091.545) (-2078.284) [-2068.827] (-2076.556) -- 0:03:42
209400 -- [-2074.960] (-2077.772) (-2078.115) (-2083.966) * (-2078.064) (-2074.827) [-2068.278] (-2084.893) -- 0:03:42
209500 -- (-2085.536) (-2079.163) [-2074.877] (-2086.068) * (-2076.341) (-2081.262) [-2071.977] (-2076.756) -- 0:03:42
209600 -- [-2076.060] (-2075.748) (-2080.481) (-2086.221) * (-2071.103) (-2076.518) (-2079.872) [-2073.530] -- 0:03:42
209700 -- [-2077.096] (-2082.958) (-2079.889) (-2081.658) * [-2076.375] (-2084.366) (-2072.838) (-2082.654) -- 0:03:42
209800 -- (-2079.666) (-2082.052) (-2078.530) [-2077.341] * (-2076.801) (-2081.883) [-2080.906] (-2082.459) -- 0:03:42
209900 -- [-2072.558] (-2084.687) (-2082.967) (-2078.161) * (-2073.036) (-2082.189) [-2071.753] (-2089.874) -- 0:03:42
210000 -- (-2080.496) [-2077.263] (-2076.382) (-2087.821) * [-2080.347] (-2081.159) (-2078.396) (-2082.090) -- 0:03:41
Average standard deviation of split frequencies: 0.005897
210100 -- (-2076.821) (-2087.318) [-2077.283] (-2075.719) * (-2074.344) (-2081.928) [-2072.028] (-2082.715) -- 0:03:41
210200 -- (-2072.374) (-2079.667) [-2081.777] (-2078.542) * (-2076.024) (-2079.843) [-2072.424] (-2089.621) -- 0:03:41
210300 -- (-2073.763) [-2075.533] (-2079.614) (-2073.817) * (-2072.589) (-2081.984) [-2075.605] (-2078.157) -- 0:03:41
210400 -- (-2070.229) (-2085.249) (-2084.505) [-2074.368] * (-2073.869) [-2079.123] (-2074.651) (-2080.943) -- 0:03:41
210500 -- [-2074.889] (-2088.380) (-2081.482) (-2076.307) * [-2073.725] (-2086.966) (-2075.370) (-2080.231) -- 0:03:41
210600 -- (-2082.599) (-2084.508) (-2087.819) [-2077.263] * [-2070.308] (-2081.635) (-2080.732) (-2082.122) -- 0:03:41
210700 -- (-2077.102) [-2078.428] (-2085.442) (-2075.983) * (-2080.093) (-2078.307) (-2079.766) [-2078.371] -- 0:03:41
210800 -- (-2077.707) [-2081.529] (-2083.953) (-2076.373) * (-2075.022) [-2075.188] (-2080.652) (-2072.591) -- 0:03:40
210900 -- (-2083.511) (-2085.340) (-2084.958) [-2077.303] * [-2070.920] (-2078.042) (-2091.180) (-2073.762) -- 0:03:40
211000 -- (-2079.963) (-2082.582) (-2082.331) [-2073.471] * (-2070.362) (-2083.191) (-2093.984) [-2075.152] -- 0:03:40
Average standard deviation of split frequencies: 0.005102
211100 -- (-2076.205) [-2080.573] (-2078.264) (-2075.786) * [-2071.093] (-2083.337) (-2091.751) (-2075.508) -- 0:03:40
211200 -- [-2078.434] (-2084.921) (-2087.250) (-2077.981) * [-2077.284] (-2082.771) (-2088.732) (-2083.796) -- 0:03:40
211300 -- (-2082.183) (-2082.316) (-2079.046) [-2076.871] * (-2076.134) (-2087.127) (-2097.765) [-2086.370] -- 0:03:40
211400 -- (-2083.270) [-2078.404] (-2085.950) (-2081.237) * (-2077.901) (-2088.604) (-2087.122) [-2080.786] -- 0:03:40
211500 -- [-2076.533] (-2078.141) (-2081.224) (-2076.908) * (-2076.522) (-2082.535) (-2079.193) [-2077.031] -- 0:03:43
211600 -- (-2078.260) (-2077.493) (-2078.206) [-2077.166] * [-2074.634] (-2078.967) (-2084.712) (-2079.212) -- 0:03:43
211700 -- [-2080.266] (-2083.425) (-2078.471) (-2082.104) * [-2071.875] (-2085.546) (-2078.278) (-2076.183) -- 0:03:43
211800 -- [-2076.925] (-2082.393) (-2079.061) (-2091.722) * [-2072.481] (-2086.966) (-2091.134) (-2078.058) -- 0:03:43
211900 -- (-2078.467) (-2080.818) [-2076.890] (-2083.560) * [-2078.616] (-2093.068) (-2076.202) (-2079.894) -- 0:03:43
212000 -- [-2073.050] (-2081.853) (-2078.590) (-2090.778) * [-2069.216] (-2104.859) (-2072.186) (-2076.593) -- 0:03:43
Average standard deviation of split frequencies: 0.005397
212100 -- (-2070.545) [-2076.317] (-2081.247) (-2084.586) * [-2075.164] (-2098.766) (-2075.821) (-2077.733) -- 0:03:42
212200 -- (-2069.202) (-2090.343) [-2077.517] (-2088.204) * (-2073.600) (-2080.874) [-2075.139] (-2081.035) -- 0:03:42
212300 -- (-2072.620) (-2086.936) [-2074.413] (-2089.464) * (-2078.619) (-2083.159) [-2077.126] (-2082.662) -- 0:03:42
212400 -- [-2075.912] (-2081.885) (-2075.251) (-2088.296) * (-2083.904) (-2081.348) [-2079.584] (-2086.658) -- 0:03:42
212500 -- (-2071.715) (-2094.973) [-2075.029] (-2089.603) * (-2082.145) [-2083.314] (-2081.784) (-2083.998) -- 0:03:42
212600 -- [-2071.855] (-2095.431) (-2083.471) (-2083.937) * (-2074.881) (-2090.774) (-2073.893) [-2081.678] -- 0:03:42
212700 -- [-2071.253] (-2087.360) (-2080.250) (-2081.891) * (-2077.166) (-2089.838) [-2069.680] (-2080.520) -- 0:03:42
212800 -- [-2073.992] (-2080.423) (-2077.768) (-2081.631) * (-2082.237) (-2086.703) [-2070.024] (-2087.554) -- 0:03:41
212900 -- (-2071.619) [-2080.793] (-2080.674) (-2084.727) * (-2072.121) (-2081.454) [-2067.469] (-2092.914) -- 0:03:41
213000 -- [-2075.235] (-2080.906) (-2078.407) (-2083.528) * (-2070.345) (-2087.485) [-2076.575] (-2084.455) -- 0:03:41
Average standard deviation of split frequencies: 0.005496
213100 -- (-2076.737) (-2079.599) [-2074.946] (-2074.831) * (-2073.906) (-2084.494) [-2070.067] (-2086.427) -- 0:03:41
213200 -- (-2082.081) (-2085.680) (-2074.638) [-2075.485] * (-2077.006) (-2088.009) [-2069.027] (-2081.051) -- 0:03:41
213300 -- (-2078.173) (-2080.784) [-2082.188] (-2081.610) * (-2087.813) (-2085.360) [-2073.190] (-2088.927) -- 0:03:41
213400 -- (-2079.941) (-2083.984) [-2074.198] (-2077.949) * [-2072.960] (-2085.974) (-2080.351) (-2090.930) -- 0:03:41
213500 -- (-2082.387) (-2078.848) [-2080.486] (-2079.597) * [-2071.103] (-2078.037) (-2074.686) (-2089.693) -- 0:03:41
213600 -- (-2078.663) (-2083.750) (-2080.738) [-2069.624] * (-2076.372) (-2086.393) (-2081.144) [-2077.287] -- 0:03:40
213700 -- (-2073.641) (-2081.920) (-2077.371) [-2076.968] * (-2078.173) [-2081.226] (-2075.971) (-2081.106) -- 0:03:40
213800 -- (-2078.929) (-2081.010) (-2078.169) [-2076.854] * (-2081.884) (-2082.895) (-2076.568) [-2079.769] -- 0:03:40
213900 -- (-2087.317) (-2076.891) (-2075.655) [-2076.796] * [-2071.246] (-2076.145) (-2075.263) (-2082.044) -- 0:03:40
214000 -- (-2078.043) [-2078.706] (-2082.842) (-2078.588) * (-2082.666) [-2074.313] (-2075.493) (-2090.971) -- 0:03:40
Average standard deviation of split frequencies: 0.005598
214100 -- [-2073.941] (-2079.802) (-2085.039) (-2082.140) * (-2079.109) (-2077.913) [-2077.059] (-2084.234) -- 0:03:40
214200 -- (-2077.486) (-2080.722) (-2077.654) [-2081.215] * (-2078.304) (-2082.834) [-2075.512] (-2085.689) -- 0:03:40
214300 -- (-2074.416) (-2080.381) (-2075.524) [-2080.757] * (-2084.717) (-2084.381) [-2077.628] (-2080.261) -- 0:03:39
214400 -- [-2071.985] (-2082.683) (-2078.229) (-2080.856) * (-2081.846) (-2086.054) (-2084.557) [-2075.173] -- 0:03:39
214500 -- [-2073.911] (-2085.957) (-2078.058) (-2078.513) * (-2076.409) (-2076.029) (-2080.371) [-2079.562] -- 0:03:39
214600 -- (-2084.272) (-2085.788) (-2079.569) [-2077.050] * (-2076.696) (-2077.021) [-2078.631] (-2080.882) -- 0:03:39
214700 -- [-2074.207] (-2080.132) (-2088.247) (-2080.697) * (-2084.552) [-2074.668] (-2073.608) (-2085.715) -- 0:03:39
214800 -- [-2071.380] (-2078.577) (-2082.893) (-2075.199) * (-2082.293) (-2077.043) [-2075.853] (-2082.648) -- 0:03:39
214900 -- [-2074.105] (-2087.183) (-2082.341) (-2085.328) * (-2087.143) (-2078.053) [-2073.659] (-2085.964) -- 0:03:39
215000 -- (-2073.970) (-2084.204) (-2084.829) [-2076.652] * (-2087.186) (-2081.505) (-2073.634) [-2082.007] -- 0:03:42
Average standard deviation of split frequencies: 0.005633
215100 -- (-2078.662) (-2077.680) (-2076.930) [-2077.256] * [-2077.783] (-2084.516) (-2072.844) (-2080.610) -- 0:03:42
215200 -- (-2075.716) (-2076.973) (-2082.524) [-2078.151] * [-2070.747] (-2076.946) (-2079.298) (-2088.686) -- 0:03:42
215300 -- (-2070.404) (-2075.619) [-2080.092] (-2083.397) * (-2074.018) (-2078.454) (-2074.451) [-2076.536] -- 0:03:42
215400 -- (-2074.858) (-2079.377) (-2075.583) [-2079.614] * (-2077.121) (-2080.388) [-2072.759] (-2072.772) -- 0:03:42
215500 -- [-2077.718] (-2082.751) (-2075.641) (-2084.410) * [-2069.561] (-2080.983) (-2072.477) (-2077.029) -- 0:03:42
215600 -- [-2068.594] (-2089.889) (-2088.765) (-2082.189) * [-2073.940] (-2087.605) (-2079.911) (-2077.707) -- 0:03:41
215700 -- [-2075.686] (-2080.154) (-2084.501) (-2086.293) * (-2076.045) (-2080.763) (-2075.702) [-2074.921] -- 0:03:41
215800 -- [-2077.945] (-2079.603) (-2100.111) (-2082.624) * (-2076.553) (-2081.386) [-2079.475] (-2073.507) -- 0:03:41
215900 -- [-2075.483] (-2079.007) (-2092.691) (-2078.398) * (-2077.745) (-2078.896) (-2078.091) [-2072.328] -- 0:03:41
216000 -- (-2079.506) (-2083.130) (-2098.539) [-2078.117] * (-2085.555) [-2075.164] (-2087.756) (-2070.716) -- 0:03:41
Average standard deviation of split frequencies: 0.005546
216100 -- [-2071.470] (-2082.696) (-2106.105) (-2082.820) * [-2070.392] (-2077.043) (-2076.784) (-2070.283) -- 0:03:41
216200 -- (-2073.638) [-2077.595] (-2101.674) (-2073.688) * (-2078.324) (-2077.161) (-2079.805) [-2067.564] -- 0:03:41
216300 -- [-2070.181] (-2077.755) (-2089.277) (-2080.717) * (-2075.011) (-2078.133) (-2087.737) [-2074.946] -- 0:03:41
216400 -- (-2074.778) (-2077.271) (-2095.390) [-2079.943] * [-2073.480] (-2086.346) (-2081.530) (-2076.090) -- 0:03:40
216500 -- [-2072.149] (-2086.708) (-2090.134) (-2085.191) * (-2074.667) (-2079.587) (-2079.882) [-2071.502] -- 0:03:40
216600 -- [-2068.412] (-2083.240) (-2092.862) (-2091.488) * (-2073.079) (-2085.810) (-2080.087) [-2070.454] -- 0:03:40
216700 -- (-2069.747) (-2081.962) (-2084.569) [-2086.793] * [-2068.533] (-2072.343) (-2083.879) (-2077.331) -- 0:03:40
216800 -- [-2071.295] (-2087.919) (-2079.169) (-2095.932) * (-2073.797) (-2076.176) (-2075.234) [-2078.003] -- 0:03:40
216900 -- [-2073.067] (-2075.785) (-2075.273) (-2091.789) * (-2075.102) [-2072.890] (-2074.430) (-2080.510) -- 0:03:40
217000 -- [-2072.417] (-2074.536) (-2078.917) (-2093.108) * [-2068.192] (-2075.233) (-2078.365) (-2089.395) -- 0:03:40
Average standard deviation of split frequencies: 0.005581
217100 -- (-2072.603) [-2077.253] (-2082.525) (-2092.775) * [-2069.809] (-2081.012) (-2081.284) (-2081.022) -- 0:03:39
217200 -- (-2073.668) [-2078.662] (-2086.436) (-2090.352) * [-2071.935] (-2087.588) (-2070.626) (-2079.256) -- 0:03:39
217300 -- (-2075.055) (-2075.088) [-2078.697] (-2081.017) * [-2073.350] (-2080.781) (-2073.313) (-2079.186) -- 0:03:39
217400 -- [-2077.243] (-2078.979) (-2084.794) (-2079.089) * (-2074.737) (-2077.650) (-2079.552) [-2074.481] -- 0:03:39
217500 -- (-2082.086) [-2076.933] (-2083.639) (-2084.781) * (-2076.713) (-2077.917) (-2076.425) [-2069.807] -- 0:03:39
217600 -- (-2080.483) (-2075.903) [-2074.477] (-2080.190) * (-2079.035) (-2075.438) (-2070.448) [-2075.561] -- 0:03:39
217700 -- (-2075.746) [-2074.626] (-2076.966) (-2077.666) * [-2071.905] (-2075.170) (-2075.224) (-2079.383) -- 0:03:39
217800 -- [-2074.510] (-2078.382) (-2084.155) (-2077.223) * (-2075.515) (-2080.890) (-2068.307) [-2075.773] -- 0:03:39
217900 -- [-2069.212] (-2082.080) (-2094.431) (-2077.582) * (-2077.496) (-2086.027) [-2070.552] (-2082.358) -- 0:03:38
218000 -- (-2078.670) (-2082.166) (-2080.239) [-2079.208] * (-2078.251) (-2081.507) [-2071.528] (-2077.779) -- 0:03:38
Average standard deviation of split frequencies: 0.005434
218100 -- (-2093.131) (-2079.203) [-2079.569] (-2073.804) * [-2075.447] (-2077.384) (-2082.933) (-2080.667) -- 0:03:38
218200 -- (-2081.822) (-2083.623) [-2075.860] (-2077.212) * (-2082.419) (-2080.184) [-2072.386] (-2082.697) -- 0:03:38
218300 -- (-2084.418) (-2075.889) (-2077.960) [-2074.970] * (-2073.511) (-2079.421) [-2071.617] (-2091.233) -- 0:03:38
218400 -- (-2083.616) [-2079.180] (-2081.905) (-2076.208) * (-2080.500) (-2078.474) [-2071.920] (-2080.162) -- 0:03:38
218500 -- (-2074.561) (-2081.305) (-2077.591) [-2074.943] * (-2079.608) (-2086.249) [-2070.837] (-2081.850) -- 0:03:38
218600 -- [-2074.654] (-2083.869) (-2076.279) (-2072.084) * [-2073.177] (-2090.907) (-2072.251) (-2078.363) -- 0:03:41
218700 -- [-2075.104] (-2085.520) (-2077.240) (-2075.958) * (-2077.596) (-2080.587) [-2078.959] (-2075.177) -- 0:03:41
218800 -- [-2076.276] (-2088.765) (-2088.408) (-2073.640) * (-2071.228) (-2078.134) [-2071.341] (-2076.141) -- 0:03:41
218900 -- (-2079.857) (-2087.494) [-2077.060] (-2078.900) * [-2071.354] (-2075.567) (-2083.144) (-2074.790) -- 0:03:41
219000 -- (-2079.831) [-2076.578] (-2084.011) (-2082.233) * (-2073.250) (-2080.800) [-2072.449] (-2079.051) -- 0:03:41
Average standard deviation of split frequencies: 0.004977
219100 -- (-2084.900) (-2081.827) (-2084.691) [-2077.685] * (-2077.709) (-2081.792) [-2069.616] (-2084.767) -- 0:03:40
219200 -- (-2082.167) [-2077.348] (-2090.257) (-2083.358) * (-2072.436) (-2082.431) [-2073.524] (-2081.371) -- 0:03:40
219300 -- [-2077.345] (-2082.458) (-2097.761) (-2077.135) * [-2070.866] (-2081.123) (-2082.530) (-2076.872) -- 0:03:40
219400 -- (-2075.057) [-2073.832] (-2093.001) (-2074.139) * (-2081.964) (-2080.434) (-2087.565) [-2076.316] -- 0:03:40
219500 -- [-2074.525] (-2075.155) (-2078.143) (-2082.179) * (-2078.876) (-2079.931) [-2077.321] (-2081.744) -- 0:03:40
219600 -- (-2073.785) [-2080.128] (-2076.704) (-2087.289) * (-2074.637) [-2075.402] (-2088.126) (-2080.312) -- 0:03:40
219700 -- (-2077.192) (-2082.152) [-2076.210] (-2079.605) * (-2079.550) [-2075.166] (-2098.768) (-2091.900) -- 0:03:40
219800 -- [-2077.177] (-2075.553) (-2077.168) (-2087.165) * [-2080.734] (-2077.283) (-2084.366) (-2074.879) -- 0:03:40
219900 -- (-2078.586) [-2074.459] (-2079.938) (-2076.765) * (-2080.025) (-2077.962) (-2074.584) [-2074.164] -- 0:03:39
220000 -- (-2075.521) [-2078.357] (-2079.860) (-2085.596) * (-2078.108) (-2082.944) [-2075.498] (-2079.897) -- 0:03:39
Average standard deviation of split frequencies: 0.004956
220100 -- [-2070.026] (-2079.257) (-2078.360) (-2080.995) * (-2091.909) [-2078.093] (-2080.791) (-2080.427) -- 0:03:39
220200 -- [-2073.098] (-2075.214) (-2086.519) (-2076.813) * (-2078.379) [-2075.803] (-2079.761) (-2074.184) -- 0:03:39
220300 -- (-2073.200) [-2073.922] (-2084.127) (-2074.772) * (-2078.024) (-2081.686) (-2079.881) [-2074.419] -- 0:03:39
220400 -- [-2077.490] (-2077.874) (-2078.828) (-2083.412) * (-2079.275) (-2080.567) (-2073.890) [-2069.679] -- 0:03:39
220500 -- (-2075.991) [-2079.003] (-2076.630) (-2082.859) * (-2082.481) (-2078.968) (-2069.750) [-2071.454] -- 0:03:39
220600 -- (-2074.708) [-2077.118] (-2089.405) (-2077.654) * (-2088.256) (-2076.972) [-2070.153] (-2078.444) -- 0:03:39
220700 -- [-2076.696] (-2073.848) (-2088.744) (-2079.280) * (-2081.827) (-2083.214) (-2079.743) [-2075.827] -- 0:03:38
220800 -- (-2077.070) [-2075.136] (-2095.341) (-2086.003) * (-2077.449) (-2077.912) [-2071.533] (-2068.970) -- 0:03:38
220900 -- (-2071.095) (-2089.848) (-2090.683) [-2073.683] * (-2076.585) (-2079.151) [-2069.074] (-2072.547) -- 0:03:38
221000 -- [-2071.413] (-2077.555) (-2081.212) (-2076.909) * (-2078.963) (-2090.716) [-2072.013] (-2077.795) -- 0:03:38
Average standard deviation of split frequencies: 0.005176
221100 -- (-2076.668) (-2076.166) (-2072.956) [-2076.104] * (-2079.192) (-2080.925) (-2076.391) [-2075.630] -- 0:03:38
221200 -- [-2074.998] (-2084.313) (-2078.999) (-2078.751) * (-2079.662) (-2075.130) [-2074.040] (-2080.959) -- 0:03:38
221300 -- (-2073.702) (-2084.325) [-2071.460] (-2083.070) * (-2082.826) (-2079.537) [-2069.267] (-2079.392) -- 0:03:38
221400 -- [-2071.831] (-2088.338) (-2074.452) (-2085.650) * [-2070.548] (-2080.552) (-2069.419) (-2077.177) -- 0:03:38
221500 -- [-2069.727] (-2087.606) (-2078.722) (-2080.830) * (-2079.556) (-2079.554) (-2076.132) [-2080.030] -- 0:03:37
221600 -- (-2077.383) [-2078.655] (-2076.085) (-2082.698) * [-2081.379] (-2077.346) (-2075.174) (-2084.740) -- 0:03:37
221700 -- [-2076.223] (-2080.278) (-2077.204) (-2082.636) * (-2076.076) (-2073.829) [-2074.727] (-2075.529) -- 0:03:37
221800 -- (-2083.311) (-2084.986) (-2076.160) [-2091.536] * [-2075.407] (-2078.674) (-2082.118) (-2083.590) -- 0:03:37
221900 -- (-2082.253) (-2092.359) [-2080.106] (-2093.256) * [-2077.918] (-2082.519) (-2082.923) (-2089.631) -- 0:03:37
222000 -- (-2071.797) [-2075.767] (-2083.470) (-2078.319) * [-2074.413] (-2080.231) (-2079.149) (-2081.479) -- 0:03:37
Average standard deviation of split frequencies: 0.004851
222100 -- [-2075.489] (-2078.775) (-2084.706) (-2082.777) * [-2072.848] (-2090.760) (-2076.809) (-2074.415) -- 0:03:40
222200 -- (-2072.975) [-2077.427] (-2084.474) (-2086.669) * [-2073.807] (-2087.793) (-2080.185) (-2075.363) -- 0:03:40
222300 -- (-2074.696) (-2078.150) [-2079.615] (-2082.310) * [-2075.245] (-2085.379) (-2077.011) (-2074.053) -- 0:03:40
222400 -- [-2077.603] (-2085.580) (-2078.583) (-2090.982) * (-2072.879) (-2096.150) [-2074.610] (-2079.713) -- 0:03:40
222500 -- (-2077.052) (-2079.978) [-2076.365] (-2093.502) * (-2084.133) (-2087.663) (-2077.305) [-2075.754] -- 0:03:40
222600 -- (-2077.226) [-2080.497] (-2090.616) (-2079.090) * (-2078.506) (-2094.604) [-2081.439] (-2077.139) -- 0:03:40
222700 -- (-2076.354) (-2078.908) (-2085.417) [-2075.613] * (-2077.353) (-2087.735) (-2080.991) [-2074.984] -- 0:03:39
222800 -- (-2087.735) (-2082.601) (-2081.690) [-2076.218] * (-2077.244) (-2080.302) (-2082.620) [-2075.189] -- 0:03:39
222900 -- (-2085.531) (-2084.430) (-2084.479) [-2082.693] * (-2083.378) (-2081.144) (-2084.362) [-2073.489] -- 0:03:39
223000 -- (-2085.199) [-2079.808] (-2085.059) (-2076.805) * (-2076.522) [-2075.024] (-2079.595) (-2072.779) -- 0:03:39
Average standard deviation of split frequencies: 0.004526
223100 -- (-2089.377) (-2081.606) [-2079.053] (-2082.371) * (-2080.573) (-2081.498) (-2076.058) [-2073.370] -- 0:03:39
223200 -- (-2095.305) [-2073.837] (-2079.045) (-2084.415) * [-2072.524] (-2086.719) (-2073.229) (-2076.926) -- 0:03:39
223300 -- (-2094.199) [-2076.043] (-2081.374) (-2083.505) * [-2072.308] (-2091.266) (-2076.082) (-2078.692) -- 0:03:39
223400 -- (-2096.472) [-2073.283] (-2081.688) (-2082.672) * (-2073.946) (-2087.939) (-2074.877) [-2075.198] -- 0:03:39
223500 -- (-2097.050) [-2073.356] (-2082.267) (-2078.118) * [-2070.247] (-2086.407) (-2077.244) (-2077.529) -- 0:03:38
223600 -- (-2085.485) [-2071.551] (-2090.870) (-2076.513) * (-2076.863) (-2093.793) [-2071.069] (-2076.028) -- 0:03:38
223700 -- (-2089.787) [-2075.149] (-2087.130) (-2079.442) * [-2077.837] (-2079.539) (-2072.696) (-2079.328) -- 0:03:38
223800 -- (-2086.747) [-2079.246] (-2082.637) (-2078.366) * [-2072.509] (-2081.539) (-2075.522) (-2079.574) -- 0:03:38
223900 -- (-2090.435) (-2084.551) [-2075.433] (-2074.517) * (-2074.616) (-2081.027) [-2069.447] (-2079.153) -- 0:03:38
224000 -- (-2084.096) (-2081.738) [-2076.536] (-2077.586) * [-2079.911] (-2073.893) (-2073.405) (-2087.960) -- 0:03:38
Average standard deviation of split frequencies: 0.004387
224100 -- (-2087.749) [-2084.694] (-2074.459) (-2081.825) * (-2078.576) [-2074.853] (-2075.675) (-2101.998) -- 0:03:38
224200 -- (-2083.124) (-2079.702) (-2079.622) [-2073.945] * (-2082.992) [-2072.174] (-2074.278) (-2080.524) -- 0:03:37
224300 -- (-2082.875) (-2088.116) (-2089.463) [-2071.925] * [-2079.841] (-2077.047) (-2079.921) (-2070.288) -- 0:03:37
224400 -- [-2077.550] (-2085.527) (-2077.961) (-2076.905) * (-2088.288) [-2074.330] (-2080.811) (-2078.734) -- 0:03:37
224500 -- (-2081.889) (-2082.199) (-2074.097) [-2078.784] * (-2080.035) (-2087.082) (-2075.560) [-2073.477] -- 0:03:37
224600 -- (-2081.901) [-2076.414] (-2075.434) (-2080.233) * [-2075.287] (-2077.972) (-2072.190) (-2078.190) -- 0:03:37
224700 -- (-2078.992) (-2078.323) (-2071.989) [-2075.530] * (-2073.938) [-2077.118] (-2074.829) (-2079.726) -- 0:03:37
224800 -- (-2084.115) [-2075.774] (-2077.000) (-2076.714) * (-2075.562) (-2080.953) [-2072.873] (-2080.027) -- 0:03:37
224900 -- (-2078.983) (-2091.557) (-2078.532) [-2075.250] * (-2079.765) (-2076.997) [-2070.772] (-2076.133) -- 0:03:37
225000 -- [-2075.304] (-2088.879) (-2078.749) (-2076.795) * (-2079.418) (-2090.562) (-2069.625) [-2080.858] -- 0:03:36
Average standard deviation of split frequencies: 0.004904
225100 -- (-2076.527) (-2085.390) (-2085.776) [-2075.543] * (-2078.663) (-2079.572) [-2076.036] (-2080.682) -- 0:03:36
225200 -- (-2085.562) (-2090.702) [-2080.831] (-2079.619) * (-2087.728) (-2076.527) [-2069.596] (-2080.751) -- 0:03:36
225300 -- (-2083.274) (-2081.333) (-2079.634) [-2074.962] * (-2078.465) [-2077.905] (-2074.675) (-2079.414) -- 0:03:36
225400 -- [-2076.729] (-2086.617) (-2074.896) (-2073.000) * [-2074.254] (-2093.766) (-2073.295) (-2080.803) -- 0:03:36
225500 -- (-2083.464) (-2079.957) [-2074.105] (-2075.938) * [-2072.114] (-2077.635) (-2079.648) (-2077.350) -- 0:03:36
225600 -- (-2079.845) [-2076.833] (-2078.856) (-2081.645) * [-2071.785] (-2077.154) (-2080.198) (-2081.682) -- 0:03:36
225700 -- (-2073.167) [-2074.324] (-2074.632) (-2092.043) * (-2070.760) (-2083.971) [-2075.161] (-2081.096) -- 0:03:39
225800 -- [-2069.334] (-2078.617) (-2071.511) (-2082.656) * (-2079.195) (-2083.009) [-2080.055] (-2082.748) -- 0:03:39
225900 -- (-2073.630) (-2078.440) [-2069.936] (-2073.844) * (-2079.782) (-2076.377) [-2077.807] (-2080.580) -- 0:03:39
226000 -- (-2076.201) (-2076.151) [-2070.052] (-2083.675) * (-2077.125) (-2078.373) [-2078.546] (-2075.864) -- 0:03:39
Average standard deviation of split frequencies: 0.004408
226100 -- (-2084.459) [-2080.907] (-2071.489) (-2083.469) * [-2074.815] (-2076.410) (-2077.947) (-2078.557) -- 0:03:39
226200 -- (-2088.126) (-2077.512) [-2069.918] (-2082.743) * (-2086.803) (-2076.287) (-2082.496) [-2077.398] -- 0:03:38
226300 -- (-2082.468) (-2080.185) [-2072.684] (-2080.689) * [-2077.558] (-2079.531) (-2086.334) (-2079.854) -- 0:03:38
226400 -- [-2077.681] (-2079.728) (-2073.757) (-2080.007) * (-2076.635) (-2076.625) [-2073.494] (-2079.965) -- 0:03:38
226500 -- (-2075.703) (-2087.585) [-2071.125] (-2093.019) * (-2084.323) (-2077.125) [-2071.435] (-2075.780) -- 0:03:38
226600 -- [-2072.845] (-2079.808) (-2077.262) (-2093.598) * (-2081.780) [-2074.504] (-2078.808) (-2077.114) -- 0:03:38
226700 -- (-2079.253) (-2082.513) [-2071.452] (-2093.465) * (-2078.265) (-2075.998) [-2068.533] (-2075.908) -- 0:03:38
226800 -- (-2081.922) (-2093.310) [-2076.059] (-2085.141) * (-2091.865) (-2075.263) (-2076.464) [-2080.308] -- 0:03:38
226900 -- (-2078.602) (-2082.838) [-2073.562] (-2078.848) * [-2074.093] (-2085.181) (-2088.042) (-2074.283) -- 0:03:38
227000 -- [-2070.888] (-2080.490) (-2070.676) (-2077.362) * (-2076.051) [-2077.656] (-2089.546) (-2077.656) -- 0:03:37
Average standard deviation of split frequencies: 0.004565
227100 -- (-2075.220) (-2076.835) [-2067.525] (-2078.059) * [-2074.087] (-2079.736) (-2079.857) (-2085.398) -- 0:03:37
227200 -- (-2079.349) (-2082.549) [-2073.171] (-2078.610) * [-2073.967] (-2079.442) (-2082.098) (-2087.083) -- 0:03:37
227300 -- [-2073.042] (-2079.257) (-2072.895) (-2084.071) * [-2075.505] (-2077.935) (-2083.359) (-2083.093) -- 0:03:37
227400 -- [-2077.844] (-2078.251) (-2077.270) (-2074.077) * [-2077.258] (-2078.876) (-2088.627) (-2080.319) -- 0:03:37
227500 -- [-2076.222] (-2080.089) (-2076.927) (-2077.163) * [-2071.056] (-2095.231) (-2076.234) (-2080.030) -- 0:03:37
227600 -- (-2078.313) (-2078.282) [-2074.584] (-2081.131) * (-2074.036) (-2086.195) [-2077.427] (-2076.676) -- 0:03:37
227700 -- (-2083.329) (-2077.480) [-2069.140] (-2078.977) * [-2073.272] (-2088.089) (-2076.822) (-2080.317) -- 0:03:37
227800 -- (-2083.815) (-2089.207) [-2070.464] (-2087.457) * [-2075.274] (-2085.290) (-2076.127) (-2080.383) -- 0:03:36
227900 -- (-2079.634) (-2086.229) [-2070.864] (-2077.626) * (-2079.612) (-2081.460) [-2074.139] (-2080.042) -- 0:03:36
228000 -- (-2083.367) (-2093.762) [-2073.309] (-2080.701) * (-2080.765) [-2079.794] (-2082.512) (-2081.669) -- 0:03:36
Average standard deviation of split frequencies: 0.005018
228100 -- [-2076.296] (-2080.583) (-2075.345) (-2086.188) * (-2072.120) (-2086.005) [-2072.378] (-2084.532) -- 0:03:36
228200 -- [-2069.817] (-2077.013) (-2072.812) (-2082.860) * (-2072.816) (-2090.376) [-2072.195] (-2091.810) -- 0:03:36
228300 -- (-2074.115) (-2074.921) [-2075.682] (-2098.306) * (-2074.781) [-2087.792] (-2077.380) (-2088.981) -- 0:03:36
228400 -- [-2079.176] (-2075.397) (-2080.253) (-2085.668) * [-2072.944] (-2092.555) (-2073.945) (-2085.820) -- 0:03:36
228500 -- (-2072.830) [-2075.812] (-2071.991) (-2085.723) * (-2079.430) (-2096.363) [-2070.642] (-2076.101) -- 0:03:36
228600 -- (-2080.659) (-2079.098) [-2074.563] (-2086.279) * (-2080.112) (-2088.699) [-2072.748] (-2075.968) -- 0:03:35
228700 -- (-2090.170) [-2077.698] (-2073.257) (-2088.348) * (-2076.305) [-2085.475] (-2082.265) (-2085.456) -- 0:03:35
228800 -- (-2081.901) (-2077.792) [-2071.044] (-2080.080) * (-2073.624) (-2087.931) [-2073.869] (-2079.404) -- 0:03:35
228900 -- (-2077.353) (-2082.394) [-2072.701] (-2078.562) * (-2078.231) (-2088.708) [-2078.997] (-2081.918) -- 0:03:35
229000 -- [-2074.247] (-2092.098) (-2076.176) (-2082.468) * (-2079.572) (-2082.983) [-2078.895] (-2077.633) -- 0:03:35
Average standard deviation of split frequencies: 0.005230
229100 -- [-2072.074] (-2087.165) (-2076.543) (-2077.451) * [-2071.403] (-2078.003) (-2072.983) (-2084.953) -- 0:03:35
229200 -- (-2083.550) (-2081.049) [-2076.752] (-2083.579) * [-2074.621] (-2077.250) (-2082.631) (-2075.927) -- 0:03:38
229300 -- [-2075.247] (-2081.124) (-2080.186) (-2097.183) * (-2072.670) (-2083.184) (-2077.960) [-2077.948] -- 0:03:38
229400 -- (-2070.306) (-2077.990) [-2071.492] (-2085.902) * [-2071.070] (-2075.156) (-2079.254) (-2082.384) -- 0:03:38
229500 -- [-2071.173] (-2073.385) (-2073.907) (-2085.529) * (-2075.172) (-2079.329) [-2080.738] (-2081.094) -- 0:03:38
229600 -- [-2073.427] (-2076.707) (-2082.589) (-2077.552) * (-2077.346) (-2081.797) [-2077.520] (-2078.207) -- 0:03:38
229700 -- [-2073.657] (-2081.688) (-2077.838) (-2087.277) * [-2074.218] (-2075.498) (-2071.808) (-2090.530) -- 0:03:37
229800 -- [-2071.548] (-2085.232) (-2080.250) (-2082.026) * [-2071.975] (-2080.619) (-2077.244) (-2083.138) -- 0:03:37
229900 -- (-2071.340) (-2083.736) [-2073.045] (-2076.342) * [-2071.370] (-2071.309) (-2085.754) (-2089.127) -- 0:03:37
230000 -- [-2070.639] (-2092.423) (-2074.967) (-2076.099) * [-2070.611] (-2075.155) (-2084.447) (-2084.083) -- 0:03:37
Average standard deviation of split frequencies: 0.005736
230100 -- [-2071.405] (-2081.690) (-2075.166) (-2080.233) * [-2072.526] (-2080.928) (-2081.812) (-2079.105) -- 0:03:37
230200 -- (-2081.082) (-2081.134) [-2072.698] (-2077.056) * [-2080.205] (-2074.921) (-2083.204) (-2083.821) -- 0:03:37
230300 -- [-2077.148] (-2079.486) (-2073.517) (-2074.827) * [-2077.477] (-2081.824) (-2088.408) (-2085.106) -- 0:03:37
230400 -- [-2076.482] (-2084.093) (-2080.796) (-2077.111) * (-2079.339) [-2079.210] (-2082.124) (-2078.730) -- 0:03:37
230500 -- (-2074.639) (-2078.276) [-2076.687] (-2078.853) * (-2076.895) [-2082.433] (-2075.001) (-2087.647) -- 0:03:36
230600 -- (-2078.944) (-2076.484) (-2080.133) [-2078.125] * (-2076.149) (-2077.617) [-2079.796] (-2083.647) -- 0:03:36
230700 -- (-2072.303) (-2076.010) [-2071.148] (-2082.849) * [-2071.325] (-2081.080) (-2074.792) (-2078.217) -- 0:03:36
230800 -- (-2073.424) [-2079.956] (-2076.633) (-2083.196) * (-2071.493) [-2077.310] (-2075.104) (-2094.554) -- 0:03:36
230900 -- [-2068.017] (-2082.699) (-2077.269) (-2084.301) * (-2072.353) (-2078.579) [-2070.071] (-2079.478) -- 0:03:36
231000 -- [-2072.360] (-2081.620) (-2079.222) (-2085.583) * (-2077.293) [-2075.264] (-2072.915) (-2079.492) -- 0:03:36
Average standard deviation of split frequencies: 0.006000
231100 -- (-2071.422) (-2080.392) [-2070.071] (-2082.950) * (-2075.670) [-2074.852] (-2085.548) (-2078.639) -- 0:03:36
231200 -- [-2070.829] (-2082.851) (-2073.835) (-2087.504) * [-2081.398] (-2077.833) (-2071.603) (-2087.282) -- 0:03:36
231300 -- (-2072.613) [-2080.701] (-2079.665) (-2081.778) * (-2074.320) (-2083.992) [-2072.864] (-2082.234) -- 0:03:36
231400 -- [-2074.573] (-2078.851) (-2082.709) (-2078.803) * [-2076.313] (-2091.171) (-2073.737) (-2079.497) -- 0:03:35
231500 -- [-2074.460] (-2086.159) (-2074.681) (-2074.886) * (-2072.943) (-2082.972) [-2074.982] (-2079.512) -- 0:03:35
231600 -- [-2072.032] (-2081.532) (-2083.649) (-2074.431) * [-2068.472] (-2092.060) (-2071.030) (-2090.544) -- 0:03:35
231700 -- (-2077.276) (-2078.254) (-2082.298) [-2072.360] * [-2074.791] (-2089.408) (-2071.468) (-2080.901) -- 0:03:35
231800 -- (-2074.472) (-2078.264) [-2077.375] (-2078.322) * (-2071.207) (-2084.999) [-2072.194] (-2078.034) -- 0:03:35
231900 -- (-2081.303) (-2078.079) (-2081.365) [-2074.053] * [-2076.007] (-2076.888) (-2080.014) (-2081.880) -- 0:03:35
232000 -- (-2071.173) [-2071.089] (-2084.877) (-2072.750) * [-2071.368] (-2081.335) (-2073.509) (-2081.128) -- 0:03:35
Average standard deviation of split frequencies: 0.005512
232100 -- (-2075.784) (-2074.879) (-2080.008) [-2074.911] * (-2074.042) (-2076.258) [-2070.203] (-2082.925) -- 0:03:35
232200 -- [-2074.977] (-2076.010) (-2075.834) (-2077.605) * [-2070.469] (-2078.323) (-2076.760) (-2087.758) -- 0:03:34
232300 -- [-2073.960] (-2070.193) (-2078.294) (-2073.792) * (-2070.767) (-2085.913) [-2073.565] (-2084.114) -- 0:03:34
232400 -- (-2080.760) (-2076.921) [-2070.302] (-2079.020) * (-2073.754) [-2076.111] (-2072.017) (-2090.677) -- 0:03:34
232500 -- (-2070.471) (-2074.811) [-2072.904] (-2077.716) * (-2078.030) (-2083.876) [-2074.987] (-2085.769) -- 0:03:34
232600 -- (-2071.183) (-2073.597) [-2069.237] (-2082.979) * (-2072.432) [-2079.004] (-2070.020) (-2082.907) -- 0:03:34
232700 -- (-2074.341) (-2078.402) [-2070.795] (-2085.345) * (-2077.825) (-2078.822) [-2073.402] (-2078.499) -- 0:03:34
232800 -- (-2076.910) [-2072.865] (-2073.169) (-2076.932) * [-2074.244] (-2077.292) (-2072.455) (-2089.161) -- 0:03:37
232900 -- (-2081.022) (-2072.746) [-2069.726] (-2075.018) * (-2075.634) [-2080.084] (-2073.417) (-2089.828) -- 0:03:37
233000 -- (-2085.712) (-2080.004) [-2075.455] (-2074.619) * (-2077.342) [-2083.556] (-2081.728) (-2088.599) -- 0:03:37
Average standard deviation of split frequencies: 0.005140
233100 -- (-2078.367) [-2080.497] (-2083.721) (-2077.718) * (-2074.033) (-2081.642) [-2073.652] (-2082.604) -- 0:03:37
233200 -- (-2074.640) (-2076.503) (-2078.008) [-2076.469] * (-2080.720) (-2084.089) [-2071.292] (-2087.820) -- 0:03:37
233300 -- (-2070.495) [-2070.977] (-2078.359) (-2080.027) * [-2071.935] (-2089.389) (-2074.132) (-2092.452) -- 0:03:36
233400 -- (-2078.547) (-2079.797) [-2072.647] (-2085.962) * (-2075.498) (-2082.757) [-2070.091] (-2091.783) -- 0:03:36
233500 -- (-2076.810) (-2074.009) [-2071.432] (-2080.840) * (-2083.364) (-2075.564) [-2070.618] (-2097.981) -- 0:03:36
233600 -- (-2077.772) (-2090.427) (-2074.573) [-2081.041] * [-2076.875] (-2081.947) (-2069.394) (-2090.925) -- 0:03:36
233700 -- (-2077.953) [-2086.000] (-2071.801) (-2079.605) * [-2071.342] (-2074.610) (-2074.446) (-2088.902) -- 0:03:36
233800 -- [-2071.158] (-2087.682) (-2082.201) (-2080.831) * [-2076.114] (-2075.817) (-2074.379) (-2095.386) -- 0:03:36
233900 -- [-2080.808] (-2080.639) (-2079.892) (-2089.676) * (-2073.594) (-2083.044) [-2068.016] (-2097.794) -- 0:03:36
234000 -- (-2076.269) (-2078.871) (-2085.019) [-2077.093] * (-2075.313) (-2082.122) [-2071.914] (-2080.980) -- 0:03:36
Average standard deviation of split frequencies: 0.005580
234100 -- [-2070.355] (-2082.925) (-2084.492) (-2080.834) * [-2071.202] (-2077.296) (-2073.949) (-2084.873) -- 0:03:35
234200 -- [-2072.887] (-2082.093) (-2082.500) (-2078.512) * (-2080.669) (-2083.835) [-2076.631] (-2086.838) -- 0:03:35
234300 -- (-2071.746) [-2081.105] (-2085.118) (-2080.293) * (-2074.038) [-2075.960] (-2071.443) (-2083.594) -- 0:03:35
234400 -- (-2075.217) (-2082.155) (-2077.828) [-2078.370] * (-2078.070) (-2076.457) [-2069.244] (-2079.220) -- 0:03:35
234500 -- (-2076.374) (-2084.813) (-2080.097) [-2079.499] * (-2074.353) (-2089.901) (-2072.398) [-2076.938] -- 0:03:35
234600 -- [-2075.416] (-2085.042) (-2085.436) (-2082.890) * [-2079.812] (-2086.452) (-2075.143) (-2080.212) -- 0:03:35
234700 -- (-2074.157) (-2083.665) [-2071.089] (-2077.640) * [-2077.097] (-2082.607) (-2076.077) (-2076.289) -- 0:03:35
234800 -- (-2075.693) (-2077.710) [-2076.552] (-2082.937) * (-2084.393) (-2087.449) [-2071.551] (-2074.464) -- 0:03:35
234900 -- (-2077.705) [-2081.305] (-2081.233) (-2086.286) * (-2075.210) (-2081.833) [-2074.160] (-2086.259) -- 0:03:34
235000 -- (-2080.160) (-2080.591) [-2074.945] (-2088.672) * (-2077.510) (-2082.659) [-2076.977] (-2083.154) -- 0:03:34
Average standard deviation of split frequencies: 0.005497
235100 -- (-2087.911) (-2084.093) [-2079.835] (-2083.239) * [-2079.750] (-2078.754) (-2071.265) (-2085.715) -- 0:03:34
235200 -- (-2079.210) [-2080.514] (-2084.951) (-2085.201) * (-2073.514) (-2080.691) [-2072.090] (-2085.358) -- 0:03:34
235300 -- (-2083.596) [-2070.507] (-2081.075) (-2077.533) * [-2071.028] (-2083.149) (-2075.459) (-2085.294) -- 0:03:34
235400 -- (-2075.520) [-2073.188] (-2081.359) (-2086.758) * [-2074.647] (-2081.266) (-2074.667) (-2081.021) -- 0:03:34
235500 -- [-2075.893] (-2086.941) (-2077.558) (-2082.254) * [-2075.040] (-2083.414) (-2067.520) (-2080.195) -- 0:03:34
235600 -- (-2076.709) [-2077.671] (-2072.806) (-2089.812) * (-2075.930) (-2079.242) [-2073.731] (-2082.642) -- 0:03:34
235700 -- (-2076.107) (-2079.605) [-2070.382] (-2084.109) * [-2074.541] (-2086.397) (-2075.781) (-2087.603) -- 0:03:34
235800 -- (-2087.851) (-2090.342) [-2072.825] (-2086.510) * [-2073.200] (-2088.092) (-2075.312) (-2078.529) -- 0:03:33
235900 -- (-2077.335) (-2089.818) [-2075.836] (-2090.159) * [-2073.765] (-2082.304) (-2069.675) (-2087.826) -- 0:03:33
236000 -- [-2074.088] (-2084.323) (-2073.690) (-2088.362) * (-2076.235) (-2083.931) [-2074.002] (-2085.757) -- 0:03:33
Average standard deviation of split frequencies: 0.005761
236100 -- (-2069.541) [-2082.347] (-2080.322) (-2078.642) * (-2080.886) (-2086.534) [-2073.021] (-2083.086) -- 0:03:33
236200 -- [-2072.458] (-2079.176) (-2083.170) (-2086.941) * [-2075.895] (-2082.616) (-2073.428) (-2086.727) -- 0:03:33
236300 -- (-2081.569) [-2073.859] (-2085.089) (-2073.753) * (-2077.580) [-2082.906] (-2076.840) (-2086.289) -- 0:03:36
236400 -- (-2082.359) [-2079.521] (-2075.896) (-2085.582) * (-2074.491) (-2074.027) [-2072.909] (-2089.421) -- 0:03:36
236500 -- (-2076.995) (-2075.057) [-2074.876] (-2077.964) * [-2074.815] (-2075.840) (-2071.248) (-2082.161) -- 0:03:36
236600 -- (-2080.838) (-2076.616) [-2073.723] (-2085.038) * [-2076.727] (-2075.453) (-2078.264) (-2082.292) -- 0:03:36
236700 -- (-2082.914) [-2078.488] (-2077.441) (-2086.297) * [-2076.123] (-2076.669) (-2078.768) (-2094.135) -- 0:03:36
236800 -- (-2081.759) (-2076.503) (-2074.567) [-2080.340] * (-2078.059) (-2076.642) [-2078.859] (-2084.707) -- 0:03:35
236900 -- (-2076.327) [-2070.690] (-2079.216) (-2080.551) * (-2078.864) [-2071.263] (-2088.638) (-2084.225) -- 0:03:35
237000 -- [-2068.467] (-2076.757) (-2084.727) (-2075.434) * (-2082.853) [-2071.097] (-2093.828) (-2077.450) -- 0:03:35
Average standard deviation of split frequencies: 0.005849
237100 -- [-2073.956] (-2080.311) (-2084.805) (-2074.354) * [-2081.335] (-2070.861) (-2083.316) (-2073.874) -- 0:03:35
237200 -- (-2073.928) (-2086.888) (-2083.631) [-2074.508] * (-2081.462) [-2072.786] (-2078.573) (-2082.546) -- 0:03:35
237300 -- [-2069.707] (-2080.845) (-2082.340) (-2075.668) * (-2085.001) [-2069.085] (-2071.738) (-2082.384) -- 0:03:35
237400 -- [-2076.015] (-2079.225) (-2087.750) (-2077.760) * (-2079.333) [-2076.767] (-2075.097) (-2079.478) -- 0:03:35
237500 -- [-2075.889] (-2086.168) (-2077.669) (-2075.183) * (-2080.316) [-2069.069] (-2074.073) (-2086.578) -- 0:03:35
237600 -- (-2073.676) (-2083.569) (-2074.389) [-2080.091] * (-2086.423) [-2071.541] (-2075.038) (-2088.983) -- 0:03:34
237700 -- (-2069.869) (-2094.853) [-2072.629] (-2077.082) * (-2081.092) (-2072.603) (-2077.781) [-2075.095] -- 0:03:34
237800 -- (-2070.533) (-2090.468) (-2076.463) [-2077.691] * (-2082.633) (-2084.043) [-2066.463] (-2073.384) -- 0:03:34
237900 -- (-2077.149) (-2095.158) (-2080.960) [-2075.163] * (-2077.970) (-2077.223) [-2073.763] (-2075.727) -- 0:03:34
238000 -- (-2078.557) (-2087.599) [-2075.639] (-2071.281) * (-2079.653) (-2076.544) [-2077.221] (-2075.207) -- 0:03:34
Average standard deviation of split frequencies: 0.005543
238100 -- (-2081.186) (-2082.310) (-2076.696) [-2070.875] * (-2081.138) (-2080.141) [-2076.501] (-2081.658) -- 0:03:34
238200 -- (-2080.402) (-2088.553) [-2072.182] (-2073.025) * (-2084.362) [-2076.732] (-2078.103) (-2083.755) -- 0:03:34
238300 -- (-2090.313) (-2082.282) [-2077.646] (-2076.747) * (-2082.567) [-2074.813] (-2076.599) (-2077.279) -- 0:03:34
238400 -- (-2087.090) (-2081.568) [-2073.185] (-2073.940) * (-2085.574) [-2074.964] (-2077.217) (-2082.247) -- 0:03:34
238500 -- [-2078.486] (-2086.396) (-2073.290) (-2075.033) * (-2086.370) (-2077.453) (-2082.936) [-2082.766] -- 0:03:33
238600 -- (-2076.056) (-2083.112) (-2072.832) [-2076.554] * (-2087.905) (-2077.542) [-2086.800] (-2078.887) -- 0:03:33
238700 -- (-2075.940) (-2083.141) (-2081.776) [-2076.807] * (-2076.140) [-2081.355] (-2084.002) (-2075.192) -- 0:03:33
238800 -- [-2078.717] (-2088.467) (-2073.213) (-2079.470) * (-2078.247) [-2077.671] (-2084.662) (-2076.322) -- 0:03:33
238900 -- [-2077.392] (-2087.251) (-2072.207) (-2075.577) * (-2078.910) (-2082.422) [-2077.126] (-2077.409) -- 0:03:33
239000 -- (-2075.778) (-2079.083) (-2079.172) [-2077.140] * (-2075.787) (-2075.810) [-2075.899] (-2080.414) -- 0:03:33
Average standard deviation of split frequencies: 0.005631
239100 -- [-2077.374] (-2072.433) (-2079.185) (-2082.432) * (-2079.918) (-2076.348) [-2073.338] (-2080.153) -- 0:03:33
239200 -- [-2073.507] (-2078.159) (-2072.080) (-2076.681) * (-2086.966) (-2087.683) (-2075.650) [-2077.951] -- 0:03:33
239300 -- (-2083.914) (-2078.740) (-2073.565) [-2083.357] * [-2079.515] (-2086.853) (-2078.768) (-2098.719) -- 0:03:32
239400 -- (-2080.093) [-2077.194] (-2078.355) (-2075.071) * (-2081.033) [-2076.555] (-2083.888) (-2078.685) -- 0:03:32
239500 -- (-2083.082) (-2084.769) (-2071.709) [-2070.286] * (-2080.805) [-2078.757] (-2080.511) (-2080.945) -- 0:03:32
239600 -- (-2072.251) (-2079.146) [-2067.276] (-2079.849) * [-2080.056] (-2076.923) (-2076.569) (-2083.224) -- 0:03:32
239700 -- (-2079.797) (-2082.799) [-2075.523] (-2081.457) * (-2078.865) (-2076.050) (-2073.205) [-2075.465] -- 0:03:32
239800 -- (-2079.131) (-2086.260) [-2079.294] (-2085.725) * (-2080.163) (-2079.770) [-2072.185] (-2080.430) -- 0:03:32
239900 -- (-2080.551) (-2085.126) (-2078.561) [-2078.610] * (-2082.450) (-2085.121) [-2072.197] (-2088.759) -- 0:03:35
240000 -- (-2080.286) [-2078.360] (-2080.758) (-2082.567) * (-2085.884) (-2078.325) [-2075.703] (-2094.213) -- 0:03:35
Average standard deviation of split frequencies: 0.005665
240100 -- (-2082.186) [-2078.583] (-2081.515) (-2087.703) * (-2080.300) (-2081.426) [-2072.432] (-2086.154) -- 0:03:35
240200 -- (-2080.983) (-2085.753) [-2076.253] (-2092.486) * (-2080.912) (-2083.405) [-2075.251] (-2079.477) -- 0:03:35
240300 -- (-2078.665) (-2089.464) [-2069.439] (-2087.357) * (-2088.366) (-2078.633) [-2072.159] (-2075.703) -- 0:03:34
240400 -- [-2079.568] (-2084.594) (-2077.256) (-2078.678) * (-2082.236) (-2088.762) (-2075.315) [-2075.935] -- 0:03:34
240500 -- (-2071.175) (-2088.413) (-2075.321) [-2082.088] * (-2081.302) (-2081.063) (-2080.470) [-2078.919] -- 0:03:34
240600 -- (-2079.365) (-2085.992) [-2073.259] (-2081.609) * (-2084.956) [-2076.273] (-2073.950) (-2078.175) -- 0:03:34
240700 -- (-2078.617) (-2087.140) [-2074.846] (-2086.680) * (-2080.695) (-2075.188) [-2072.608] (-2080.695) -- 0:03:34
240800 -- [-2076.713] (-2082.498) (-2076.565) (-2079.447) * (-2082.115) [-2074.227] (-2075.079) (-2084.606) -- 0:03:34
240900 -- (-2082.921) (-2077.718) [-2077.273] (-2077.744) * (-2088.768) (-2077.002) [-2074.722] (-2086.034) -- 0:03:34
241000 -- [-2074.161] (-2078.504) (-2083.813) (-2081.672) * (-2083.280) (-2080.904) [-2080.427] (-2076.999) -- 0:03:34
Average standard deviation of split frequencies: 0.005863
241100 -- [-2074.966] (-2076.973) (-2078.980) (-2080.772) * (-2087.541) (-2084.871) [-2080.364] (-2083.503) -- 0:03:34
241200 -- [-2069.129] (-2076.764) (-2081.867) (-2073.520) * (-2085.472) (-2092.036) [-2078.877] (-2083.799) -- 0:03:33
241300 -- (-2073.859) (-2080.181) [-2073.701] (-2083.878) * (-2088.967) (-2085.544) [-2070.340] (-2087.583) -- 0:03:33
241400 -- [-2068.759] (-2075.905) (-2075.741) (-2078.752) * (-2079.862) (-2083.478) [-2075.621] (-2079.538) -- 0:03:33
241500 -- (-2070.081) (-2080.672) [-2071.343] (-2084.841) * (-2084.579) [-2076.401] (-2077.716) (-2081.874) -- 0:03:33
241600 -- [-2073.288] (-2081.146) (-2072.392) (-2078.421) * (-2075.547) [-2074.958] (-2081.408) (-2088.959) -- 0:03:33
241700 -- (-2074.370) (-2079.241) [-2069.615] (-2085.587) * (-2078.697) (-2076.716) [-2083.538] (-2081.330) -- 0:03:33
241800 -- (-2082.215) (-2085.767) [-2072.878] (-2090.710) * (-2078.964) (-2081.055) [-2081.153] (-2079.669) -- 0:03:33
241900 -- (-2086.098) (-2084.078) [-2069.506] (-2083.664) * (-2083.860) (-2083.606) [-2074.244] (-2080.845) -- 0:03:33
242000 -- (-2093.422) [-2086.175] (-2069.027) (-2077.844) * (-2078.953) (-2085.872) [-2073.385] (-2081.219) -- 0:03:32
Average standard deviation of split frequencies: 0.006286
242100 -- (-2088.491) (-2072.694) [-2069.915] (-2071.769) * (-2087.488) (-2079.714) [-2077.038] (-2087.235) -- 0:03:32
242200 -- (-2082.069) (-2078.345) [-2070.985] (-2077.895) * [-2080.215] (-2076.789) (-2081.634) (-2075.421) -- 0:03:32
242300 -- (-2075.855) (-2079.676) [-2067.508] (-2083.441) * [-2075.508] (-2078.902) (-2077.842) (-2073.852) -- 0:03:32
242400 -- [-2071.090] (-2078.264) (-2070.482) (-2081.062) * [-2073.522] (-2087.189) (-2079.335) (-2079.843) -- 0:03:32
242500 -- (-2080.251) (-2086.120) [-2069.260] (-2082.458) * [-2079.097] (-2081.721) (-2072.623) (-2078.226) -- 0:03:32
242600 -- (-2077.721) (-2084.814) [-2069.526] (-2078.364) * (-2079.980) (-2076.037) [-2073.118] (-2087.532) -- 0:03:32
242700 -- (-2073.241) (-2081.001) [-2067.515] (-2093.073) * (-2084.884) [-2076.869] (-2069.444) (-2084.563) -- 0:03:32
242800 -- [-2074.033] (-2081.868) (-2072.602) (-2090.752) * (-2077.245) [-2076.674] (-2071.722) (-2086.578) -- 0:03:32
242900 -- [-2071.883] (-2080.388) (-2078.360) (-2077.894) * (-2081.014) (-2076.103) [-2067.921] (-2086.948) -- 0:03:31
243000 -- (-2081.246) (-2077.851) (-2077.092) [-2075.530] * (-2076.770) (-2075.785) [-2068.855] (-2087.124) -- 0:03:31
Average standard deviation of split frequencies: 0.006646
243100 -- (-2072.483) [-2076.966] (-2069.152) (-2075.644) * [-2078.598] (-2081.303) (-2073.041) (-2099.022) -- 0:03:31
243200 -- [-2076.037] (-2079.872) (-2072.992) (-2078.548) * (-2084.743) (-2080.227) [-2075.754] (-2088.185) -- 0:03:31
243300 -- (-2074.082) (-2091.512) [-2074.100] (-2077.714) * (-2076.540) (-2083.971) (-2077.511) [-2077.886] -- 0:03:31
243400 -- (-2077.199) [-2081.591] (-2077.994) (-2076.489) * (-2082.619) (-2077.543) (-2080.673) [-2072.149] -- 0:03:34
243500 -- (-2083.240) (-2084.505) [-2078.129] (-2082.601) * (-2084.751) [-2075.298] (-2085.002) (-2076.188) -- 0:03:34
243600 -- (-2078.959) [-2078.955] (-2075.213) (-2080.543) * (-2090.587) [-2077.569] (-2080.405) (-2077.415) -- 0:03:34
243700 -- [-2076.506] (-2078.582) (-2074.917) (-2081.333) * (-2084.927) (-2072.819) (-2080.418) [-2080.673] -- 0:03:34
243800 -- [-2075.038] (-2083.255) (-2068.594) (-2082.852) * (-2085.157) [-2074.423] (-2082.871) (-2078.827) -- 0:03:34
243900 -- (-2078.513) (-2080.290) [-2074.065] (-2078.309) * (-2084.444) (-2080.231) [-2076.638] (-2085.630) -- 0:03:33
244000 -- (-2073.041) [-2085.336] (-2080.684) (-2074.504) * (-2080.578) (-2076.775) [-2076.084] (-2078.241) -- 0:03:33
Average standard deviation of split frequencies: 0.006124
244100 -- [-2080.639] (-2083.551) (-2073.490) (-2074.479) * [-2080.411] (-2075.861) (-2079.773) (-2087.107) -- 0:03:33
244200 -- (-2080.371) (-2081.809) [-2075.117] (-2074.628) * (-2078.859) (-2078.844) [-2075.770] (-2080.057) -- 0:03:33
244300 -- [-2074.100] (-2076.768) (-2075.170) (-2080.380) * (-2079.841) (-2074.123) [-2076.861] (-2078.669) -- 0:03:33
244400 -- [-2071.933] (-2083.443) (-2079.762) (-2081.236) * [-2076.915] (-2079.237) (-2073.717) (-2085.620) -- 0:03:33
244500 -- (-2078.138) (-2077.200) (-2076.045) [-2080.773] * [-2073.884] (-2076.085) (-2076.322) (-2084.508) -- 0:03:33
244600 -- (-2070.434) (-2080.904) [-2069.793] (-2081.485) * (-2074.281) (-2088.029) [-2070.540] (-2082.200) -- 0:03:33
244700 -- (-2077.701) [-2077.065] (-2073.177) (-2078.619) * (-2075.132) [-2078.648] (-2078.043) (-2084.075) -- 0:03:32
244800 -- (-2072.767) (-2072.853) [-2070.972] (-2078.190) * [-2072.311] (-2076.361) (-2075.597) (-2081.901) -- 0:03:32
244900 -- [-2073.337] (-2085.673) (-2071.587) (-2071.823) * [-2074.870] (-2077.726) (-2077.730) (-2087.669) -- 0:03:32
245000 -- (-2077.611) [-2080.188] (-2074.731) (-2077.098) * (-2075.414) (-2074.802) [-2069.757] (-2091.375) -- 0:03:32
Average standard deviation of split frequencies: 0.005603
245100 -- (-2068.564) (-2081.042) (-2082.944) [-2077.726] * (-2080.839) [-2076.118] (-2073.632) (-2086.817) -- 0:03:32
245200 -- (-2070.629) (-2085.659) (-2075.788) [-2075.797] * (-2079.129) (-2073.527) (-2084.171) [-2082.902] -- 0:03:32
245300 -- [-2072.672] (-2088.866) (-2091.885) (-2077.525) * (-2078.571) (-2078.647) (-2082.826) [-2074.749] -- 0:03:32
245400 -- (-2071.518) (-2082.890) [-2070.653] (-2081.401) * (-2079.333) (-2080.288) (-2078.014) [-2073.295] -- 0:03:32
245500 -- [-2071.478] (-2087.258) (-2074.578) (-2073.576) * (-2077.949) (-2084.777) (-2075.638) [-2073.636] -- 0:03:32
245600 -- (-2077.296) (-2090.439) [-2070.458] (-2072.142) * (-2081.311) (-2079.302) (-2076.889) [-2072.342] -- 0:03:31
245700 -- [-2068.935] (-2086.790) (-2073.705) (-2076.469) * (-2080.312) [-2080.244] (-2075.468) (-2082.666) -- 0:03:31
245800 -- [-2066.880] (-2078.170) (-2079.828) (-2079.195) * (-2090.805) [-2076.904] (-2079.138) (-2085.043) -- 0:03:31
245900 -- (-2077.692) (-2079.136) (-2077.894) [-2071.903] * (-2076.621) (-2076.323) [-2071.630] (-2083.853) -- 0:03:31
246000 -- (-2075.360) (-2080.996) (-2074.307) [-2070.207] * (-2079.136) (-2078.141) [-2068.121] (-2078.266) -- 0:03:31
Average standard deviation of split frequencies: 0.005800
246100 -- (-2069.924) [-2079.287] (-2075.008) (-2079.658) * (-2079.169) (-2083.751) (-2073.555) [-2078.218] -- 0:03:31
246200 -- (-2072.194) (-2076.807) [-2073.336] (-2080.412) * [-2074.999] (-2086.526) (-2078.452) (-2080.903) -- 0:03:31
246300 -- [-2071.339] (-2098.645) (-2089.000) (-2077.906) * [-2073.907] (-2087.463) (-2071.441) (-2078.917) -- 0:03:31
246400 -- [-2069.684] (-2081.985) (-2076.374) (-2079.687) * [-2074.672] (-2076.026) (-2082.024) (-2080.286) -- 0:03:31
246500 -- [-2069.104] (-2082.233) (-2073.318) (-2081.562) * (-2077.300) (-2084.338) [-2075.371] (-2081.881) -- 0:03:30
246600 -- (-2070.729) (-2077.325) (-2073.084) [-2068.670] * (-2081.845) (-2089.544) [-2074.871] (-2075.206) -- 0:03:30
246700 -- (-2076.493) (-2072.282) (-2069.391) [-2070.155] * (-2076.461) (-2084.264) (-2076.416) [-2074.189] -- 0:03:30
246800 -- [-2073.649] (-2081.477) (-2082.717) (-2077.733) * (-2081.362) (-2078.219) [-2074.016] (-2072.999) -- 0:03:30
246900 -- (-2068.704) [-2072.059] (-2077.047) (-2073.902) * [-2074.464] (-2086.098) (-2068.348) (-2083.640) -- 0:03:30
247000 -- [-2067.734] (-2081.393) (-2081.643) (-2074.751) * [-2074.912] (-2077.315) (-2075.536) (-2085.429) -- 0:03:33
Average standard deviation of split frequencies: 0.006756
247100 -- (-2075.448) [-2072.894] (-2075.943) (-2078.058) * [-2074.452] (-2078.715) (-2073.864) (-2079.248) -- 0:03:33
247200 -- (-2075.203) (-2077.446) [-2076.170] (-2073.258) * (-2074.422) (-2080.413) [-2075.164] (-2073.376) -- 0:03:33
247300 -- (-2076.532) (-2081.445) (-2083.272) [-2075.247] * (-2073.784) (-2077.208) (-2088.577) [-2072.125] -- 0:03:33
247400 -- [-2073.144] (-2078.554) (-2072.409) (-2077.272) * (-2077.393) (-2076.460) [-2077.736] (-2080.803) -- 0:03:32
247500 -- (-2079.451) (-2072.444) (-2075.404) [-2072.708] * (-2081.095) (-2085.788) [-2076.203] (-2084.311) -- 0:03:32
247600 -- (-2084.413) (-2080.900) (-2074.065) [-2079.893] * (-2079.228) (-2083.458) [-2074.516] (-2090.006) -- 0:03:32
247700 -- (-2085.047) (-2078.967) (-2073.763) [-2069.615] * (-2077.404) [-2078.311] (-2075.239) (-2099.694) -- 0:03:32
247800 -- [-2074.402] (-2080.184) (-2070.818) (-2079.265) * (-2079.719) (-2080.495) [-2067.615] (-2102.018) -- 0:03:32
247900 -- (-2072.863) (-2076.622) (-2068.933) [-2071.953] * [-2081.021] (-2085.004) (-2074.597) (-2080.177) -- 0:03:32
248000 -- [-2071.304] (-2084.971) (-2079.743) (-2077.978) * (-2078.243) (-2078.601) [-2068.962] (-2084.364) -- 0:03:32
Average standard deviation of split frequencies: 0.007274
248100 -- [-2072.305] (-2078.294) (-2077.343) (-2075.981) * (-2079.009) (-2082.432) [-2071.571] (-2079.174) -- 0:03:32
248200 -- (-2072.444) (-2085.322) (-2079.937) [-2072.516] * (-2074.908) (-2081.479) [-2069.823] (-2081.517) -- 0:03:32
248300 -- (-2072.009) (-2085.566) (-2083.369) [-2073.808] * (-2088.412) (-2082.767) [-2066.740] (-2079.675) -- 0:03:31
248400 -- [-2070.492] (-2079.408) (-2088.790) (-2070.685) * (-2076.474) (-2093.779) [-2067.670] (-2073.572) -- 0:03:31
248500 -- (-2074.879) [-2078.635] (-2077.694) (-2071.102) * (-2077.694) (-2090.335) (-2071.640) [-2073.743] -- 0:03:31
248600 -- (-2072.371) (-2080.681) [-2073.438] (-2075.201) * (-2077.098) (-2090.843) [-2077.871] (-2074.531) -- 0:03:31
248700 -- (-2076.097) (-2086.986) (-2069.024) [-2070.444] * (-2084.070) (-2076.860) [-2070.485] (-2071.276) -- 0:03:31
248800 -- [-2067.693] (-2080.408) (-2076.582) (-2070.254) * (-2077.947) (-2078.524) (-2071.053) [-2072.619] -- 0:03:31
248900 -- [-2070.779] (-2080.278) (-2086.553) (-2080.393) * (-2079.860) (-2081.291) [-2072.534] (-2069.738) -- 0:03:31
249000 -- [-2073.863] (-2083.393) (-2075.591) (-2078.932) * (-2078.019) (-2075.700) [-2078.133] (-2073.686) -- 0:03:31
Average standard deviation of split frequencies: 0.007729
249100 -- (-2076.980) (-2086.442) [-2076.119] (-2075.574) * (-2073.616) [-2078.082] (-2081.935) (-2075.107) -- 0:03:31
249200 -- [-2069.579] (-2075.870) (-2076.429) (-2074.466) * [-2074.211] (-2085.833) (-2076.450) (-2076.409) -- 0:03:30
249300 -- (-2073.385) [-2071.925] (-2073.736) (-2073.993) * (-2083.418) [-2079.409] (-2076.716) (-2076.321) -- 0:03:30
249400 -- [-2075.871] (-2079.086) (-2072.334) (-2074.963) * (-2089.229) (-2078.847) [-2071.773] (-2081.739) -- 0:03:30
249500 -- [-2070.657] (-2077.057) (-2070.636) (-2079.200) * (-2097.624) (-2083.240) [-2073.038] (-2082.854) -- 0:03:30
249600 -- (-2078.420) (-2076.448) [-2069.903] (-2074.126) * (-2085.456) (-2091.152) [-2072.068] (-2084.279) -- 0:03:30
249700 -- [-2072.837] (-2070.677) (-2074.591) (-2075.616) * (-2093.947) (-2088.732) [-2069.860] (-2077.996) -- 0:03:30
249800 -- [-2072.001] (-2073.875) (-2077.061) (-2076.743) * (-2092.205) (-2079.382) [-2069.770] (-2075.357) -- 0:03:30
249900 -- (-2075.830) [-2067.409] (-2084.995) (-2078.090) * (-2099.839) (-2077.599) [-2073.129] (-2074.725) -- 0:03:30
250000 -- (-2080.416) [-2070.144] (-2076.881) (-2077.692) * (-2095.378) (-2079.742) [-2070.510] (-2079.445) -- 0:03:29
Average standard deviation of split frequencies: 0.007754
250100 -- (-2073.064) (-2082.326) [-2075.320] (-2081.114) * (-2082.295) (-2085.819) (-2076.479) [-2074.399] -- 0:03:29
250200 -- [-2072.877] (-2073.042) (-2080.757) (-2078.525) * (-2086.657) (-2084.778) (-2071.819) [-2075.211] -- 0:03:29
250300 -- [-2075.917] (-2080.213) (-2079.111) (-2085.837) * (-2092.253) (-2083.777) [-2076.932] (-2074.914) -- 0:03:29
250400 -- (-2073.020) (-2077.157) (-2080.941) [-2074.570] * (-2084.295) (-2090.293) (-2071.113) [-2075.355] -- 0:03:29
250500 -- [-2072.904] (-2075.503) (-2082.409) (-2077.497) * (-2076.338) (-2092.267) [-2069.325] (-2076.474) -- 0:03:32
250600 -- (-2082.038) [-2073.342] (-2070.878) (-2077.772) * [-2074.780] (-2082.371) (-2076.694) (-2074.681) -- 0:03:32
250700 -- (-2080.520) (-2073.713) [-2075.449] (-2079.265) * (-2075.467) (-2083.243) (-2073.320) [-2076.367] -- 0:03:32
250800 -- (-2075.426) (-2069.800) (-2077.466) [-2075.730] * (-2078.731) (-2077.911) (-2082.170) [-2076.300] -- 0:03:32
250900 -- (-2076.886) (-2083.901) (-2081.007) [-2074.346] * (-2078.316) (-2074.656) (-2083.000) [-2071.593] -- 0:03:31
251000 -- (-2079.146) (-2087.910) [-2075.182] (-2075.955) * (-2080.351) (-2079.745) (-2074.760) [-2070.366] -- 0:03:31
Average standard deviation of split frequencies: 0.007667
251100 -- (-2091.571) (-2084.952) [-2073.277] (-2073.137) * [-2073.766] (-2084.084) (-2078.334) (-2071.119) -- 0:03:31
251200 -- (-2079.976) (-2073.142) (-2076.011) [-2072.229] * (-2073.370) (-2091.270) [-2071.928] (-2072.021) -- 0:03:31
251300 -- (-2073.329) (-2080.842) [-2065.317] (-2073.111) * (-2081.654) (-2090.951) (-2076.087) [-2075.284] -- 0:03:31
251400 -- (-2078.803) (-2081.463) [-2066.765] (-2074.926) * [-2074.117] (-2078.572) (-2071.851) (-2076.417) -- 0:03:31
251500 -- (-2081.394) (-2073.652) (-2071.129) [-2068.862] * (-2073.659) (-2089.955) (-2084.966) [-2077.559] -- 0:03:31
251600 -- (-2076.068) (-2085.534) (-2072.301) [-2071.300] * (-2075.144) (-2075.413) [-2082.825] (-2080.080) -- 0:03:31
251700 -- (-2077.045) (-2075.391) [-2069.000] (-2077.101) * (-2075.007) [-2076.044] (-2075.347) (-2080.000) -- 0:03:31
251800 -- (-2078.286) (-2080.273) [-2070.562] (-2077.575) * [-2080.446] (-2079.540) (-2077.260) (-2071.859) -- 0:03:30
251900 -- (-2085.926) [-2073.233] (-2071.602) (-2076.180) * (-2076.451) [-2080.724] (-2072.120) (-2071.794) -- 0:03:30
252000 -- (-2078.555) (-2087.924) [-2077.234] (-2078.808) * (-2077.717) (-2081.279) [-2071.000] (-2073.255) -- 0:03:30
Average standard deviation of split frequencies: 0.007105
252100 -- [-2071.080] (-2076.490) (-2071.259) (-2079.258) * (-2079.273) (-2079.456) [-2074.124] (-2075.503) -- 0:03:30
252200 -- [-2075.532] (-2077.550) (-2077.650) (-2082.956) * (-2078.251) (-2077.554) (-2083.147) [-2073.385] -- 0:03:30
252300 -- [-2073.147] (-2070.150) (-2083.452) (-2100.636) * [-2075.223] (-2084.810) (-2088.504) (-2067.027) -- 0:03:30
252400 -- [-2072.611] (-2077.305) (-2082.388) (-2086.612) * (-2076.798) (-2077.928) (-2084.197) [-2070.980] -- 0:03:30
252500 -- (-2076.079) (-2074.737) [-2069.823] (-2080.252) * (-2078.101) (-2086.515) (-2079.078) [-2070.410] -- 0:03:30
252600 -- (-2080.130) (-2080.271) [-2071.575] (-2073.804) * (-2073.286) (-2079.031) (-2086.114) [-2069.830] -- 0:03:30
252700 -- (-2074.438) (-2083.091) [-2067.845] (-2073.312) * (-2077.622) (-2088.685) (-2086.218) [-2069.889] -- 0:03:29
252800 -- [-2070.117] (-2075.565) (-2073.277) (-2075.350) * (-2079.515) (-2080.978) (-2080.288) [-2072.418] -- 0:03:29
252900 -- (-2079.305) (-2077.241) [-2075.524] (-2077.056) * (-2076.635) (-2080.407) (-2080.974) [-2068.881] -- 0:03:29
253000 -- (-2085.597) (-2074.821) [-2073.717] (-2075.261) * (-2082.722) (-2095.145) (-2076.034) [-2071.339] -- 0:03:29
Average standard deviation of split frequencies: 0.007128
253100 -- (-2074.637) (-2075.191) (-2075.004) [-2076.663] * (-2076.822) (-2092.507) (-2078.090) [-2072.133] -- 0:03:29
253200 -- (-2079.502) (-2077.798) (-2089.594) [-2075.228] * (-2083.197) [-2088.607] (-2081.183) (-2069.706) -- 0:03:29
253300 -- (-2073.408) (-2076.386) [-2081.100] (-2080.799) * (-2080.603) (-2084.452) (-2078.759) [-2067.601] -- 0:03:29
253400 -- [-2076.203] (-2075.908) (-2080.202) (-2075.277) * (-2082.137) [-2077.772] (-2092.916) (-2066.133) -- 0:03:29
253500 -- (-2084.272) [-2071.620] (-2085.247) (-2076.877) * (-2080.346) (-2076.902) (-2085.173) [-2068.536] -- 0:03:29
253600 -- [-2079.833] (-2074.404) (-2076.026) (-2078.028) * (-2082.079) (-2088.479) (-2084.656) [-2066.635] -- 0:03:28
253700 -- (-2075.959) [-2068.503] (-2070.472) (-2077.365) * (-2081.466) (-2084.633) (-2084.169) [-2076.077] -- 0:03:28
253800 -- (-2073.530) (-2079.377) [-2069.587] (-2082.810) * (-2080.583) (-2078.802) (-2085.842) [-2074.649] -- 0:03:28
253900 -- (-2073.229) [-2076.873] (-2076.007) (-2081.042) * (-2074.322) (-2079.727) (-2078.071) [-2075.748] -- 0:03:28
254000 -- (-2080.986) (-2074.397) (-2075.805) [-2071.134] * [-2075.155] (-2084.502) (-2079.642) (-2086.260) -- 0:03:31
Average standard deviation of split frequencies: 0.006784
254100 -- (-2077.082) (-2073.087) [-2072.016] (-2081.292) * (-2087.522) (-2084.752) [-2077.405] (-2090.831) -- 0:03:31
254200 -- (-2078.931) (-2082.768) [-2070.152] (-2083.942) * (-2080.064) [-2076.537] (-2075.786) (-2079.539) -- 0:03:31
254300 -- [-2080.131] (-2080.323) (-2073.612) (-2076.168) * (-2076.762) [-2072.941] (-2073.379) (-2087.583) -- 0:03:31
254400 -- (-2080.199) [-2074.361] (-2069.882) (-2073.369) * (-2078.575) (-2075.581) [-2073.328] (-2079.413) -- 0:03:31
254500 -- [-2069.868] (-2075.393) (-2070.256) (-2077.433) * (-2081.255) (-2073.110) (-2077.610) [-2081.028] -- 0:03:30
254600 -- [-2074.269] (-2077.773) (-2080.774) (-2079.852) * (-2082.643) (-2083.118) [-2078.498] (-2080.827) -- 0:03:30
254700 -- (-2070.343) (-2086.317) (-2072.319) [-2071.002] * (-2080.662) (-2074.962) (-2077.919) [-2073.429] -- 0:03:30
254800 -- [-2070.570] (-2080.116) (-2074.835) (-2073.574) * (-2077.516) (-2084.174) [-2074.819] (-2077.116) -- 0:03:30
254900 -- (-2070.863) (-2080.153) [-2072.897] (-2079.635) * (-2075.521) (-2088.392) (-2077.031) [-2076.748] -- 0:03:30
255000 -- (-2070.857) [-2077.467] (-2074.200) (-2072.568) * (-2084.806) (-2089.337) (-2078.425) [-2076.847] -- 0:03:30
Average standard deviation of split frequencies: 0.007389
255100 -- (-2078.343) (-2090.100) (-2075.477) [-2068.551] * (-2089.033) (-2078.859) (-2087.137) [-2076.833] -- 0:03:30
255200 -- (-2080.785) (-2081.155) [-2072.851] (-2073.540) * (-2080.174) (-2079.781) (-2084.801) [-2081.639] -- 0:03:30
255300 -- (-2073.086) (-2073.359) (-2084.265) [-2073.469] * (-2086.354) [-2076.355] (-2077.893) (-2073.086) -- 0:03:30
255400 -- (-2077.764) [-2073.757] (-2077.163) (-2069.499) * (-2086.530) (-2076.506) (-2079.968) [-2073.131] -- 0:03:29
255500 -- (-2073.271) [-2077.591] (-2074.764) (-2071.385) * (-2083.731) (-2080.048) (-2075.331) [-2068.915] -- 0:03:29
255600 -- (-2076.156) (-2076.050) [-2072.647] (-2075.502) * (-2082.583) (-2080.123) (-2076.912) [-2072.475] -- 0:03:29
255700 -- (-2075.080) [-2070.724] (-2073.787) (-2076.325) * (-2084.104) (-2075.369) [-2074.908] (-2073.447) -- 0:03:29
255800 -- (-2082.941) [-2078.377] (-2074.528) (-2074.390) * (-2091.604) (-2075.880) [-2073.983] (-2074.330) -- 0:03:29
255900 -- (-2075.706) (-2091.473) [-2071.100] (-2083.985) * (-2082.904) (-2078.184) (-2079.137) [-2069.086] -- 0:03:29
256000 -- (-2077.772) (-2073.401) [-2072.882] (-2080.844) * (-2088.826) [-2073.237] (-2075.378) (-2075.575) -- 0:03:29
Average standard deviation of split frequencies: 0.007940
256100 -- [-2072.274] (-2076.826) (-2074.414) (-2081.450) * (-2096.925) (-2078.152) (-2076.873) [-2073.227] -- 0:03:29
256200 -- (-2074.508) [-2066.174] (-2074.853) (-2101.164) * (-2080.513) (-2076.794) (-2085.041) [-2080.627] -- 0:03:29
256300 -- (-2085.893) [-2069.125] (-2076.331) (-2105.674) * (-2096.941) (-2076.885) (-2091.126) [-2075.760] -- 0:03:28
256400 -- (-2077.803) [-2070.435] (-2072.185) (-2082.576) * (-2099.749) (-2077.786) [-2081.728] (-2081.011) -- 0:03:28
256500 -- (-2076.794) [-2070.079] (-2080.362) (-2080.672) * (-2096.118) (-2081.396) (-2081.866) [-2074.196] -- 0:03:28
256600 -- (-2079.283) (-2073.935) (-2086.032) [-2071.057] * (-2095.109) (-2075.507) (-2077.112) [-2066.283] -- 0:03:28
256700 -- [-2076.121] (-2073.881) (-2085.485) (-2077.208) * (-2096.601) (-2077.737) (-2083.349) [-2069.630] -- 0:03:28
256800 -- (-2081.940) [-2070.162] (-2084.902) (-2075.361) * (-2091.360) (-2078.349) (-2084.668) [-2070.573] -- 0:03:28
256900 -- (-2094.291) [-2071.529] (-2076.301) (-2073.442) * (-2093.200) (-2083.979) (-2087.943) [-2069.928] -- 0:03:28
257000 -- (-2089.085) (-2072.672) [-2076.915] (-2079.468) * (-2092.838) (-2081.058) (-2092.380) [-2068.521] -- 0:03:28
Average standard deviation of split frequencies: 0.008064
257100 -- (-2080.921) [-2072.874] (-2076.627) (-2083.066) * (-2095.865) (-2076.963) (-2086.689) [-2076.601] -- 0:03:28
257200 -- (-2084.293) (-2074.970) [-2072.762] (-2080.602) * (-2091.100) (-2083.774) (-2080.051) [-2072.494] -- 0:03:27
257300 -- (-2086.699) (-2076.930) [-2071.862] (-2077.999) * (-2085.603) (-2073.036) (-2090.015) [-2070.812] -- 0:03:27
257400 -- (-2077.980) (-2079.611) (-2073.204) [-2074.815] * (-2081.248) (-2080.003) (-2085.964) [-2077.790] -- 0:03:27
257500 -- (-2084.892) [-2077.736] (-2072.786) (-2073.704) * (-2083.486) (-2085.320) (-2084.928) [-2068.814] -- 0:03:27
257600 -- (-2079.954) [-2072.875] (-2074.704) (-2079.163) * (-2082.342) (-2085.968) (-2086.865) [-2076.889] -- 0:03:30
257700 -- (-2084.340) (-2076.736) (-2069.677) [-2081.479] * (-2087.985) [-2074.302] (-2081.257) (-2077.761) -- 0:03:30
257800 -- (-2076.648) (-2079.049) [-2069.859] (-2080.883) * (-2084.844) [-2077.983] (-2074.719) (-2074.055) -- 0:03:30
257900 -- (-2073.141) [-2079.501] (-2072.893) (-2088.936) * (-2082.747) (-2076.747) (-2081.393) [-2073.161] -- 0:03:30
258000 -- (-2070.815) (-2077.724) [-2068.341] (-2077.852) * (-2079.366) (-2082.829) (-2081.933) [-2072.345] -- 0:03:29
Average standard deviation of split frequencies: 0.008087
258100 -- [-2072.396] (-2073.110) (-2073.831) (-2083.284) * (-2080.089) (-2087.282) [-2081.389] (-2069.423) -- 0:03:29
258200 -- (-2077.265) (-2073.659) [-2079.610] (-2079.776) * (-2080.546) (-2089.649) (-2083.754) [-2068.496] -- 0:03:29
258300 -- [-2071.493] (-2073.579) (-2079.726) (-2088.675) * (-2072.717) (-2084.618) (-2073.176) [-2067.346] -- 0:03:29
258400 -- (-2083.070) [-2072.581] (-2081.067) (-2085.541) * [-2076.411] (-2082.885) (-2084.680) (-2076.708) -- 0:03:29
258500 -- (-2084.647) (-2085.861) [-2075.782] (-2083.442) * (-2076.156) (-2079.541) (-2083.027) [-2068.915] -- 0:03:29
258600 -- (-2084.389) (-2077.440) [-2072.072] (-2086.669) * (-2074.107) (-2082.334) (-2078.473) [-2079.492] -- 0:03:29
258700 -- (-2081.664) (-2076.288) (-2070.551) [-2081.819] * (-2077.976) (-2092.488) (-2076.784) [-2074.771] -- 0:03:29
258800 -- (-2088.190) (-2079.262) [-2072.908] (-2085.092) * (-2075.991) (-2082.376) (-2075.187) [-2071.096] -- 0:03:29
258900 -- (-2075.499) (-2085.042) [-2067.452] (-2083.578) * [-2076.888] (-2080.739) (-2078.132) (-2071.351) -- 0:03:28
259000 -- [-2074.124] (-2090.562) (-2070.381) (-2085.108) * (-2085.116) (-2078.541) (-2076.894) [-2070.561] -- 0:03:28
Average standard deviation of split frequencies: 0.008262
259100 -- (-2076.905) (-2080.384) [-2074.256] (-2080.882) * (-2077.484) (-2082.568) [-2077.807] (-2075.231) -- 0:03:28
259200 -- [-2071.492] (-2072.037) (-2076.955) (-2082.820) * (-2084.569) (-2090.658) [-2082.325] (-2078.059) -- 0:03:28
259300 -- (-2074.917) (-2070.847) [-2070.604] (-2082.764) * (-2079.809) (-2080.656) (-2077.192) [-2070.748] -- 0:03:28
259400 -- [-2072.123] (-2080.394) (-2073.274) (-2080.211) * (-2081.576) [-2081.378] (-2090.600) (-2074.883) -- 0:03:28
259500 -- (-2074.379) (-2084.691) (-2075.313) [-2075.168] * (-2077.409) (-2082.522) (-2083.186) [-2072.576] -- 0:03:28
259600 -- (-2080.141) [-2079.916] (-2079.968) (-2079.106) * (-2080.958) (-2079.249) (-2083.172) [-2071.506] -- 0:03:28
259700 -- (-2072.432) (-2085.353) (-2074.802) [-2073.592] * (-2073.634) (-2082.288) [-2080.220] (-2075.180) -- 0:03:28
259800 -- (-2068.459) (-2094.331) [-2070.249] (-2084.242) * [-2071.882] (-2079.318) (-2079.324) (-2079.821) -- 0:03:27
259900 -- (-2068.824) (-2086.850) [-2069.637] (-2080.821) * (-2083.657) (-2079.536) (-2082.380) [-2074.867] -- 0:03:27
260000 -- (-2073.891) (-2079.860) [-2070.999] (-2087.629) * (-2076.100) (-2079.879) (-2080.207) [-2075.834] -- 0:03:27
Average standard deviation of split frequencies: 0.008491
260100 -- [-2077.123] (-2079.480) (-2074.782) (-2079.731) * (-2084.558) (-2076.575) [-2073.920] (-2073.721) -- 0:03:27
260200 -- (-2079.123) (-2080.463) [-2070.165] (-2075.135) * (-2085.028) (-2092.456) (-2080.407) [-2077.317] -- 0:03:27
260300 -- (-2075.867) (-2073.299) [-2068.054] (-2077.564) * (-2086.468) (-2082.262) [-2078.522] (-2080.701) -- 0:03:27
260400 -- [-2077.294] (-2073.016) (-2069.937) (-2080.239) * (-2085.997) (-2081.582) [-2075.487] (-2073.924) -- 0:03:27
260500 -- (-2084.571) [-2078.108] (-2076.168) (-2084.174) * (-2080.890) (-2083.363) (-2075.131) [-2073.571] -- 0:03:27
260600 -- (-2087.592) (-2069.895) [-2074.512] (-2079.565) * (-2086.820) (-2080.660) (-2076.913) [-2078.950] -- 0:03:27
260700 -- (-2077.253) [-2077.941] (-2075.673) (-2084.777) * (-2085.903) (-2084.557) (-2077.055) [-2079.179] -- 0:03:27
260800 -- (-2076.576) (-2070.087) (-2075.403) [-2074.408] * [-2079.679] (-2091.877) (-2079.015) (-2076.099) -- 0:03:26
260900 -- (-2073.824) (-2068.970) (-2083.092) [-2077.246] * (-2084.373) (-2082.397) (-2083.024) [-2079.020] -- 0:03:26
261000 -- (-2077.524) [-2068.285] (-2070.028) (-2094.914) * (-2082.268) (-2083.214) (-2074.974) [-2077.645] -- 0:03:26
Average standard deviation of split frequencies: 0.008921
261100 -- [-2068.137] (-2071.331) (-2071.835) (-2087.493) * (-2083.122) (-2076.393) [-2076.397] (-2074.782) -- 0:03:29
261200 -- (-2069.956) (-2069.078) [-2069.371] (-2092.548) * (-2085.908) (-2089.150) (-2078.419) [-2075.657] -- 0:03:29
261300 -- (-2071.340) (-2069.255) [-2072.594] (-2086.417) * (-2086.566) (-2089.097) [-2071.865] (-2078.087) -- 0:03:29
261400 -- (-2071.878) (-2070.387) (-2069.711) [-2084.381] * [-2077.945] (-2074.854) (-2077.649) (-2079.596) -- 0:03:29
261500 -- [-2070.736] (-2070.112) (-2075.766) (-2086.431) * (-2083.356) [-2075.301] (-2079.311) (-2074.468) -- 0:03:28
261600 -- [-2070.006] (-2072.486) (-2072.113) (-2078.177) * (-2086.540) [-2080.988] (-2079.983) (-2076.444) -- 0:03:28
261700 -- (-2075.283) (-2075.566) [-2068.670] (-2083.445) * [-2076.220] (-2083.147) (-2082.442) (-2085.010) -- 0:03:28
261800 -- (-2076.934) (-2074.564) [-2078.037] (-2083.467) * [-2075.649] (-2087.126) (-2081.231) (-2085.915) -- 0:03:28
261900 -- (-2077.136) (-2084.197) (-2068.974) [-2082.669] * [-2078.029] (-2078.827) (-2076.792) (-2083.535) -- 0:03:28
262000 -- [-2075.418] (-2072.972) (-2086.034) (-2083.604) * (-2079.544) (-2081.848) [-2077.351] (-2079.660) -- 0:03:28
Average standard deviation of split frequencies: 0.008632
262100 -- (-2079.315) (-2074.016) [-2072.542] (-2074.227) * (-2078.472) [-2081.238] (-2082.544) (-2080.167) -- 0:03:28
262200 -- (-2083.011) [-2077.305] (-2073.906) (-2079.609) * (-2075.545) [-2083.704] (-2081.790) (-2095.170) -- 0:03:28
262300 -- (-2079.521) [-2070.795] (-2068.257) (-2076.712) * [-2076.340] (-2083.583) (-2083.391) (-2088.231) -- 0:03:28
262400 -- (-2075.379) [-2070.019] (-2070.023) (-2079.409) * [-2076.462] (-2076.219) (-2085.178) (-2079.185) -- 0:03:28
262500 -- (-2079.059) [-2072.915] (-2075.534) (-2081.242) * [-2081.163] (-2081.668) (-2077.989) (-2074.782) -- 0:03:27
262600 -- (-2077.739) [-2071.707] (-2082.021) (-2087.450) * (-2075.420) (-2082.934) (-2076.423) [-2079.502] -- 0:03:27
262700 -- (-2082.142) [-2071.195] (-2086.709) (-2080.151) * (-2077.436) [-2077.228] (-2079.178) (-2080.159) -- 0:03:27
262800 -- (-2078.541) [-2068.857] (-2087.245) (-2080.110) * (-2075.973) [-2073.817] (-2086.084) (-2074.153) -- 0:03:27
262900 -- (-2072.756) [-2072.006] (-2074.545) (-2079.800) * (-2079.815) (-2076.131) [-2078.926] (-2078.703) -- 0:03:27
263000 -- (-2078.332) (-2082.681) [-2078.234] (-2072.376) * [-2071.544] (-2078.844) (-2084.352) (-2082.702) -- 0:03:27
Average standard deviation of split frequencies: 0.008341
263100 -- (-2083.581) (-2082.218) (-2075.552) [-2072.906] * (-2074.005) (-2094.189) (-2086.670) [-2077.365] -- 0:03:27
263200 -- (-2077.000) (-2076.308) (-2079.099) [-2075.748] * [-2074.832] (-2086.978) (-2081.642) (-2077.270) -- 0:03:27
263300 -- (-2081.520) (-2071.789) [-2072.413] (-2078.425) * (-2072.556) (-2092.561) (-2091.460) [-2074.847] -- 0:03:27
263400 -- (-2087.649) (-2069.841) [-2078.677] (-2083.845) * [-2071.892] (-2078.140) (-2085.202) (-2079.948) -- 0:03:26
263500 -- (-2077.823) (-2070.092) (-2076.337) [-2080.909] * [-2067.856] (-2082.758) (-2088.757) (-2080.711) -- 0:03:26
263600 -- (-2078.306) (-2076.029) [-2079.876] (-2086.528) * [-2068.772] (-2079.613) (-2086.137) (-2082.155) -- 0:03:26
263700 -- (-2076.224) [-2075.413] (-2080.495) (-2080.450) * (-2068.743) [-2075.683] (-2087.287) (-2087.679) -- 0:03:26
263800 -- (-2076.389) (-2075.253) [-2080.371] (-2086.449) * [-2071.730] (-2082.995) (-2091.142) (-2082.178) -- 0:03:26
263900 -- (-2072.649) (-2079.989) [-2073.885] (-2083.859) * (-2074.124) [-2074.540] (-2080.841) (-2091.362) -- 0:03:26
264000 -- [-2074.490] (-2087.224) (-2082.673) (-2088.669) * (-2069.470) [-2074.225] (-2084.118) (-2105.120) -- 0:03:26
Average standard deviation of split frequencies: 0.008669
264100 -- [-2073.594] (-2081.051) (-2076.992) (-2085.582) * [-2076.763] (-2078.611) (-2088.050) (-2085.510) -- 0:03:26
264200 -- [-2072.166] (-2086.088) (-2084.203) (-2092.396) * (-2075.773) (-2084.659) [-2079.207] (-2086.312) -- 0:03:26
264300 -- (-2073.397) (-2077.322) [-2080.321] (-2088.347) * (-2077.871) (-2088.282) (-2082.762) [-2076.086] -- 0:03:25
264400 -- (-2077.623) [-2078.879] (-2084.442) (-2092.678) * (-2079.289) (-2078.485) (-2086.300) [-2079.046] -- 0:03:25
264500 -- (-2079.568) [-2076.339] (-2087.604) (-2085.237) * (-2084.418) (-2080.431) [-2080.512] (-2079.885) -- 0:03:25
264600 -- (-2076.727) [-2075.402] (-2090.682) (-2082.466) * (-2079.490) (-2077.284) (-2077.242) [-2077.046] -- 0:03:25
264700 -- (-2078.417) (-2072.724) (-2077.599) [-2088.772] * [-2069.450] (-2075.544) (-2078.446) (-2077.932) -- 0:03:28
264800 -- [-2070.692] (-2074.352) (-2076.270) (-2087.476) * [-2069.856] (-2073.052) (-2084.788) (-2084.147) -- 0:03:28
264900 -- (-2073.605) (-2079.685) [-2075.294] (-2078.389) * [-2067.938] (-2069.641) (-2082.337) (-2076.273) -- 0:03:28
265000 -- (-2072.705) (-2079.641) (-2071.926) [-2077.968] * (-2068.531) [-2072.040] (-2083.844) (-2075.299) -- 0:03:28
Average standard deviation of split frequencies: 0.008329
265100 -- [-2071.513] (-2084.719) (-2075.225) (-2078.008) * [-2077.280] (-2069.940) (-2090.438) (-2080.907) -- 0:03:27
265200 -- (-2071.421) (-2090.093) (-2077.556) [-2078.761] * [-2078.095] (-2077.321) (-2087.003) (-2082.639) -- 0:03:27
265300 -- (-2077.051) (-2078.970) [-2074.913] (-2088.600) * (-2072.655) [-2075.259] (-2085.767) (-2073.745) -- 0:03:27
265400 -- [-2076.368] (-2082.531) (-2074.760) (-2084.457) * (-2075.883) [-2071.181] (-2083.545) (-2082.352) -- 0:03:27
265500 -- (-2076.664) [-2076.565] (-2077.238) (-2082.543) * [-2076.765] (-2075.103) (-2085.383) (-2077.104) -- 0:03:27
265600 -- [-2078.821] (-2076.506) (-2076.941) (-2085.903) * [-2067.932] (-2073.422) (-2084.270) (-2072.389) -- 0:03:27
265700 -- (-2082.704) (-2087.465) [-2070.723] (-2075.807) * (-2069.492) [-2078.574] (-2075.350) (-2076.235) -- 0:03:27
265800 -- (-2071.911) (-2089.672) [-2074.316] (-2081.391) * [-2068.956] (-2074.661) (-2081.143) (-2078.507) -- 0:03:27
265900 -- (-2078.526) (-2075.162) [-2075.350] (-2080.115) * (-2077.720) [-2070.987] (-2080.601) (-2075.833) -- 0:03:27
266000 -- (-2073.195) (-2079.438) (-2076.463) [-2076.185] * (-2077.512) (-2078.242) (-2078.987) [-2073.916] -- 0:03:26
Average standard deviation of split frequencies: 0.008502
266100 -- [-2073.320] (-2082.206) (-2070.757) (-2082.377) * [-2078.676] (-2073.494) (-2080.177) (-2077.682) -- 0:03:26
266200 -- (-2077.955) (-2078.387) [-2072.159] (-2082.280) * (-2081.060) [-2069.665] (-2078.748) (-2074.598) -- 0:03:26
266300 -- (-2078.142) (-2089.802) (-2077.627) [-2073.210] * [-2075.858] (-2078.920) (-2082.802) (-2080.147) -- 0:03:26
266400 -- (-2075.989) (-2091.554) (-2079.079) [-2075.901] * (-2080.228) (-2073.911) (-2084.439) [-2081.954] -- 0:03:26
266500 -- (-2076.627) (-2079.368) [-2074.419] (-2089.107) * (-2076.721) (-2081.201) (-2079.444) [-2084.229] -- 0:03:26
266600 -- (-2074.273) (-2075.964) [-2074.348] (-2089.633) * (-2074.440) (-2076.002) (-2072.527) [-2075.970] -- 0:03:26
266700 -- [-2070.045] (-2080.728) (-2079.268) (-2079.971) * [-2074.519] (-2071.762) (-2087.174) (-2072.402) -- 0:03:26
266800 -- (-2079.251) [-2080.311] (-2086.206) (-2079.411) * [-2072.796] (-2075.691) (-2076.219) (-2077.033) -- 0:03:26
266900 -- (-2078.227) (-2077.417) (-2083.977) [-2074.176] * (-2075.788) (-2073.824) (-2079.617) [-2077.438] -- 0:03:26
267000 -- (-2075.501) (-2076.562) [-2075.929] (-2078.113) * (-2077.586) (-2067.883) [-2083.311] (-2077.214) -- 0:03:25
Average standard deviation of split frequencies: 0.008065
267100 -- [-2074.656] (-2073.566) (-2073.378) (-2084.850) * (-2086.516) [-2069.889] (-2089.335) (-2073.071) -- 0:03:25
267200 -- (-2075.353) [-2075.781] (-2078.290) (-2084.614) * (-2078.942) (-2074.961) (-2082.497) [-2076.624] -- 0:03:25
267300 -- (-2082.265) (-2079.515) [-2074.695] (-2074.818) * [-2073.014] (-2088.368) (-2082.208) (-2077.115) -- 0:03:25
267400 -- (-2081.049) (-2088.236) (-2070.633) [-2078.128] * [-2074.316] (-2086.554) (-2075.359) (-2083.740) -- 0:03:25
267500 -- (-2078.579) (-2088.448) [-2068.356] (-2083.657) * [-2075.236] (-2092.134) (-2075.034) (-2076.191) -- 0:03:25
267600 -- (-2076.935) [-2076.547] (-2081.817) (-2080.653) * [-2073.805] (-2086.389) (-2080.839) (-2077.712) -- 0:03:25
267700 -- (-2084.448) [-2073.013] (-2080.433) (-2083.838) * (-2078.062) [-2075.478] (-2081.369) (-2075.038) -- 0:03:25
267800 -- (-2079.902) [-2071.165] (-2079.943) (-2088.581) * [-2073.067] (-2087.940) (-2086.614) (-2074.328) -- 0:03:25
267900 -- (-2079.813) [-2070.538] (-2086.838) (-2084.707) * (-2068.657) (-2083.016) (-2078.975) [-2084.182] -- 0:03:24
268000 -- (-2074.341) [-2072.411] (-2076.428) (-2082.382) * [-2071.222] (-2082.547) (-2080.242) (-2077.705) -- 0:03:24
Average standard deviation of split frequencies: 0.007585
268100 -- [-2078.517] (-2084.735) (-2072.072) (-2089.061) * [-2077.668] (-2081.830) (-2083.295) (-2081.316) -- 0:03:24
268200 -- (-2071.936) (-2079.717) [-2074.313] (-2082.142) * [-2071.503] (-2085.724) (-2084.806) (-2080.354) -- 0:03:27
268300 -- (-2071.185) (-2076.950) [-2071.321] (-2095.929) * [-2073.090] (-2073.720) (-2077.991) (-2086.798) -- 0:03:27
268400 -- [-2075.255] (-2080.214) (-2074.820) (-2087.401) * (-2075.480) (-2069.679) [-2076.820] (-2087.329) -- 0:03:27
268500 -- [-2075.137] (-2079.973) (-2070.583) (-2088.239) * (-2081.127) [-2067.804] (-2079.447) (-2084.671) -- 0:03:27
268600 -- [-2074.734] (-2077.510) (-2080.085) (-2083.329) * (-2089.597) (-2071.730) (-2081.684) [-2080.317] -- 0:03:26
268700 -- [-2068.390] (-2071.563) (-2075.547) (-2085.749) * (-2087.042) [-2071.450] (-2083.031) (-2078.597) -- 0:03:26
268800 -- (-2073.838) [-2073.664] (-2070.027) (-2082.450) * (-2079.219) (-2073.730) (-2086.327) [-2075.859] -- 0:03:26
268900 -- (-2075.925) (-2077.303) [-2074.799] (-2083.236) * (-2082.038) (-2074.494) (-2079.581) [-2075.739] -- 0:03:26
269000 -- (-2086.119) [-2075.997] (-2072.880) (-2076.573) * (-2076.152) [-2069.364] (-2081.134) (-2072.845) -- 0:03:26
Average standard deviation of split frequencies: 0.007605
269100 -- (-2086.589) (-2077.662) [-2071.258] (-2079.988) * (-2080.247) (-2068.842) [-2087.206] (-2075.520) -- 0:03:26
269200 -- (-2076.791) [-2073.309] (-2068.680) (-2084.900) * (-2077.515) [-2070.795] (-2077.515) (-2084.688) -- 0:03:26
269300 -- (-2074.695) [-2074.432] (-2072.876) (-2086.685) * (-2076.066) (-2068.497) [-2078.561] (-2079.149) -- 0:03:26
269400 -- (-2081.918) (-2075.323) [-2073.282] (-2077.444) * (-2078.183) [-2067.707] (-2073.810) (-2081.232) -- 0:03:26
269500 -- (-2080.137) (-2081.347) [-2071.345] (-2079.869) * (-2078.093) [-2073.875] (-2080.179) (-2080.310) -- 0:03:26
269600 -- (-2072.036) (-2074.540) [-2072.646] (-2084.911) * (-2078.430) [-2073.602] (-2081.230) (-2080.441) -- 0:03:25
269700 -- (-2075.150) [-2072.599] (-2075.040) (-2084.607) * (-2080.212) [-2069.472] (-2085.779) (-2077.099) -- 0:03:25
269800 -- (-2080.146) [-2074.122] (-2083.251) (-2086.259) * [-2080.430] (-2074.386) (-2090.414) (-2082.173) -- 0:03:25
269900 -- (-2073.013) [-2072.996] (-2075.813) (-2091.700) * [-2077.273] (-2073.900) (-2080.691) (-2089.050) -- 0:03:25
270000 -- (-2075.324) [-2075.586] (-2077.184) (-2087.033) * (-2078.474) [-2071.624] (-2074.212) (-2077.485) -- 0:03:25
Average standard deviation of split frequencies: 0.008476
270100 -- (-2075.040) (-2074.233) [-2074.824] (-2086.768) * (-2089.605) [-2071.722] (-2077.750) (-2076.393) -- 0:03:25
270200 -- (-2078.671) [-2072.276] (-2075.097) (-2088.234) * (-2084.254) (-2076.557) (-2075.689) [-2082.992] -- 0:03:25
270300 -- (-2079.273) (-2076.488) [-2077.410] (-2075.324) * (-2092.833) [-2077.919] (-2075.819) (-2079.635) -- 0:03:25
270400 -- [-2072.449] (-2084.130) (-2077.453) (-2075.339) * (-2093.953) (-2085.850) (-2077.588) [-2077.981] -- 0:03:25
270500 -- (-2079.097) (-2076.875) [-2074.281] (-2082.086) * (-2097.821) [-2074.925] (-2082.530) (-2084.754) -- 0:03:24
270600 -- (-2083.968) (-2073.968) [-2074.112] (-2079.689) * (-2085.994) [-2078.651] (-2079.605) (-2092.070) -- 0:03:24
270700 -- (-2079.582) [-2072.440] (-2075.382) (-2080.783) * (-2092.924) (-2080.017) [-2080.209] (-2083.196) -- 0:03:24
270800 -- (-2080.987) (-2076.253) [-2070.902] (-2084.128) * (-2093.320) (-2068.045) (-2083.210) [-2081.956] -- 0:03:24
270900 -- (-2075.167) [-2068.771] (-2073.763) (-2082.480) * (-2090.359) [-2074.109] (-2075.886) (-2084.312) -- 0:03:24
271000 -- (-2072.981) [-2068.734] (-2073.740) (-2089.295) * (-2080.073) [-2064.968] (-2076.331) (-2086.274) -- 0:03:24
Average standard deviation of split frequencies: 0.008492
271100 -- (-2072.220) [-2071.167] (-2071.665) (-2083.653) * (-2074.143) [-2072.929] (-2086.682) (-2078.369) -- 0:03:24
271200 -- (-2078.303) (-2076.204) [-2070.813] (-2078.259) * [-2071.340] (-2075.740) (-2088.065) (-2080.830) -- 0:03:24
271300 -- (-2080.218) (-2075.510) (-2072.117) [-2077.869] * [-2066.085] (-2075.004) (-2078.918) (-2079.419) -- 0:03:24
271400 -- (-2077.680) (-2080.691) [-2076.870] (-2082.405) * (-2068.143) [-2068.560] (-2080.822) (-2083.738) -- 0:03:24
271500 -- (-2079.679) [-2075.247] (-2095.193) (-2078.329) * [-2070.631] (-2073.910) (-2084.650) (-2084.421) -- 0:03:23
271600 -- (-2072.335) (-2076.273) (-2083.540) [-2077.211] * [-2071.570] (-2082.972) (-2084.354) (-2093.804) -- 0:03:23
271700 -- [-2073.472] (-2076.328) (-2079.002) (-2075.838) * [-2076.545] (-2076.627) (-2092.498) (-2090.368) -- 0:03:23
271800 -- (-2073.730) [-2076.895] (-2077.298) (-2078.949) * [-2074.053] (-2079.557) (-2081.685) (-2081.155) -- 0:03:26
271900 -- (-2072.116) [-2071.188] (-2083.958) (-2079.984) * (-2078.752) [-2074.051] (-2085.061) (-2087.014) -- 0:03:26
272000 -- (-2071.082) [-2069.413] (-2083.143) (-2083.133) * (-2081.102) [-2076.903] (-2082.781) (-2088.798) -- 0:03:26
Average standard deviation of split frequencies: 0.009156
272100 -- (-2072.982) (-2072.769) [-2070.515] (-2078.225) * (-2075.845) (-2079.226) [-2074.640] (-2091.519) -- 0:03:25
272200 -- (-2073.313) [-2069.672] (-2070.514) (-2091.099) * (-2084.910) (-2076.838) [-2076.458] (-2086.586) -- 0:03:25
272300 -- (-2072.818) (-2084.005) [-2071.489] (-2079.692) * (-2076.216) (-2089.136) (-2082.518) [-2087.590] -- 0:03:25
272400 -- (-2070.773) (-2077.122) (-2072.489) [-2074.083] * [-2079.343] (-2082.735) (-2080.279) (-2081.402) -- 0:03:25
272500 -- (-2075.107) (-2082.635) (-2077.129) [-2072.573] * (-2083.660) (-2082.519) [-2076.205] (-2083.586) -- 0:03:25
272600 -- (-2071.564) (-2081.011) (-2082.083) [-2073.668] * (-2080.110) (-2090.318) [-2076.476] (-2089.354) -- 0:03:25
272700 -- (-2080.101) [-2071.098] (-2075.023) (-2080.636) * (-2079.915) [-2085.353] (-2073.756) (-2084.438) -- 0:03:25
272800 -- (-2077.704) (-2072.574) [-2078.964] (-2078.263) * (-2090.629) (-2075.408) [-2073.658] (-2080.259) -- 0:03:25
272900 -- [-2079.532] (-2072.899) (-2077.617) (-2080.825) * (-2086.724) (-2078.987) [-2076.227] (-2088.315) -- 0:03:25
273000 -- (-2084.066) [-2070.787] (-2074.676) (-2083.814) * (-2080.769) [-2088.968] (-2074.615) (-2082.595) -- 0:03:25
Average standard deviation of split frequencies: 0.008529
273100 -- [-2077.555] (-2072.866) (-2072.889) (-2082.233) * (-2083.260) (-2080.424) [-2079.747] (-2089.751) -- 0:03:24
273200 -- (-2077.340) (-2074.408) [-2068.536] (-2083.418) * (-2078.742) [-2077.036] (-2083.362) (-2084.412) -- 0:03:24
273300 -- (-2079.042) [-2076.303] (-2080.342) (-2091.311) * [-2076.646] (-2078.057) (-2081.464) (-2096.690) -- 0:03:24
273400 -- [-2077.788] (-2080.450) (-2084.156) (-2089.648) * (-2072.781) [-2072.371] (-2082.345) (-2081.349) -- 0:03:24
273500 -- [-2074.211] (-2070.702) (-2087.997) (-2083.635) * [-2072.498] (-2073.752) (-2082.967) (-2083.618) -- 0:03:24
273600 -- [-2073.679] (-2074.543) (-2077.331) (-2087.410) * [-2076.381] (-2078.350) (-2079.542) (-2083.268) -- 0:03:24
273700 -- [-2075.678] (-2078.621) (-2081.412) (-2095.644) * (-2079.595) (-2072.882) [-2077.265] (-2082.391) -- 0:03:24
273800 -- (-2073.346) (-2074.017) [-2076.781] (-2080.626) * (-2084.483) [-2080.184] (-2074.943) (-2082.467) -- 0:03:24
273900 -- [-2067.057] (-2073.156) (-2086.119) (-2085.225) * (-2077.762) (-2071.690) [-2077.202] (-2082.772) -- 0:03:24
274000 -- (-2068.968) (-2078.398) (-2076.414) [-2078.646] * [-2075.792] (-2074.708) (-2074.629) (-2079.001) -- 0:03:24
Average standard deviation of split frequencies: 0.008549
274100 -- (-2068.166) (-2075.116) (-2075.845) [-2073.816] * [-2073.639] (-2074.975) (-2075.225) (-2080.717) -- 0:03:23
274200 -- [-2068.228] (-2073.314) (-2073.858) (-2080.888) * (-2077.795) (-2074.363) [-2071.397] (-2082.732) -- 0:03:23
274300 -- (-2071.787) [-2073.428] (-2078.434) (-2080.844) * (-2083.833) (-2079.962) [-2073.662] (-2087.004) -- 0:03:23
274400 -- [-2072.373] (-2075.624) (-2081.746) (-2080.504) * [-2076.654] (-2076.668) (-2080.117) (-2087.266) -- 0:03:23
274500 -- (-2076.583) [-2071.665] (-2076.104) (-2087.137) * (-2075.441) [-2073.598] (-2083.656) (-2089.550) -- 0:03:23
274600 -- (-2073.886) (-2084.619) (-2076.283) [-2080.429] * [-2074.729] (-2075.717) (-2081.627) (-2080.475) -- 0:03:23
274700 -- (-2077.084) (-2091.623) (-2074.155) [-2081.980] * [-2071.992] (-2079.031) (-2087.952) (-2086.794) -- 0:03:23
274800 -- (-2082.057) (-2086.784) [-2069.996] (-2080.356) * (-2075.270) (-2076.571) (-2086.396) [-2081.700] -- 0:03:23
274900 -- (-2077.096) (-2092.728) (-2079.542) [-2078.763] * [-2068.008] (-2079.116) (-2087.324) (-2079.962) -- 0:03:23
275000 -- (-2083.669) (-2093.753) [-2072.832] (-2087.702) * (-2077.480) (-2071.449) (-2085.621) [-2079.609] -- 0:03:22
Average standard deviation of split frequencies: 0.008222
275100 -- [-2075.663] (-2085.444) (-2077.084) (-2085.549) * [-2075.155] (-2075.428) (-2084.555) (-2079.935) -- 0:03:22
275200 -- [-2077.533] (-2082.478) (-2080.954) (-2086.721) * (-2087.451) (-2080.630) (-2088.740) [-2081.324] -- 0:03:22
275300 -- [-2074.701] (-2085.436) (-2082.567) (-2091.596) * (-2087.672) (-2082.781) (-2084.386) [-2076.825] -- 0:03:25
275400 -- [-2073.901] (-2081.003) (-2077.186) (-2075.026) * (-2080.950) [-2080.634] (-2085.763) (-2089.101) -- 0:03:25
275500 -- (-2075.370) [-2074.732] (-2078.989) (-2082.742) * [-2077.124] (-2077.637) (-2085.624) (-2085.139) -- 0:03:25
275600 -- (-2084.160) (-2075.261) [-2080.430] (-2089.152) * [-2074.010] (-2074.162) (-2092.773) (-2077.830) -- 0:03:25
275700 -- [-2075.051] (-2078.783) (-2081.859) (-2080.377) * (-2078.369) (-2083.277) (-2083.935) [-2075.475] -- 0:03:24
275800 -- [-2072.884] (-2086.051) (-2080.764) (-2078.007) * (-2076.773) (-2082.046) (-2096.164) [-2080.006] -- 0:03:24
275900 -- (-2079.544) (-2086.639) [-2085.781] (-2080.665) * (-2076.361) (-2084.127) (-2084.463) [-2075.079] -- 0:03:24
276000 -- (-2077.753) (-2084.025) (-2076.902) [-2079.375] * (-2079.686) (-2080.499) (-2088.473) [-2073.466] -- 0:03:24
Average standard deviation of split frequencies: 0.007999
276100 -- (-2079.658) (-2080.510) [-2071.539] (-2085.513) * (-2079.697) [-2075.303] (-2081.507) (-2076.449) -- 0:03:24
276200 -- (-2082.782) [-2073.213] (-2076.277) (-2081.940) * [-2077.802] (-2080.895) (-2081.902) (-2077.397) -- 0:03:24
276300 -- [-2073.048] (-2079.007) (-2080.732) (-2074.952) * [-2080.795] (-2075.596) (-2084.176) (-2087.984) -- 0:03:24
276400 -- [-2075.301] (-2084.218) (-2080.367) (-2084.731) * (-2081.439) (-2071.057) [-2081.964] (-2096.355) -- 0:03:24
276500 -- [-2067.204] (-2087.126) (-2076.034) (-2077.482) * (-2085.171) [-2075.703] (-2078.797) (-2089.177) -- 0:03:24
276600 -- [-2068.642] (-2089.258) (-2077.245) (-2088.535) * [-2080.368] (-2074.572) (-2076.252) (-2085.564) -- 0:03:23
276700 -- [-2069.077] (-2080.910) (-2086.558) (-2078.467) * (-2081.829) [-2071.618] (-2079.066) (-2082.201) -- 0:03:23
276800 -- (-2069.749) (-2084.351) (-2085.856) [-2076.274] * (-2074.631) (-2082.782) [-2076.505] (-2076.906) -- 0:03:23
276900 -- [-2073.363] (-2084.830) (-2079.315) (-2076.824) * (-2081.905) (-2075.186) [-2078.112] (-2079.644) -- 0:03:23
277000 -- (-2078.833) (-2083.413) (-2081.952) [-2083.703] * (-2086.779) [-2075.449] (-2086.446) (-2078.085) -- 0:03:23
Average standard deviation of split frequencies: 0.007726
277100 -- [-2078.696] (-2079.035) (-2081.872) (-2083.915) * (-2090.928) [-2070.818] (-2078.031) (-2083.696) -- 0:03:23
277200 -- (-2080.273) (-2081.070) [-2074.239] (-2084.824) * (-2084.827) [-2075.941] (-2077.701) (-2080.104) -- 0:03:23
277300 -- (-2087.231) (-2089.421) [-2069.748] (-2085.199) * (-2082.075) [-2070.441] (-2077.949) (-2077.560) -- 0:03:23
277400 -- [-2078.457] (-2085.847) (-2073.740) (-2088.053) * (-2076.961) [-2072.477] (-2080.509) (-2082.533) -- 0:03:23
277500 -- [-2077.965] (-2084.226) (-2072.689) (-2085.399) * (-2078.235) [-2077.354] (-2084.398) (-2085.587) -- 0:03:23
277600 -- (-2072.907) (-2074.518) [-2072.135] (-2087.692) * [-2076.310] (-2076.770) (-2073.946) (-2076.114) -- 0:03:22
277700 -- (-2075.664) [-2075.246] (-2073.092) (-2083.661) * (-2078.409) [-2073.872] (-2075.925) (-2080.802) -- 0:03:22
277800 -- [-2071.412] (-2078.814) (-2069.154) (-2082.537) * [-2080.696] (-2074.928) (-2079.149) (-2079.464) -- 0:03:22
277900 -- (-2075.030) [-2073.175] (-2071.469) (-2083.794) * [-2078.665] (-2078.174) (-2076.980) (-2076.844) -- 0:03:22
278000 -- (-2080.153) [-2075.364] (-2072.355) (-2086.729) * [-2076.620] (-2079.176) (-2078.561) (-2078.875) -- 0:03:22
Average standard deviation of split frequencies: 0.008184
278100 -- (-2075.252) [-2075.111] (-2071.043) (-2085.291) * [-2075.437] (-2080.439) (-2079.782) (-2082.284) -- 0:03:22
278200 -- [-2075.411] (-2084.865) (-2078.019) (-2086.017) * (-2074.935) [-2075.704] (-2077.827) (-2091.949) -- 0:03:22
278300 -- [-2074.109] (-2077.426) (-2074.107) (-2087.587) * [-2075.325] (-2081.850) (-2078.846) (-2088.405) -- 0:03:22
278400 -- (-2077.001) [-2079.854] (-2070.449) (-2088.931) * (-2073.336) [-2074.439] (-2083.749) (-2079.524) -- 0:03:22
278500 -- [-2068.869] (-2074.949) (-2076.845) (-2092.785) * (-2072.942) [-2074.190] (-2085.319) (-2078.344) -- 0:03:22
278600 -- (-2075.505) [-2077.930] (-2076.077) (-2084.618) * [-2078.779] (-2074.998) (-2095.560) (-2082.645) -- 0:03:21
278700 -- (-2076.228) (-2082.731) [-2070.991] (-2087.453) * (-2084.001) [-2072.846] (-2087.985) (-2095.897) -- 0:03:21
278800 -- (-2086.412) [-2079.535] (-2074.449) (-2086.766) * [-2072.111] (-2070.053) (-2086.301) (-2077.787) -- 0:03:24
278900 -- [-2079.061] (-2075.577) (-2080.240) (-2081.577) * (-2076.607) [-2080.452] (-2078.443) (-2088.165) -- 0:03:24
279000 -- (-2082.763) [-2073.957] (-2078.010) (-2082.665) * (-2076.672) (-2076.863) [-2073.997] (-2085.835) -- 0:03:24
Average standard deviation of split frequencies: 0.008008
279100 -- (-2072.780) [-2073.251] (-2081.904) (-2078.620) * (-2083.007) (-2077.483) [-2080.687] (-2091.247) -- 0:03:24
279200 -- [-2071.608] (-2078.515) (-2083.885) (-2075.330) * (-2088.633) [-2075.808] (-2080.669) (-2084.618) -- 0:03:23
279300 -- [-2072.876] (-2077.782) (-2080.431) (-2083.220) * (-2074.920) [-2073.936] (-2075.575) (-2084.670) -- 0:03:23
279400 -- [-2073.701] (-2081.233) (-2076.298) (-2083.417) * (-2077.112) [-2081.073] (-2081.144) (-2087.544) -- 0:03:23
279500 -- [-2073.013] (-2076.851) (-2073.095) (-2094.743) * [-2076.268] (-2077.418) (-2081.579) (-2096.206) -- 0:03:23
279600 -- (-2075.552) (-2072.360) [-2075.055] (-2086.784) * (-2075.894) (-2074.990) [-2075.373] (-2090.589) -- 0:03:23
279700 -- [-2070.064] (-2080.788) (-2081.464) (-2080.068) * (-2087.563) (-2077.255) [-2075.709] (-2077.897) -- 0:03:23
279800 -- (-2070.771) (-2082.622) [-2078.587] (-2082.509) * (-2087.041) (-2075.961) [-2076.343] (-2081.399) -- 0:03:23
279900 -- [-2071.982] (-2076.728) (-2084.153) (-2079.508) * (-2081.311) [-2076.484] (-2078.844) (-2078.476) -- 0:03:23
280000 -- [-2073.109] (-2074.902) (-2085.936) (-2081.826) * (-2078.989) (-2091.842) [-2072.732] (-2074.352) -- 0:03:23
Average standard deviation of split frequencies: 0.007500
280100 -- [-2072.153] (-2086.007) (-2076.097) (-2076.904) * [-2077.876] (-2079.629) (-2089.088) (-2074.062) -- 0:03:23
280200 -- [-2073.142] (-2088.014) (-2075.463) (-2083.620) * (-2082.105) [-2069.660] (-2078.301) (-2080.299) -- 0:03:22
280300 -- (-2075.726) (-2086.561) [-2072.538] (-2081.052) * (-2078.830) (-2073.667) (-2085.090) [-2082.700] -- 0:03:22
280400 -- [-2068.923] (-2085.755) (-2078.727) (-2086.726) * (-2084.046) [-2077.574] (-2078.537) (-2079.055) -- 0:03:22
280500 -- (-2073.471) (-2081.520) [-2076.886] (-2078.861) * (-2078.135) (-2072.783) (-2073.819) [-2081.179] -- 0:03:22
280600 -- [-2077.814] (-2080.957) (-2076.822) (-2076.163) * (-2080.001) (-2074.070) [-2074.215] (-2080.632) -- 0:03:22
280700 -- (-2083.099) (-2082.073) [-2074.653] (-2075.517) * (-2080.910) (-2079.204) (-2078.501) [-2080.787] -- 0:03:22
280800 -- (-2080.333) (-2076.559) (-2071.626) [-2077.796] * (-2085.335) (-2079.972) [-2074.504] (-2079.703) -- 0:03:22
280900 -- (-2077.330) (-2084.899) (-2080.111) [-2076.651] * (-2088.484) (-2084.800) [-2071.250] (-2079.165) -- 0:03:22
281000 -- (-2074.928) (-2080.756) [-2074.604] (-2080.327) * (-2083.230) (-2087.235) [-2076.420] (-2079.417) -- 0:03:22
Average standard deviation of split frequencies: 0.007568
281100 -- [-2072.292] (-2076.026) (-2069.969) (-2083.838) * (-2087.569) (-2076.640) [-2076.695] (-2089.779) -- 0:03:22
281200 -- (-2073.589) (-2082.281) [-2070.867] (-2088.335) * (-2078.148) (-2077.097) [-2072.222] (-2089.973) -- 0:03:21
281300 -- (-2079.333) (-2075.912) [-2076.720] (-2082.660) * (-2083.541) (-2083.211) [-2073.531] (-2083.168) -- 0:03:21
281400 -- [-2077.352] (-2077.191) (-2077.230) (-2081.820) * (-2079.435) (-2075.968) [-2077.482] (-2075.302) -- 0:03:21
281500 -- [-2073.779] (-2083.875) (-2079.350) (-2082.581) * (-2077.475) (-2075.638) [-2073.443] (-2081.741) -- 0:03:21
281600 -- [-2074.353] (-2080.831) (-2083.935) (-2087.623) * (-2081.097) [-2070.173] (-2072.425) (-2083.787) -- 0:03:21
281700 -- [-2073.844] (-2080.007) (-2075.003) (-2082.275) * (-2079.936) [-2068.720] (-2070.195) (-2077.011) -- 0:03:21
281800 -- [-2068.922] (-2095.112) (-2081.640) (-2081.939) * (-2080.408) [-2072.800] (-2074.766) (-2081.279) -- 0:03:21
281900 -- [-2071.358] (-2083.846) (-2071.296) (-2090.040) * (-2082.217) (-2070.011) [-2070.757] (-2080.241) -- 0:03:21
282000 -- [-2070.551] (-2080.377) (-2078.291) (-2092.726) * (-2082.785) (-2084.224) [-2069.783] (-2087.476) -- 0:03:21
Average standard deviation of split frequencies: 0.007829
282100 -- [-2079.584] (-2075.991) (-2083.736) (-2081.552) * [-2081.861] (-2079.735) (-2079.329) (-2080.616) -- 0:03:21
282200 -- (-2079.718) (-2081.310) [-2074.303] (-2077.482) * (-2094.718) (-2079.603) [-2075.464] (-2077.790) -- 0:03:20
282300 -- (-2081.339) (-2083.618) [-2073.779] (-2078.256) * (-2089.097) (-2071.940) [-2070.197] (-2077.805) -- 0:03:20
282400 -- (-2075.385) (-2085.113) [-2076.855] (-2081.974) * (-2094.798) (-2083.867) (-2070.240) [-2078.276] -- 0:03:23
282500 -- [-2072.166] (-2089.174) (-2077.037) (-2083.252) * (-2082.621) (-2076.608) (-2069.998) [-2080.112] -- 0:03:23
282600 -- [-2070.243] (-2084.333) (-2074.764) (-2080.142) * (-2093.363) (-2073.098) [-2072.269] (-2082.207) -- 0:03:23
282700 -- (-2074.414) (-2088.246) [-2076.915] (-2080.282) * (-2081.148) [-2073.508] (-2071.396) (-2085.276) -- 0:03:22
282800 -- (-2074.282) (-2085.483) [-2074.158] (-2080.515) * (-2082.121) [-2073.417] (-2086.504) (-2081.952) -- 0:03:22
282900 -- (-2076.112) (-2090.574) [-2070.454] (-2077.539) * (-2078.065) [-2075.995] (-2083.254) (-2075.866) -- 0:03:22
283000 -- [-2074.672] (-2091.067) (-2071.984) (-2086.159) * [-2075.560] (-2086.193) (-2083.635) (-2081.769) -- 0:03:22
Average standard deviation of split frequencies: 0.008037
283100 -- [-2069.814] (-2089.768) (-2078.204) (-2080.823) * (-2075.241) [-2073.626] (-2079.109) (-2083.730) -- 0:03:22
283200 -- [-2070.146] (-2091.178) (-2079.136) (-2085.318) * (-2072.267) [-2070.299] (-2075.570) (-2079.427) -- 0:03:22
283300 -- [-2073.579] (-2092.982) (-2070.672) (-2081.683) * (-2082.630) (-2077.293) [-2075.543] (-2083.053) -- 0:03:22
283400 -- [-2081.181] (-2078.323) (-2074.846) (-2083.209) * (-2080.789) [-2074.239] (-2069.749) (-2078.814) -- 0:03:22
283500 -- [-2068.419] (-2079.241) (-2078.261) (-2075.410) * (-2079.036) (-2079.327) [-2071.025] (-2079.094) -- 0:03:22
283600 -- [-2072.673] (-2077.269) (-2072.528) (-2078.899) * (-2077.232) (-2076.782) [-2071.373] (-2081.232) -- 0:03:22
283700 -- (-2073.744) (-2082.397) [-2075.768] (-2084.013) * (-2087.629) (-2072.238) [-2069.544] (-2080.803) -- 0:03:21
283800 -- (-2075.174) (-2081.640) [-2068.837] (-2083.504) * (-2078.547) [-2073.120] (-2077.449) (-2085.260) -- 0:03:21
283900 -- (-2097.396) (-2074.963) (-2070.059) [-2077.118] * (-2091.463) (-2072.121) [-2068.166] (-2086.035) -- 0:03:21
284000 -- (-2092.072) (-2080.499) [-2069.341] (-2079.641) * (-2084.283) [-2074.769] (-2069.247) (-2088.517) -- 0:03:21
Average standard deviation of split frequencies: 0.008248
284100 -- (-2088.412) (-2078.231) [-2070.717] (-2082.056) * [-2077.710] (-2079.661) (-2071.475) (-2087.841) -- 0:03:21
284200 -- (-2075.130) (-2077.231) [-2065.365] (-2097.905) * (-2078.822) (-2082.182) [-2071.389] (-2079.721) -- 0:03:21
284300 -- (-2076.050) [-2085.806] (-2072.272) (-2087.312) * (-2078.711) (-2075.798) (-2071.020) [-2074.517] -- 0:03:21
284400 -- [-2071.763] (-2082.198) (-2082.696) (-2081.075) * [-2073.610] (-2074.421) (-2082.948) (-2085.197) -- 0:03:21
284500 -- [-2073.371] (-2090.780) (-2086.150) (-2082.895) * (-2083.480) [-2077.700] (-2068.640) (-2081.257) -- 0:03:21
284600 -- [-2076.513] (-2082.697) (-2079.813) (-2075.016) * (-2078.945) (-2083.031) (-2079.174) [-2081.774] -- 0:03:21
284700 -- (-2072.198) (-2083.880) [-2075.301] (-2086.752) * (-2080.726) [-2076.040] (-2074.116) (-2073.591) -- 0:03:20
284800 -- (-2081.201) (-2089.292) [-2081.076] (-2076.031) * (-2083.944) (-2079.044) [-2070.562] (-2077.217) -- 0:03:20
284900 -- (-2080.926) (-2089.562) [-2070.175] (-2089.197) * (-2077.596) (-2080.820) [-2068.928] (-2076.334) -- 0:03:20
285000 -- (-2073.585) (-2096.974) [-2073.832] (-2082.662) * (-2077.507) (-2072.704) [-2074.189] (-2082.818) -- 0:03:20
Average standard deviation of split frequencies: 0.008264
285100 -- [-2081.347] (-2077.950) (-2080.246) (-2080.070) * (-2082.814) [-2076.113] (-2072.066) (-2086.339) -- 0:03:20
285200 -- (-2080.317) (-2099.713) (-2083.848) [-2081.135] * (-2084.105) [-2069.334] (-2067.549) (-2084.667) -- 0:03:20
285300 -- (-2076.104) (-2084.925) [-2080.112] (-2079.704) * (-2083.254) (-2075.154) (-2076.345) [-2090.088] -- 0:03:20
285400 -- (-2078.648) (-2078.497) (-2079.796) [-2080.184] * (-2081.256) (-2076.769) [-2076.480] (-2077.390) -- 0:03:20
285500 -- [-2076.702] (-2078.006) (-2083.414) (-2086.580) * (-2090.569) [-2074.046] (-2084.547) (-2078.978) -- 0:03:20
285600 -- (-2081.417) [-2077.534] (-2077.955) (-2082.503) * (-2088.995) (-2073.645) [-2079.494] (-2092.313) -- 0:03:20
285700 -- [-2071.114] (-2089.258) (-2075.639) (-2078.947) * (-2083.618) (-2075.116) [-2074.769] (-2085.125) -- 0:03:20
285800 -- (-2073.577) (-2081.613) [-2074.892] (-2079.417) * (-2082.507) [-2073.015] (-2079.874) (-2077.611) -- 0:03:19
285900 -- [-2073.892] (-2079.335) (-2088.236) (-2076.145) * [-2084.545] (-2073.594) (-2094.193) (-2082.792) -- 0:03:22
286000 -- [-2071.224] (-2084.647) (-2082.319) (-2075.241) * (-2086.242) [-2074.314] (-2084.206) (-2075.849) -- 0:03:22
Average standard deviation of split frequencies: 0.008190
286100 -- (-2077.012) (-2077.825) (-2087.178) [-2073.674] * (-2081.888) (-2072.087) [-2077.140] (-2083.901) -- 0:03:22
286200 -- (-2073.597) [-2076.851] (-2077.084) (-2081.736) * (-2087.462) (-2074.629) (-2080.032) [-2088.834] -- 0:03:22
286300 -- (-2086.792) (-2080.861) (-2075.986) [-2077.159] * (-2085.853) (-2072.617) [-2070.653] (-2085.869) -- 0:03:21
286400 -- (-2097.068) (-2080.596) [-2081.503] (-2082.175) * (-2084.829) [-2073.147] (-2073.715) (-2087.996) -- 0:03:21
286500 -- (-2078.964) (-2076.036) [-2074.229] (-2075.597) * (-2080.842) (-2069.941) [-2071.355] (-2087.197) -- 0:03:21
286600 -- (-2080.117) [-2079.188] (-2081.161) (-2084.031) * [-2080.116] (-2073.763) (-2076.981) (-2078.955) -- 0:03:21
286700 -- [-2076.478] (-2079.082) (-2074.796) (-2090.669) * (-2077.284) [-2070.508] (-2075.011) (-2081.723) -- 0:03:21
286800 -- (-2074.608) (-2084.069) [-2074.208] (-2085.710) * (-2084.204) [-2072.658] (-2075.511) (-2074.951) -- 0:03:21
286900 -- (-2075.626) (-2080.639) [-2075.445] (-2082.441) * (-2079.639) (-2084.379) [-2073.221] (-2083.814) -- 0:03:21
287000 -- (-2077.640) (-2083.668) (-2071.904) [-2079.907] * [-2069.252] (-2082.554) (-2075.590) (-2086.149) -- 0:03:21
Average standard deviation of split frequencies: 0.008019
287100 -- (-2083.206) (-2079.801) [-2071.683] (-2079.079) * (-2076.880) (-2073.005) [-2074.485] (-2083.164) -- 0:03:21
287200 -- (-2073.314) (-2085.410) [-2070.884] (-2082.372) * (-2081.482) [-2077.211] (-2080.566) (-2083.189) -- 0:03:21
287300 -- [-2074.544] (-2080.235) (-2080.663) (-2090.519) * (-2078.886) (-2078.170) [-2077.028] (-2083.202) -- 0:03:20
287400 -- (-2075.842) (-2089.300) [-2075.907] (-2089.267) * [-2076.107] (-2077.475) (-2078.132) (-2090.893) -- 0:03:20
287500 -- [-2075.860] (-2088.434) (-2072.549) (-2083.481) * (-2075.377) [-2073.548] (-2076.264) (-2084.726) -- 0:03:20
287600 -- (-2074.620) (-2087.386) [-2076.889] (-2085.833) * (-2087.419) [-2070.895] (-2076.012) (-2077.543) -- 0:03:20
287700 -- [-2077.634] (-2081.724) (-2068.831) (-2081.804) * (-2079.294) [-2072.601] (-2075.668) (-2080.985) -- 0:03:20
287800 -- (-2071.027) (-2083.771) [-2072.094] (-2085.962) * (-2079.047) [-2072.902] (-2072.473) (-2087.619) -- 0:03:20
287900 -- (-2076.917) (-2079.231) [-2074.494] (-2091.362) * [-2075.852] (-2081.779) (-2071.065) (-2083.610) -- 0:03:20
288000 -- [-2075.011] (-2080.855) (-2083.705) (-2080.285) * (-2077.484) (-2075.925) [-2073.976] (-2083.565) -- 0:03:20
Average standard deviation of split frequencies: 0.008601
288100 -- [-2078.883] (-2085.110) (-2077.986) (-2084.671) * (-2079.461) (-2077.530) [-2072.491] (-2077.210) -- 0:03:20
288200 -- (-2082.525) (-2086.084) [-2074.071] (-2088.390) * (-2081.418) (-2077.255) [-2074.202] (-2085.304) -- 0:03:20
288300 -- [-2087.637] (-2083.665) (-2074.765) (-2076.934) * (-2078.263) (-2081.308) [-2071.951] (-2075.181) -- 0:03:19
288400 -- (-2090.324) (-2081.757) [-2076.876] (-2076.993) * [-2077.089] (-2092.428) (-2074.475) (-2076.548) -- 0:03:19
288500 -- (-2092.977) (-2078.732) [-2075.024] (-2076.176) * [-2074.144] (-2086.362) (-2069.557) (-2088.299) -- 0:03:19
288600 -- (-2085.010) (-2077.842) (-2081.459) [-2075.853] * (-2081.177) (-2077.017) [-2069.697] (-2079.880) -- 0:03:19
288700 -- (-2072.869) (-2076.581) (-2085.157) [-2077.698] * (-2087.622) (-2084.659) [-2066.748] (-2079.926) -- 0:03:19
288800 -- (-2080.415) (-2079.195) (-2095.838) [-2073.477] * (-2082.625) (-2096.714) [-2070.662] (-2079.824) -- 0:03:19
288900 -- (-2076.045) (-2080.494) (-2077.179) [-2077.566] * (-2080.671) (-2097.877) [-2067.550] (-2077.924) -- 0:03:19
289000 -- [-2070.418] (-2086.219) (-2079.982) (-2082.581) * (-2084.914) (-2094.564) (-2069.335) [-2073.803] -- 0:03:19
Average standard deviation of split frequencies: 0.008430
289100 -- (-2073.400) [-2078.305] (-2078.281) (-2082.432) * (-2082.775) (-2093.319) [-2074.163] (-2074.006) -- 0:03:19
289200 -- [-2072.034] (-2076.249) (-2085.291) (-2084.032) * (-2080.041) (-2099.280) [-2074.162] (-2080.280) -- 0:03:19
289300 -- (-2075.602) (-2088.380) (-2075.500) [-2076.222] * (-2085.812) (-2083.153) [-2073.943] (-2077.546) -- 0:03:18
289400 -- [-2077.041] (-2087.296) (-2077.064) (-2080.774) * (-2086.756) (-2085.466) [-2072.075] (-2086.094) -- 0:03:18
289500 -- [-2080.914] (-2084.826) (-2085.541) (-2075.150) * (-2089.120) [-2079.325] (-2071.444) (-2092.417) -- 0:03:21
289600 -- (-2077.409) [-2084.511] (-2077.283) (-2083.728) * (-2078.083) (-2081.764) [-2071.624] (-2084.380) -- 0:03:21
289700 -- (-2083.400) (-2085.270) [-2071.801] (-2081.152) * [-2077.635] (-2081.765) (-2072.762) (-2078.314) -- 0:03:21
289800 -- (-2080.948) (-2083.394) [-2074.937] (-2081.875) * (-2076.325) (-2083.319) [-2073.970] (-2089.665) -- 0:03:20
289900 -- (-2076.033) (-2082.478) [-2077.468] (-2078.150) * (-2075.508) (-2081.898) [-2074.389] (-2084.658) -- 0:03:20
290000 -- (-2082.066) (-2083.286) (-2079.158) [-2073.246] * (-2076.530) (-2090.808) [-2078.439] (-2083.607) -- 0:03:20
Average standard deviation of split frequencies: 0.008356
290100 -- (-2084.976) (-2093.988) (-2074.457) [-2069.722] * (-2080.481) (-2083.325) [-2074.393] (-2088.277) -- 0:03:20
290200 -- (-2080.262) (-2088.239) (-2082.523) [-2069.267] * (-2083.177) (-2083.460) [-2079.059] (-2088.361) -- 0:03:20
290300 -- (-2083.124) (-2094.931) [-2076.376] (-2073.455) * (-2084.566) (-2079.200) [-2077.231] (-2086.668) -- 0:03:20
290400 -- (-2088.035) (-2090.050) [-2069.341] (-2075.319) * [-2080.274] (-2089.993) (-2085.731) (-2098.239) -- 0:03:20
290500 -- (-2090.306) (-2082.001) [-2072.372] (-2083.573) * (-2077.851) (-2088.777) [-2072.783] (-2091.258) -- 0:03:20
290600 -- (-2082.533) (-2080.131) (-2076.214) [-2075.858] * (-2086.365) (-2081.486) [-2071.810] (-2082.113) -- 0:03:20
290700 -- (-2075.197) [-2075.505] (-2075.420) (-2074.826) * (-2081.936) [-2078.560] (-2075.363) (-2084.805) -- 0:03:20
290800 -- (-2079.577) (-2075.247) (-2074.840) [-2076.019] * (-2079.144) (-2085.078) [-2077.733] (-2082.679) -- 0:03:19
290900 -- (-2071.049) (-2078.540) (-2085.394) [-2073.793] * (-2076.733) (-2081.809) [-2069.244] (-2079.238) -- 0:03:19
291000 -- (-2073.754) (-2083.164) [-2072.887] (-2072.466) * (-2081.935) (-2081.108) [-2074.459] (-2080.387) -- 0:03:19
Average standard deviation of split frequencies: 0.008695
291100 -- (-2070.399) (-2075.067) [-2074.220] (-2078.065) * (-2079.232) [-2073.710] (-2078.641) (-2079.846) -- 0:03:19
291200 -- (-2069.551) [-2076.811] (-2074.949) (-2075.384) * (-2081.231) (-2068.309) [-2067.090] (-2083.100) -- 0:03:19
291300 -- [-2073.550] (-2081.940) (-2081.229) (-2069.348) * (-2077.227) (-2074.208) (-2079.466) [-2076.481] -- 0:03:19
291400 -- [-2076.558] (-2082.831) (-2079.792) (-2072.349) * (-2089.453) (-2075.051) (-2084.099) [-2074.671] -- 0:03:19
291500 -- (-2076.298) [-2081.230] (-2073.947) (-2076.984) * (-2081.772) [-2066.585] (-2083.571) (-2079.123) -- 0:03:19
291600 -- [-2076.121] (-2081.360) (-2075.302) (-2082.918) * (-2088.736) [-2074.096] (-2080.286) (-2079.216) -- 0:03:19
291700 -- (-2079.590) (-2075.561) [-2080.776] (-2078.744) * (-2086.750) (-2086.960) [-2068.795] (-2075.685) -- 0:03:19
291800 -- (-2077.606) (-2082.477) (-2076.493) [-2073.465] * (-2079.946) (-2073.660) [-2069.642] (-2078.989) -- 0:03:19
291900 -- (-2078.585) (-2077.697) (-2078.437) [-2072.983] * (-2078.319) [-2074.811] (-2067.140) (-2088.458) -- 0:03:18
292000 -- (-2081.832) (-2071.898) (-2078.502) [-2069.753] * (-2077.470) (-2091.314) [-2070.648] (-2080.408) -- 0:03:18
Average standard deviation of split frequencies: 0.008622
292100 -- (-2082.903) [-2073.793] (-2079.362) (-2077.364) * (-2084.538) (-2071.982) [-2074.407] (-2078.304) -- 0:03:18
292200 -- (-2080.447) [-2074.355] (-2090.666) (-2078.172) * (-2073.706) [-2083.174] (-2080.245) (-2078.294) -- 0:03:18
292300 -- (-2079.651) [-2074.065] (-2086.167) (-2077.922) * (-2074.203) (-2081.912) (-2083.522) [-2076.314] -- 0:03:18
292400 -- (-2072.598) (-2074.664) (-2081.737) [-2074.816] * (-2076.264) (-2083.552) (-2083.267) [-2079.757] -- 0:03:18
292500 -- (-2077.123) (-2074.772) (-2081.874) [-2074.205] * (-2081.049) [-2079.671] (-2076.064) (-2084.023) -- 0:03:18
292600 -- (-2074.200) [-2083.903] (-2073.461) (-2080.959) * (-2075.397) [-2074.802] (-2075.246) (-2079.028) -- 0:03:18
292700 -- [-2076.930] (-2084.999) (-2086.451) (-2081.799) * (-2081.336) [-2074.605] (-2077.562) (-2080.680) -- 0:03:18
292800 -- (-2084.427) (-2080.733) (-2081.670) [-2070.499] * (-2088.264) [-2067.492] (-2075.683) (-2080.083) -- 0:03:18
292900 -- (-2085.457) (-2075.019) [-2082.365] (-2080.127) * (-2088.086) (-2068.090) (-2081.281) [-2085.274] -- 0:03:17
293000 -- (-2078.590) (-2082.997) (-2085.623) [-2083.896] * (-2084.168) [-2072.354] (-2083.391) (-2079.216) -- 0:03:20
Average standard deviation of split frequencies: 0.008406
293100 -- (-2081.147) [-2085.380] (-2084.261) (-2083.700) * (-2082.384) [-2071.763] (-2081.670) (-2074.552) -- 0:03:20
293200 -- (-2074.300) (-2089.892) (-2081.068) [-2084.106] * (-2082.635) [-2069.875] (-2080.849) (-2084.890) -- 0:03:20
293300 -- [-2073.700] (-2089.645) (-2088.826) (-2073.322) * (-2079.802) [-2067.176] (-2081.068) (-2085.035) -- 0:03:19
293400 -- (-2074.221) (-2079.787) (-2086.807) [-2074.703] * (-2078.518) [-2068.844] (-2083.548) (-2077.247) -- 0:03:19
293500 -- (-2072.108) [-2078.752] (-2082.565) (-2083.207) * (-2080.322) [-2081.164] (-2086.199) (-2079.155) -- 0:03:19
293600 -- (-2075.353) (-2083.368) (-2085.930) [-2084.079] * (-2083.973) [-2076.669] (-2079.077) (-2076.377) -- 0:03:19
293700 -- [-2071.334] (-2080.767) (-2087.691) (-2072.119) * (-2085.232) [-2074.266] (-2080.601) (-2075.743) -- 0:03:19
293800 -- [-2072.112] (-2094.057) (-2077.867) (-2074.518) * (-2085.051) (-2073.013) (-2077.613) [-2074.386] -- 0:03:19
293900 -- (-2075.161) (-2089.105) [-2080.206] (-2072.871) * (-2089.205) (-2068.328) [-2073.830] (-2075.152) -- 0:03:19
294000 -- [-2078.592] (-2087.512) (-2080.985) (-2078.630) * (-2084.385) [-2071.655] (-2084.655) (-2075.470) -- 0:03:19
Average standard deviation of split frequencies: 0.008700
294100 -- (-2077.081) (-2091.278) [-2077.793] (-2075.812) * (-2095.734) [-2069.136] (-2079.521) (-2088.262) -- 0:03:19
294200 -- [-2078.979] (-2083.456) (-2082.388) (-2073.259) * (-2081.727) [-2072.457] (-2083.981) (-2089.734) -- 0:03:19
294300 -- [-2071.007] (-2085.761) (-2085.907) (-2074.993) * (-2079.342) [-2068.427] (-2075.005) (-2078.237) -- 0:03:19
294400 -- [-2075.515] (-2084.496) (-2080.244) (-2079.380) * (-2083.431) (-2066.475) [-2072.404] (-2080.135) -- 0:03:18
294500 -- [-2074.786] (-2085.766) (-2076.998) (-2072.005) * (-2079.127) [-2069.790] (-2071.236) (-2085.434) -- 0:03:18
294600 -- (-2069.705) (-2085.906) [-2079.069] (-2074.803) * (-2085.841) (-2076.236) [-2070.021] (-2082.844) -- 0:03:18
294700 -- [-2071.745] (-2083.710) (-2090.507) (-2073.262) * (-2089.477) [-2076.304] (-2070.988) (-2077.609) -- 0:03:18
294800 -- (-2073.223) (-2097.439) (-2085.553) [-2069.778] * [-2081.244] (-2072.449) (-2074.039) (-2084.905) -- 0:03:18
294900 -- (-2073.431) (-2081.107) (-2078.381) [-2071.111] * (-2082.252) (-2073.358) [-2072.977] (-2085.332) -- 0:03:18
295000 -- (-2082.307) [-2085.174] (-2077.911) (-2071.768) * [-2086.211] (-2073.508) (-2078.041) (-2082.223) -- 0:03:18
Average standard deviation of split frequencies: 0.008532
295100 -- (-2087.704) [-2081.243] (-2086.460) (-2071.677) * [-2076.847] (-2071.480) (-2077.239) (-2084.790) -- 0:03:18
295200 -- (-2078.165) (-2087.774) (-2083.413) [-2071.108] * (-2083.877) (-2072.480) [-2072.310] (-2078.115) -- 0:03:18
295300 -- (-2077.415) (-2084.649) [-2080.428] (-2080.822) * (-2085.754) (-2072.618) [-2073.269] (-2081.272) -- 0:03:18
295400 -- (-2078.406) (-2080.806) (-2080.077) [-2073.931] * (-2086.067) (-2078.529) [-2073.094] (-2078.017) -- 0:03:17
295500 -- (-2084.339) (-2077.029) (-2081.851) [-2076.385] * (-2083.539) (-2083.741) [-2073.186] (-2081.704) -- 0:03:17
295600 -- (-2077.478) (-2072.472) (-2084.873) [-2069.942] * (-2073.717) (-2068.452) [-2072.833] (-2077.851) -- 0:03:17
295700 -- (-2079.745) (-2079.561) (-2081.227) [-2075.357] * (-2078.074) (-2078.060) (-2079.665) [-2076.392] -- 0:03:17
295800 -- (-2086.695) [-2078.063] (-2072.820) (-2073.647) * (-2078.125) (-2078.689) (-2085.585) [-2078.459] -- 0:03:17
295900 -- (-2089.728) (-2079.398) (-2075.667) [-2072.451] * (-2078.598) [-2072.179] (-2084.881) (-2076.028) -- 0:03:17
296000 -- (-2091.179) (-2084.175) (-2078.241) [-2070.305] * [-2083.477] (-2082.639) (-2085.235) (-2078.812) -- 0:03:17
Average standard deviation of split frequencies: 0.008096
296100 -- [-2081.669] (-2087.893) (-2078.731) (-2073.847) * (-2076.627) (-2075.085) (-2075.322) [-2082.866] -- 0:03:17
296200 -- (-2076.013) (-2081.203) (-2082.579) [-2071.592] * [-2077.538] (-2074.155) (-2083.052) (-2082.361) -- 0:03:17
296300 -- (-2074.243) (-2081.970) (-2086.758) [-2072.419] * (-2074.954) (-2072.968) (-2080.628) [-2078.467] -- 0:03:17
296400 -- (-2084.440) (-2078.192) (-2084.283) [-2071.335] * [-2074.594] (-2073.662) (-2074.490) (-2078.951) -- 0:03:17
296500 -- (-2080.625) (-2081.217) (-2094.079) [-2067.957] * (-2077.369) [-2071.093] (-2079.148) (-2085.791) -- 0:03:16
296600 -- (-2077.064) [-2076.471] (-2087.548) (-2075.377) * (-2078.201) (-2071.822) [-2074.945] (-2082.463) -- 0:03:19
296700 -- [-2070.561] (-2079.938) (-2087.158) (-2075.780) * (-2088.149) [-2068.831] (-2075.632) (-2085.732) -- 0:03:19
296800 -- (-2073.125) (-2081.815) (-2086.476) [-2073.906] * (-2078.381) (-2077.018) (-2077.845) [-2078.171] -- 0:03:19
296900 -- [-2072.395] (-2083.980) (-2094.789) (-2077.111) * (-2077.877) [-2070.428] (-2081.073) (-2074.750) -- 0:03:18
297000 -- [-2074.811] (-2075.845) (-2099.044) (-2069.300) * (-2084.878) [-2072.351] (-2093.805) (-2078.047) -- 0:03:18
Average standard deviation of split frequencies: 0.008475
297100 -- (-2078.370) (-2082.405) (-2094.796) [-2070.895] * [-2076.071] (-2074.889) (-2078.348) (-2075.912) -- 0:03:18
297200 -- (-2079.394) (-2084.163) (-2099.187) [-2069.277] * [-2076.151] (-2077.067) (-2095.951) (-2077.613) -- 0:03:18
297300 -- (-2083.684) [-2086.090] (-2093.371) (-2071.858) * (-2086.048) (-2077.366) (-2088.742) [-2082.129] -- 0:03:18
297400 -- (-2083.037) (-2080.052) (-2093.126) [-2071.036] * (-2083.147) (-2073.396) (-2085.241) [-2076.763] -- 0:03:18
297500 -- (-2081.076) (-2085.448) (-2094.207) [-2069.247] * (-2085.396) [-2075.489] (-2084.614) (-2079.031) -- 0:03:18
297600 -- (-2082.097) [-2083.817] (-2102.090) (-2076.507) * (-2075.470) [-2070.191] (-2080.838) (-2084.951) -- 0:03:18
297700 -- [-2078.575] (-2081.373) (-2097.877) (-2079.575) * (-2084.275) [-2070.037] (-2076.582) (-2076.995) -- 0:03:18
297800 -- [-2074.630] (-2085.078) (-2108.479) (-2077.745) * (-2090.133) (-2074.437) [-2078.865] (-2082.776) -- 0:03:18
297900 -- [-2075.733] (-2078.575) (-2104.613) (-2082.349) * (-2078.174) (-2076.100) (-2076.349) [-2078.578] -- 0:03:17
298000 -- [-2076.148] (-2082.523) (-2107.284) (-2076.588) * (-2080.817) [-2074.806] (-2077.769) (-2077.727) -- 0:03:17
Average standard deviation of split frequencies: 0.008358
298100 -- (-2086.946) (-2086.040) (-2110.072) [-2079.781] * (-2076.236) (-2075.137) (-2079.879) [-2077.275] -- 0:03:17
298200 -- (-2087.055) (-2086.398) (-2100.458) [-2075.827] * (-2083.165) [-2073.547] (-2075.587) (-2073.895) -- 0:03:17
298300 -- (-2084.188) (-2077.821) (-2091.886) [-2075.293] * (-2081.521) [-2074.189] (-2074.171) (-2082.971) -- 0:03:17
298400 -- (-2078.051) (-2084.690) (-2094.247) [-2075.296] * [-2077.804] (-2081.121) (-2076.820) (-2078.777) -- 0:03:17
298500 -- [-2073.775] (-2080.888) (-2088.154) (-2071.643) * (-2078.754) (-2075.268) [-2080.234] (-2076.691) -- 0:03:17
298600 -- [-2072.867] (-2080.488) (-2085.779) (-2073.490) * (-2079.467) [-2074.600] (-2083.919) (-2091.323) -- 0:03:17
298700 -- [-2076.280] (-2079.162) (-2084.089) (-2077.198) * (-2075.330) (-2083.006) [-2074.229] (-2083.687) -- 0:03:17
298800 -- [-2074.166] (-2083.245) (-2079.509) (-2084.839) * (-2075.533) [-2077.266] (-2077.316) (-2085.121) -- 0:03:17
298900 -- [-2075.612] (-2083.638) (-2080.499) (-2082.969) * (-2077.582) [-2074.290] (-2080.982) (-2086.342) -- 0:03:17
299000 -- (-2076.215) [-2079.209] (-2081.740) (-2082.968) * (-2080.798) (-2075.721) [-2074.295] (-2080.399) -- 0:03:16
Average standard deviation of split frequencies: 0.008418
299100 -- [-2072.911] (-2076.255) (-2079.411) (-2085.058) * (-2074.432) (-2081.219) [-2072.195] (-2082.144) -- 0:03:16
299200 -- (-2073.653) [-2080.867] (-2090.046) (-2088.094) * (-2077.389) [-2080.575] (-2077.865) (-2084.418) -- 0:03:16
299300 -- (-2077.215) [-2078.137] (-2087.969) (-2085.643) * (-2074.857) (-2079.939) [-2077.676] (-2085.911) -- 0:03:16
299400 -- [-2070.855] (-2079.824) (-2077.200) (-2083.603) * (-2076.853) [-2079.727] (-2075.622) (-2091.171) -- 0:03:16
299500 -- (-2080.447) (-2082.174) (-2079.958) [-2074.964] * [-2073.566] (-2077.080) (-2074.679) (-2081.931) -- 0:03:16
299600 -- (-2077.594) (-2095.701) [-2074.044] (-2075.472) * (-2074.690) (-2076.278) (-2075.786) [-2079.774] -- 0:03:16
299700 -- [-2075.644] (-2095.261) (-2084.376) (-2085.737) * (-2074.360) (-2071.911) [-2073.513] (-2085.620) -- 0:03:16
299800 -- (-2082.140) (-2090.809) (-2079.571) [-2068.404] * (-2078.044) [-2071.348] (-2077.578) (-2082.367) -- 0:03:16
299900 -- (-2076.731) (-2091.413) (-2078.191) [-2072.791] * (-2076.999) [-2073.794] (-2091.917) (-2079.067) -- 0:03:16
300000 -- (-2085.061) (-2096.448) (-2076.245) [-2071.485] * (-2080.817) [-2072.688] (-2086.641) (-2073.435) -- 0:03:15
Average standard deviation of split frequencies: 0.007943
300100 -- [-2074.742] (-2091.376) (-2090.108) (-2075.062) * (-2084.490) [-2070.255] (-2077.632) (-2076.712) -- 0:03:18
300200 -- (-2078.446) (-2088.871) (-2086.492) [-2073.380] * (-2087.568) [-2075.195] (-2075.328) (-2085.004) -- 0:03:18
300300 -- [-2071.892] (-2080.919) (-2078.357) (-2074.451) * (-2082.027) [-2073.194] (-2075.356) (-2084.298) -- 0:03:18
300400 -- [-2074.124] (-2081.238) (-2080.713) (-2073.044) * (-2076.291) [-2081.237] (-2074.453) (-2081.509) -- 0:03:17
300500 -- (-2071.608) (-2089.219) (-2076.650) [-2075.715] * (-2079.714) (-2075.051) (-2076.303) [-2075.420] -- 0:03:17
300600 -- (-2079.808) (-2084.578) (-2078.902) [-2080.439] * (-2082.144) (-2081.872) [-2078.945] (-2078.056) -- 0:03:17
300700 -- [-2069.511] (-2094.270) (-2079.996) (-2085.792) * (-2085.659) [-2085.953] (-2079.173) (-2088.573) -- 0:03:17
300800 -- [-2073.756] (-2080.997) (-2084.425) (-2080.809) * (-2081.773) (-2087.386) [-2077.288] (-2082.605) -- 0:03:17
300900 -- (-2070.428) (-2079.367) (-2086.389) [-2077.013] * (-2083.887) [-2077.564] (-2081.645) (-2079.606) -- 0:03:17
301000 -- [-2075.149] (-2080.686) (-2087.592) (-2081.158) * (-2084.799) (-2076.691) (-2080.608) [-2076.979] -- 0:03:17
Average standard deviation of split frequencies: 0.007870
301100 -- (-2072.541) (-2081.974) (-2093.576) [-2080.217] * (-2083.285) (-2082.298) [-2078.506] (-2078.108) -- 0:03:17
301200 -- [-2072.354] (-2084.731) (-2084.783) (-2072.045) * (-2082.303) [-2082.147] (-2088.269) (-2082.207) -- 0:03:17
301300 -- (-2083.000) [-2074.936] (-2090.427) (-2071.037) * (-2088.795) [-2072.904] (-2081.753) (-2088.607) -- 0:03:17
301400 -- [-2075.915] (-2077.154) (-2082.154) (-2070.640) * (-2091.905) [-2075.128] (-2088.974) (-2080.345) -- 0:03:17
301500 -- (-2077.978) [-2075.785] (-2085.329) (-2076.118) * (-2084.161) [-2073.454] (-2075.586) (-2085.322) -- 0:03:16
301600 -- [-2081.637] (-2082.043) (-2082.897) (-2071.091) * (-2088.945) [-2070.182] (-2079.035) (-2082.194) -- 0:03:16
301700 -- [-2078.340] (-2082.843) (-2079.292) (-2069.180) * (-2083.655) [-2066.798] (-2074.447) (-2082.923) -- 0:03:16
301800 -- [-2074.203] (-2078.505) (-2083.685) (-2071.829) * (-2088.181) (-2072.392) [-2080.479] (-2077.830) -- 0:03:16
301900 -- (-2077.142) (-2083.851) (-2089.188) [-2065.969] * (-2092.531) [-2070.792] (-2087.532) (-2074.714) -- 0:03:16
302000 -- (-2078.896) (-2085.051) (-2083.908) [-2068.992] * (-2094.671) (-2075.056) (-2081.761) [-2074.590] -- 0:03:16
Average standard deviation of split frequencies: 0.008024
302100 -- (-2078.274) (-2074.236) (-2082.299) [-2068.307] * (-2084.990) [-2072.030] (-2085.302) (-2077.306) -- 0:03:16
302200 -- (-2072.451) (-2077.667) [-2090.222] (-2078.483) * (-2089.306) [-2068.962] (-2082.290) (-2075.217) -- 0:03:16
302300 -- [-2069.872] (-2075.896) (-2086.521) (-2081.741) * (-2084.559) [-2071.378] (-2082.497) (-2079.359) -- 0:03:16
302400 -- [-2070.020] (-2074.491) (-2079.695) (-2089.655) * (-2083.823) [-2070.729] (-2077.154) (-2094.861) -- 0:03:16
302500 -- [-2072.590] (-2079.887) (-2079.327) (-2090.169) * (-2085.904) (-2079.054) [-2081.342] (-2098.242) -- 0:03:15
302600 -- [-2068.586] (-2076.513) (-2075.151) (-2090.448) * (-2085.090) [-2072.753] (-2081.719) (-2086.607) -- 0:03:15
302700 -- (-2073.773) (-2079.235) [-2074.352] (-2083.343) * (-2081.049) [-2070.169] (-2086.842) (-2085.246) -- 0:03:15
302800 -- (-2079.810) (-2086.169) [-2075.388] (-2093.173) * (-2073.156) [-2071.405] (-2087.569) (-2088.374) -- 0:03:15
302900 -- [-2079.318] (-2084.727) (-2079.089) (-2096.578) * (-2075.956) [-2073.172] (-2078.981) (-2083.034) -- 0:03:15
303000 -- [-2080.190] (-2087.783) (-2079.465) (-2097.080) * [-2077.644] (-2075.086) (-2086.183) (-2086.299) -- 0:03:15
Average standard deviation of split frequencies: 0.008085
303100 -- (-2075.905) (-2084.272) [-2082.747] (-2093.018) * (-2082.441) [-2072.922] (-2082.456) (-2086.833) -- 0:03:15
303200 -- [-2077.809] (-2083.552) (-2076.127) (-2077.993) * (-2076.590) [-2072.696] (-2096.090) (-2092.057) -- 0:03:15
303300 -- (-2079.365) [-2087.070] (-2084.117) (-2080.624) * (-2077.986) [-2070.163] (-2087.878) (-2085.756) -- 0:03:15
303400 -- [-2077.839] (-2076.993) (-2087.135) (-2078.448) * (-2083.426) [-2071.390] (-2073.133) (-2083.851) -- 0:03:15
303500 -- (-2080.024) (-2077.061) (-2081.262) [-2079.259] * (-2078.361) (-2073.551) (-2080.541) [-2085.505] -- 0:03:15
303600 -- [-2078.955] (-2085.403) (-2082.218) (-2083.381) * (-2088.406) [-2074.231] (-2087.102) (-2083.609) -- 0:03:17
303700 -- (-2082.674) [-2074.189] (-2084.586) (-2087.585) * (-2078.297) [-2071.236] (-2083.286) (-2080.832) -- 0:03:17
303800 -- (-2076.738) [-2076.053] (-2082.405) (-2084.119) * (-2084.532) (-2074.773) [-2071.595] (-2079.319) -- 0:03:17
303900 -- (-2078.660) [-2082.904] (-2083.075) (-2087.467) * (-2083.711) [-2072.594] (-2077.296) (-2089.260) -- 0:03:16
304000 -- [-2076.940] (-2079.040) (-2090.528) (-2077.488) * (-2081.374) [-2071.983] (-2076.346) (-2083.951) -- 0:03:16
Average standard deviation of split frequencies: 0.007883
304100 -- [-2071.853] (-2084.983) (-2084.800) (-2097.173) * (-2077.619) [-2070.572] (-2070.687) (-2077.238) -- 0:03:16
304200 -- [-2070.873] (-2083.122) (-2074.565) (-2096.695) * (-2078.124) (-2077.076) (-2073.487) [-2075.352] -- 0:03:16
304300 -- (-2076.525) [-2079.546] (-2087.587) (-2089.856) * (-2079.455) (-2075.187) [-2070.172] (-2073.801) -- 0:03:16
304400 -- [-2077.198] (-2075.923) (-2088.977) (-2085.791) * (-2082.063) [-2073.612] (-2068.267) (-2079.863) -- 0:03:16
304500 -- [-2077.008] (-2075.665) (-2080.870) (-2083.941) * (-2075.686) (-2072.088) [-2070.881] (-2083.255) -- 0:03:16
304600 -- [-2070.392] (-2073.604) (-2077.584) (-2077.083) * (-2080.958) (-2069.116) [-2073.257] (-2079.493) -- 0:03:16
304700 -- (-2070.970) (-2074.771) [-2076.713] (-2092.036) * [-2077.333] (-2081.404) (-2076.223) (-2083.478) -- 0:03:16
304800 -- (-2075.452) (-2076.268) [-2074.400] (-2084.419) * (-2083.047) (-2081.199) (-2073.267) [-2080.818] -- 0:03:16
304900 -- (-2075.451) (-2079.437) [-2077.107] (-2081.283) * (-2077.053) (-2071.481) [-2070.555] (-2078.940) -- 0:03:16
305000 -- (-2083.965) [-2072.362] (-2079.548) (-2081.204) * (-2071.632) [-2068.042] (-2066.888) (-2082.151) -- 0:03:15
Average standard deviation of split frequencies: 0.007635
305100 -- (-2079.575) [-2070.214] (-2080.359) (-2088.877) * (-2071.011) [-2068.796] (-2074.797) (-2084.361) -- 0:03:15
305200 -- (-2083.134) (-2078.208) [-2078.351] (-2085.143) * [-2068.979] (-2079.947) (-2074.463) (-2076.934) -- 0:03:15
305300 -- (-2077.394) [-2081.382] (-2078.690) (-2080.024) * [-2071.620] (-2069.078) (-2073.566) (-2081.762) -- 0:03:15
305400 -- (-2072.818) (-2087.727) [-2073.507] (-2076.223) * [-2073.546] (-2074.114) (-2077.568) (-2075.958) -- 0:03:15
305500 -- [-2073.550] (-2084.691) (-2070.725) (-2075.494) * (-2071.906) (-2074.251) [-2067.589] (-2081.065) -- 0:03:15
305600 -- (-2078.970) (-2072.101) [-2073.273] (-2089.952) * (-2076.115) (-2074.279) [-2070.479] (-2084.642) -- 0:03:15
305700 -- (-2077.432) [-2069.261] (-2078.358) (-2075.485) * (-2081.257) [-2074.633] (-2075.506) (-2087.926) -- 0:03:15
305800 -- (-2080.773) [-2068.379] (-2077.768) (-2071.426) * (-2075.311) [-2070.782] (-2079.060) (-2083.515) -- 0:03:15
305900 -- (-2080.668) (-2068.271) (-2089.531) [-2073.811] * (-2072.639) (-2073.787) [-2076.299] (-2081.048) -- 0:03:15
306000 -- (-2082.100) (-2075.109) (-2082.488) [-2073.168] * (-2071.161) (-2071.029) (-2073.374) [-2079.601] -- 0:03:15
Average standard deviation of split frequencies: 0.007523
306100 -- (-2078.695) [-2066.733] (-2075.306) (-2073.385) * [-2075.865] (-2074.393) (-2088.937) (-2081.949) -- 0:03:14
306200 -- (-2077.321) [-2074.766] (-2077.734) (-2082.952) * (-2077.265) [-2073.242] (-2080.643) (-2088.662) -- 0:03:14
306300 -- (-2068.969) [-2067.654] (-2077.379) (-2078.573) * (-2081.742) [-2076.064] (-2077.261) (-2088.115) -- 0:03:14
306400 -- (-2067.921) [-2072.155] (-2080.586) (-2078.333) * (-2078.209) (-2070.674) [-2072.620] (-2083.228) -- 0:03:14
306500 -- (-2069.613) [-2076.633] (-2084.285) (-2073.734) * (-2078.241) (-2075.173) (-2093.496) [-2074.436] -- 0:03:14
306600 -- (-2078.695) [-2077.796] (-2079.552) (-2077.908) * (-2079.981) [-2071.705] (-2091.025) (-2080.164) -- 0:03:14
306700 -- [-2071.914] (-2074.650) (-2085.140) (-2081.443) * (-2079.262) (-2073.422) (-2080.865) [-2075.638] -- 0:03:14
306800 -- [-2068.300] (-2073.999) (-2082.765) (-2073.903) * (-2081.243) [-2071.734] (-2078.760) (-2076.427) -- 0:03:16
306900 -- (-2072.455) [-2071.067] (-2088.635) (-2076.376) * (-2077.552) [-2073.046] (-2095.815) (-2073.198) -- 0:03:16
307000 -- (-2074.759) [-2070.252] (-2089.498) (-2075.704) * (-2086.136) (-2083.618) (-2086.721) [-2075.886] -- 0:03:16
Average standard deviation of split frequencies: 0.007673
307100 -- (-2078.315) [-2079.213] (-2090.150) (-2075.912) * (-2084.773) (-2083.101) [-2088.946] (-2075.034) -- 0:03:16
307200 -- (-2073.365) [-2072.029] (-2092.327) (-2076.932) * [-2078.178] (-2078.759) (-2079.043) (-2078.396) -- 0:03:16
307300 -- (-2086.853) (-2075.064) (-2085.770) [-2078.671] * (-2072.726) (-2091.453) [-2073.360] (-2078.229) -- 0:03:16
307400 -- (-2080.721) [-2070.483] (-2081.745) (-2082.492) * (-2076.977) (-2083.211) [-2068.988] (-2081.998) -- 0:03:16
307500 -- (-2079.829) (-2081.127) [-2076.168] (-2089.416) * (-2070.603) (-2075.298) [-2069.976] (-2084.222) -- 0:03:15
307600 -- (-2083.316) [-2074.635] (-2073.428) (-2090.675) * (-2075.962) (-2082.731) [-2068.007] (-2082.543) -- 0:03:15
307700 -- (-2080.015) [-2069.850] (-2078.834) (-2081.265) * (-2073.529) (-2083.242) [-2067.484] (-2076.909) -- 0:03:15
307800 -- (-2084.427) [-2068.629] (-2072.724) (-2089.857) * (-2080.970) (-2080.696) (-2073.682) [-2080.251] -- 0:03:15
307900 -- (-2085.340) [-2069.007] (-2073.587) (-2093.898) * [-2070.096] (-2079.785) (-2074.745) (-2083.216) -- 0:03:15
308000 -- [-2081.557] (-2077.930) (-2073.544) (-2091.091) * (-2072.359) (-2081.083) [-2073.503] (-2086.406) -- 0:03:15
Average standard deviation of split frequencies: 0.007606
308100 -- (-2080.173) [-2075.505] (-2072.913) (-2087.350) * (-2081.391) (-2078.696) [-2071.686] (-2087.416) -- 0:03:15
308200 -- [-2070.383] (-2077.344) (-2071.335) (-2081.987) * [-2067.165] (-2078.452) (-2074.875) (-2089.379) -- 0:03:15
308300 -- [-2068.887] (-2079.658) (-2078.528) (-2074.909) * [-2067.104] (-2080.754) (-2070.487) (-2088.605) -- 0:03:15
308400 -- (-2076.374) (-2078.930) [-2080.197] (-2078.591) * [-2070.373] (-2099.031) (-2079.459) (-2085.493) -- 0:03:15
308500 -- (-2076.467) [-2073.951] (-2084.054) (-2069.811) * [-2071.997] (-2075.834) (-2073.517) (-2079.374) -- 0:03:15
308600 -- (-2075.334) (-2074.017) (-2082.332) [-2068.206] * [-2068.981] (-2080.503) (-2070.281) (-2077.935) -- 0:03:14
308700 -- (-2073.910) [-2074.598] (-2078.075) (-2070.606) * (-2069.092) (-2075.366) (-2072.454) [-2078.533] -- 0:03:14
308800 -- (-2073.440) (-2077.956) (-2081.762) [-2065.895] * (-2076.234) (-2076.680) [-2074.037] (-2087.082) -- 0:03:14
308900 -- [-2071.826] (-2075.743) (-2093.417) (-2069.938) * [-2073.362] (-2079.331) (-2081.634) (-2079.300) -- 0:03:14
309000 -- [-2076.964] (-2069.920) (-2082.054) (-2075.362) * (-2070.606) [-2076.582] (-2079.153) (-2080.723) -- 0:03:14
Average standard deviation of split frequencies: 0.007754
309100 -- (-2084.054) (-2069.262) (-2075.027) [-2071.809] * (-2080.341) [-2076.832] (-2078.697) (-2086.803) -- 0:03:14
309200 -- (-2080.019) (-2072.326) [-2072.186] (-2078.085) * [-2073.695] (-2074.121) (-2077.427) (-2096.450) -- 0:03:14
309300 -- (-2080.789) [-2070.756] (-2069.779) (-2077.007) * (-2085.341) [-2079.981] (-2078.715) (-2097.262) -- 0:03:14
309400 -- [-2075.197] (-2079.754) (-2073.088) (-2072.746) * (-2078.557) (-2088.268) [-2070.346] (-2088.795) -- 0:03:14
309500 -- (-2077.573) (-2078.423) [-2069.767] (-2075.965) * [-2077.027] (-2077.377) (-2075.036) (-2083.089) -- 0:03:14
309600 -- (-2080.976) (-2068.098) (-2075.184) [-2071.461] * (-2074.089) [-2078.054] (-2075.910) (-2078.676) -- 0:03:14
309700 -- (-2084.732) (-2072.917) [-2078.158] (-2073.415) * [-2071.717] (-2079.843) (-2075.775) (-2073.322) -- 0:03:13
309800 -- (-2076.757) (-2077.983) (-2076.022) [-2069.644] * (-2080.902) [-2077.549] (-2075.846) (-2076.420) -- 0:03:13
309900 -- (-2077.996) [-2076.492] (-2082.587) (-2073.233) * (-2076.454) (-2082.159) (-2081.919) [-2077.554] -- 0:03:13
310000 -- (-2081.400) [-2074.549] (-2073.974) (-2074.979) * (-2074.542) [-2076.952] (-2081.896) (-2080.611) -- 0:03:13
Average standard deviation of split frequencies: 0.007557
310100 -- [-2070.659] (-2077.925) (-2077.312) (-2078.211) * [-2073.359] (-2089.033) (-2076.905) (-2078.917) -- 0:03:13
310200 -- (-2072.375) (-2072.167) (-2079.557) [-2080.489] * [-2080.965] (-2080.101) (-2073.766) (-2074.920) -- 0:03:13
310300 -- (-2071.436) (-2083.218) (-2077.135) [-2070.197] * (-2079.601) (-2076.392) (-2074.225) [-2080.059] -- 0:03:15
310400 -- (-2074.710) [-2076.137] (-2069.254) (-2073.404) * (-2074.262) (-2074.778) [-2075.398] (-2077.990) -- 0:03:15
310500 -- (-2077.423) (-2071.562) [-2069.892] (-2072.503) * (-2086.453) [-2073.032] (-2072.926) (-2086.010) -- 0:03:15
310600 -- [-2067.919] (-2075.163) (-2079.632) (-2074.843) * (-2080.743) (-2074.547) [-2069.539] (-2077.877) -- 0:03:15
310700 -- [-2071.694] (-2076.599) (-2075.437) (-2083.052) * (-2084.864) (-2073.436) (-2071.979) [-2078.776] -- 0:03:15
310800 -- (-2069.370) [-2070.001] (-2082.230) (-2079.166) * (-2089.037) (-2083.243) [-2071.837] (-2079.047) -- 0:03:15
310900 -- [-2075.043] (-2074.254) (-2079.507) (-2081.297) * (-2083.418) (-2081.717) [-2072.619] (-2083.195) -- 0:03:15
311000 -- [-2069.299] (-2076.591) (-2077.512) (-2081.196) * (-2087.161) (-2078.868) [-2071.311] (-2085.732) -- 0:03:14
Average standard deviation of split frequencies: 0.007747
311100 -- (-2073.053) (-2080.175) [-2076.173] (-2075.777) * (-2082.639) (-2086.866) [-2072.628] (-2077.208) -- 0:03:14
311200 -- (-2073.660) (-2081.222) (-2077.305) [-2071.057] * (-2082.357) (-2083.887) (-2076.036) [-2073.595] -- 0:03:14
311300 -- (-2076.069) (-2072.521) (-2084.301) [-2071.524] * (-2084.651) (-2077.233) (-2081.544) [-2072.746] -- 0:03:14
311400 -- (-2082.926) (-2071.328) [-2071.378] (-2074.057) * (-2076.891) (-2080.240) (-2085.044) [-2073.623] -- 0:03:14
311500 -- (-2081.281) [-2070.833] (-2082.905) (-2072.283) * (-2077.558) (-2083.679) (-2081.378) [-2082.107] -- 0:03:14
311600 -- (-2075.898) (-2071.017) (-2081.042) [-2070.364] * (-2076.280) (-2083.208) [-2075.402] (-2088.154) -- 0:03:14
311700 -- (-2071.915) [-2066.812] (-2078.584) (-2069.126) * (-2086.232) (-2081.356) [-2075.424] (-2079.527) -- 0:03:14
311800 -- (-2071.787) (-2066.317) (-2078.800) [-2075.073] * (-2086.085) (-2086.314) (-2076.768) [-2079.502] -- 0:03:14
311900 -- (-2078.013) [-2067.804] (-2075.435) (-2077.241) * (-2099.299) (-2081.033) [-2076.145] (-2077.782) -- 0:03:14
312000 -- (-2085.517) (-2075.016) [-2070.608] (-2072.063) * (-2090.486) (-2083.370) (-2079.681) [-2073.440] -- 0:03:14
Average standard deviation of split frequencies: 0.008026
312100 -- (-2086.282) (-2071.084) (-2074.522) [-2075.101] * (-2083.627) (-2075.043) (-2080.319) [-2075.172] -- 0:03:13
312200 -- (-2080.488) (-2070.193) [-2071.267] (-2081.188) * (-2080.819) [-2075.841] (-2082.269) (-2071.663) -- 0:03:13
312300 -- (-2081.980) [-2074.028] (-2076.435) (-2080.176) * (-2079.578) [-2077.595] (-2089.067) (-2073.771) -- 0:03:13
312400 -- (-2077.757) (-2076.844) [-2074.301] (-2088.413) * (-2089.243) (-2075.930) (-2082.018) [-2069.892] -- 0:03:13
312500 -- (-2082.289) (-2078.074) [-2070.522] (-2074.581) * (-2084.315) (-2074.942) (-2085.275) [-2069.383] -- 0:03:13
312600 -- (-2077.433) [-2075.582] (-2070.587) (-2080.991) * (-2081.985) (-2075.020) (-2088.987) [-2068.935] -- 0:03:13
312700 -- (-2076.168) (-2077.565) [-2068.596] (-2075.090) * [-2074.370] (-2088.201) (-2079.459) (-2071.897) -- 0:03:13
312800 -- (-2086.001) (-2073.383) [-2069.446] (-2072.949) * (-2082.976) (-2089.062) (-2081.311) [-2071.650] -- 0:03:13
312900 -- (-2082.080) (-2073.239) [-2071.589] (-2074.864) * (-2089.437) (-2077.091) (-2089.276) [-2068.248] -- 0:03:13
313000 -- (-2087.151) [-2081.055] (-2077.349) (-2078.249) * (-2078.476) (-2087.015) (-2091.826) [-2067.933] -- 0:03:13
Average standard deviation of split frequencies: 0.007913
313100 -- (-2084.388) (-2082.575) (-2072.981) [-2080.506] * (-2072.824) (-2084.761) (-2084.380) [-2069.862] -- 0:03:13
313200 -- [-2083.372] (-2086.033) (-2078.360) (-2080.962) * (-2072.876) (-2091.082) (-2086.163) [-2072.069] -- 0:03:12
313300 -- (-2078.334) (-2072.937) (-2075.966) [-2077.303] * [-2073.517] (-2086.418) (-2095.238) (-2071.190) -- 0:03:12
313400 -- (-2080.462) [-2076.244] (-2076.619) (-2083.984) * (-2077.006) (-2083.193) (-2085.969) [-2069.059] -- 0:03:12
313500 -- [-2074.062] (-2075.792) (-2073.608) (-2084.963) * (-2077.520) (-2089.630) [-2081.894] (-2076.880) -- 0:03:12
313600 -- (-2081.796) [-2074.582] (-2077.062) (-2075.643) * [-2072.659] (-2084.289) (-2083.542) (-2072.666) -- 0:03:12
313700 -- (-2081.781) (-2077.388) [-2076.216] (-2079.723) * (-2086.325) (-2089.584) [-2074.434] (-2077.576) -- 0:03:12
313800 -- [-2074.608] (-2076.152) (-2085.975) (-2077.180) * (-2084.741) (-2094.791) [-2074.882] (-2078.248) -- 0:03:12
313900 -- (-2071.724) [-2075.806] (-2085.668) (-2078.090) * (-2092.557) (-2073.593) (-2074.619) [-2077.090] -- 0:03:14
314000 -- (-2071.214) [-2073.964] (-2084.799) (-2075.639) * (-2088.786) [-2075.373] (-2080.726) (-2083.592) -- 0:03:14
Average standard deviation of split frequencies: 0.007632
314100 -- [-2073.308] (-2073.764) (-2078.858) (-2074.333) * (-2083.926) (-2086.800) [-2079.270] (-2077.731) -- 0:03:14
314200 -- (-2077.225) [-2071.204] (-2084.170) (-2080.268) * (-2076.886) (-2086.771) (-2091.397) [-2073.923] -- 0:03:14
314300 -- [-2070.576] (-2070.553) (-2081.974) (-2078.070) * (-2085.940) (-2086.461) [-2079.432] (-2071.022) -- 0:03:14
314400 -- (-2077.224) (-2073.029) [-2074.455] (-2072.741) * [-2078.476] (-2089.162) (-2077.332) (-2080.218) -- 0:03:14
314500 -- (-2076.121) (-2072.187) [-2072.842] (-2073.170) * [-2077.103] (-2085.951) (-2074.153) (-2079.691) -- 0:03:13
314600 -- (-2077.375) (-2075.087) (-2077.634) [-2071.024] * [-2076.046] (-2081.640) (-2077.090) (-2090.503) -- 0:03:13
314700 -- (-2080.791) (-2082.897) (-2079.598) [-2073.937] * [-2077.361] (-2078.994) (-2079.428) (-2086.097) -- 0:03:13
314800 -- (-2085.312) [-2075.871] (-2079.940) (-2072.364) * (-2085.562) (-2077.444) [-2079.515] (-2082.694) -- 0:03:13
314900 -- (-2079.395) (-2079.479) [-2081.300] (-2089.222) * (-2077.089) (-2074.363) [-2077.088] (-2083.333) -- 0:03:13
315000 -- (-2080.622) [-2074.356] (-2077.917) (-2080.725) * [-2078.391] (-2077.856) (-2077.421) (-2085.402) -- 0:03:13
Average standard deviation of split frequencies: 0.007606
315100 -- (-2077.225) (-2079.120) [-2074.677] (-2082.391) * (-2082.576) [-2082.922] (-2080.612) (-2074.751) -- 0:03:13
315200 -- [-2076.842] (-2074.911) (-2078.658) (-2095.340) * (-2082.103) (-2076.759) (-2082.257) [-2073.410] -- 0:03:13
315300 -- [-2080.113] (-2079.001) (-2082.585) (-2089.994) * (-2076.902) (-2079.653) (-2082.249) [-2073.978] -- 0:03:13
315400 -- (-2077.089) [-2078.360] (-2074.872) (-2084.728) * [-2072.336] (-2082.897) (-2076.332) (-2073.456) -- 0:03:13
315500 -- (-2075.226) (-2079.806) [-2076.531] (-2082.216) * (-2078.628) [-2078.558] (-2079.722) (-2074.167) -- 0:03:13
315600 -- (-2087.259) (-2088.953) (-2077.999) [-2077.415] * [-2075.576] (-2080.254) (-2086.762) (-2076.089) -- 0:03:13
315700 -- (-2076.121) (-2084.306) [-2074.911] (-2080.566) * (-2082.591) [-2075.949] (-2076.157) (-2076.115) -- 0:03:12
315800 -- (-2077.581) (-2076.364) [-2073.747] (-2079.297) * (-2076.998) [-2075.060] (-2079.177) (-2077.763) -- 0:03:12
315900 -- (-2077.181) [-2070.843] (-2072.389) (-2083.125) * (-2080.219) (-2082.533) (-2087.957) [-2073.180] -- 0:03:12
316000 -- (-2085.552) [-2074.720] (-2073.261) (-2077.725) * (-2073.469) (-2078.819) (-2081.072) [-2078.940] -- 0:03:12
Average standard deviation of split frequencies: 0.007328
316100 -- (-2087.831) [-2076.271] (-2070.909) (-2082.250) * [-2071.485] (-2088.326) (-2099.616) (-2075.982) -- 0:03:12
316200 -- (-2079.645) (-2081.798) [-2073.541] (-2081.597) * (-2075.949) (-2077.236) (-2093.884) [-2070.876] -- 0:03:12
316300 -- (-2074.903) [-2070.976] (-2075.122) (-2076.023) * (-2076.700) [-2076.339] (-2089.734) (-2070.801) -- 0:03:12
316400 -- (-2087.783) [-2069.523] (-2075.561) (-2078.965) * (-2078.888) [-2077.280] (-2082.581) (-2071.509) -- 0:03:12
316500 -- (-2089.333) (-2074.646) [-2076.035] (-2086.454) * (-2083.416) (-2081.041) (-2092.864) [-2072.668] -- 0:03:12
316600 -- (-2083.501) (-2071.586) (-2079.846) [-2085.350] * (-2080.282) (-2083.748) (-2089.547) [-2066.828] -- 0:03:12
316700 -- (-2075.626) (-2075.563) [-2072.269] (-2074.934) * (-2077.074) (-2084.024) (-2087.826) [-2069.842] -- 0:03:12
316800 -- (-2077.329) [-2071.218] (-2079.659) (-2076.095) * (-2074.355) [-2080.317] (-2082.579) (-2076.896) -- 0:03:11
316900 -- [-2070.975] (-2080.933) (-2087.406) (-2087.252) * [-2072.651] (-2080.881) (-2090.689) (-2079.012) -- 0:03:11
317000 -- (-2081.684) [-2080.662] (-2088.842) (-2092.718) * (-2073.359) [-2078.348] (-2098.633) (-2079.962) -- 0:03:11
Average standard deviation of split frequencies: 0.007176
317100 -- [-2076.380] (-2085.633) (-2078.247) (-2085.855) * (-2069.616) [-2076.970] (-2094.899) (-2078.201) -- 0:03:11
317200 -- (-2077.301) (-2080.347) [-2075.340] (-2088.167) * (-2073.165) (-2086.831) (-2084.940) [-2073.063] -- 0:03:11
317300 -- (-2083.840) (-2080.838) [-2076.089] (-2087.955) * [-2075.101] (-2085.149) (-2073.106) (-2085.974) -- 0:03:11
317400 -- (-2076.422) (-2085.729) [-2074.324] (-2080.087) * (-2070.377) (-2081.087) (-2084.854) [-2083.330] -- 0:03:13
317500 -- (-2076.906) (-2080.122) [-2071.180] (-2083.133) * [-2070.961] (-2081.825) (-2074.761) (-2085.461) -- 0:03:13
317600 -- [-2073.524] (-2085.474) (-2078.543) (-2079.637) * [-2068.491] (-2085.096) (-2077.804) (-2085.301) -- 0:03:13
317700 -- [-2073.451] (-2086.560) (-2072.103) (-2080.189) * (-2073.830) (-2084.938) [-2078.553] (-2080.435) -- 0:03:13
317800 -- (-2073.086) (-2100.376) [-2071.289] (-2086.506) * [-2072.934] (-2081.956) (-2080.930) (-2088.238) -- 0:03:13
317900 -- [-2068.213] (-2089.156) (-2073.246) (-2083.294) * (-2071.028) [-2074.955] (-2082.899) (-2084.206) -- 0:03:13
318000 -- (-2079.034) (-2089.991) [-2069.486] (-2080.990) * (-2080.310) (-2090.191) [-2083.108] (-2072.836) -- 0:03:13
Average standard deviation of split frequencies: 0.007367
318100 -- (-2073.892) (-2079.075) [-2068.886] (-2081.300) * (-2084.183) (-2079.938) (-2085.741) [-2071.694] -- 0:03:12
318200 -- (-2076.247) (-2079.494) [-2071.257] (-2077.352) * (-2083.367) (-2087.834) (-2080.661) [-2075.665] -- 0:03:12
318300 -- [-2070.062] (-2082.231) (-2074.036) (-2076.584) * (-2081.179) (-2086.793) (-2081.073) [-2074.369] -- 0:03:12
318400 -- (-2072.221) (-2075.694) [-2072.298] (-2079.275) * (-2075.457) (-2089.928) (-2077.784) [-2069.722] -- 0:03:12
318500 -- (-2067.756) (-2073.263) [-2067.831] (-2084.258) * (-2074.230) (-2081.944) [-2077.860] (-2074.825) -- 0:03:12
318600 -- (-2073.259) (-2076.247) [-2070.421] (-2102.667) * [-2071.125] (-2077.825) (-2080.776) (-2076.996) -- 0:03:12
318700 -- [-2070.884] (-2080.706) (-2074.219) (-2091.273) * [-2071.433] (-2082.844) (-2080.518) (-2073.526) -- 0:03:12
318800 -- [-2075.227] (-2078.103) (-2074.007) (-2085.443) * (-2081.725) (-2082.375) (-2075.407) [-2070.222] -- 0:03:12
318900 -- (-2072.796) (-2076.427) [-2070.468] (-2080.799) * (-2084.232) (-2080.924) (-2069.972) [-2072.124] -- 0:03:12
319000 -- (-2086.541) (-2079.662) [-2070.417] (-2082.201) * (-2079.198) [-2076.749] (-2070.757) (-2079.795) -- 0:03:12
Average standard deviation of split frequencies: 0.007342
319100 -- (-2090.753) (-2071.177) (-2077.989) [-2085.183] * [-2074.629] (-2083.844) (-2074.610) (-2076.630) -- 0:03:12
319200 -- (-2083.264) [-2072.537] (-2077.584) (-2083.250) * (-2071.867) (-2074.530) [-2074.291] (-2079.134) -- 0:03:11
319300 -- (-2082.974) [-2072.097] (-2078.950) (-2084.527) * (-2071.275) (-2077.578) [-2071.953] (-2080.503) -- 0:03:11
319400 -- [-2080.310] (-2089.003) (-2081.451) (-2080.490) * [-2068.607] (-2077.523) (-2081.972) (-2075.724) -- 0:03:11
319500 -- (-2085.351) [-2081.011] (-2078.086) (-2077.526) * [-2065.867] (-2084.589) (-2070.383) (-2071.888) -- 0:03:11
319600 -- (-2082.795) [-2078.899] (-2077.234) (-2075.391) * (-2067.035) (-2087.800) [-2076.782] (-2076.985) -- 0:03:11
319700 -- (-2084.538) (-2082.041) [-2070.154] (-2084.036) * [-2074.259] (-2082.511) (-2081.074) (-2074.215) -- 0:03:11
319800 -- (-2087.906) (-2088.414) (-2072.144) [-2082.222] * (-2079.617) (-2083.562) [-2072.644] (-2074.561) -- 0:03:11
319900 -- (-2086.114) (-2077.028) [-2071.725] (-2084.099) * (-2073.411) (-2078.007) [-2076.621] (-2080.781) -- 0:03:11
320000 -- (-2076.530) (-2078.965) [-2067.885] (-2080.884) * (-2077.298) (-2088.852) [-2075.930] (-2085.839) -- 0:03:11
Average standard deviation of split frequencies: 0.007068
320100 -- (-2086.065) (-2077.838) [-2068.733] (-2074.874) * (-2075.972) (-2087.028) [-2072.607] (-2075.838) -- 0:03:11
320200 -- (-2081.751) (-2085.165) [-2076.880] (-2077.540) * (-2078.706) (-2089.579) (-2077.889) [-2077.859] -- 0:03:11
320300 -- (-2075.054) (-2081.143) [-2073.777] (-2079.280) * [-2072.595] (-2075.951) (-2076.961) (-2081.562) -- 0:03:10
320400 -- (-2076.078) (-2079.658) [-2075.486] (-2080.937) * (-2078.724) (-2080.452) (-2076.562) [-2072.820] -- 0:03:10
320500 -- (-2071.129) [-2076.264] (-2081.636) (-2075.669) * (-2084.454) (-2077.697) [-2076.308] (-2075.206) -- 0:03:10
320600 -- [-2071.469] (-2084.933) (-2085.917) (-2084.286) * (-2090.287) [-2080.425] (-2074.909) (-2071.901) -- 0:03:10
320700 -- (-2075.141) (-2086.077) [-2075.099] (-2074.293) * (-2078.104) (-2075.440) (-2077.572) [-2073.972] -- 0:03:10
320800 -- [-2072.628] (-2080.658) (-2085.501) (-2075.542) * (-2074.338) (-2081.939) [-2077.355] (-2073.873) -- 0:03:10
320900 -- [-2076.658] (-2073.799) (-2083.943) (-2080.707) * (-2075.321) (-2078.991) (-2081.522) [-2071.140] -- 0:03:12
321000 -- [-2074.153] (-2075.736) (-2075.438) (-2091.183) * (-2069.371) (-2076.192) (-2087.306) [-2070.587] -- 0:03:12
Average standard deviation of split frequencies: 0.007296
321100 -- [-2073.568] (-2076.749) (-2071.300) (-2090.862) * (-2075.579) (-2075.229) (-2083.764) [-2069.724] -- 0:03:12
321200 -- (-2072.222) (-2073.360) [-2074.591] (-2095.637) * [-2070.254] (-2077.918) (-2081.896) (-2079.415) -- 0:03:12
321300 -- (-2070.412) [-2073.509] (-2078.789) (-2087.492) * [-2070.430] (-2077.235) (-2080.148) (-2082.031) -- 0:03:12
321400 -- [-2069.802] (-2072.125) (-2084.378) (-2084.972) * (-2076.200) (-2087.850) (-2072.703) [-2075.204] -- 0:03:12
321500 -- (-2074.775) [-2074.498] (-2075.226) (-2079.008) * [-2068.963] (-2081.672) (-2072.915) (-2085.273) -- 0:03:12
321600 -- (-2071.505) [-2077.609] (-2076.119) (-2088.595) * (-2070.633) (-2077.804) (-2075.711) [-2076.286] -- 0:03:11
321700 -- (-2074.352) [-2077.839] (-2068.941) (-2082.860) * (-2075.618) (-2077.120) [-2077.312] (-2079.078) -- 0:03:11
321800 -- (-2073.887) (-2083.207) [-2071.273] (-2094.285) * (-2073.260) (-2080.558) (-2080.210) [-2069.661] -- 0:03:11
321900 -- [-2071.542] (-2079.231) (-2076.788) (-2076.469) * [-2070.643] (-2081.015) (-2076.745) (-2073.452) -- 0:03:11
322000 -- [-2067.944] (-2078.347) (-2078.164) (-2078.322) * (-2077.130) (-2085.515) (-2076.374) [-2072.954] -- 0:03:11
Average standard deviation of split frequencies: 0.008070
322100 -- (-2077.569) (-2079.352) (-2075.203) [-2074.349] * (-2072.300) (-2094.252) (-2076.083) [-2074.170] -- 0:03:11
322200 -- (-2077.947) (-2082.326) [-2072.945] (-2075.630) * [-2074.088] (-2079.940) (-2075.377) (-2072.383) -- 0:03:11
322300 -- (-2079.112) (-2082.286) [-2075.671] (-2080.581) * (-2077.707) (-2082.864) (-2080.403) [-2071.090] -- 0:03:11
322400 -- (-2082.781) (-2071.782) (-2076.853) [-2076.561] * (-2076.337) (-2079.560) [-2075.110] (-2077.851) -- 0:03:11
322500 -- [-2071.166] (-2069.914) (-2081.844) (-2082.576) * (-2074.152) (-2079.859) (-2072.530) [-2076.042] -- 0:03:11
322600 -- (-2071.579) [-2072.954] (-2086.691) (-2080.820) * (-2073.797) (-2087.984) (-2074.486) [-2072.779] -- 0:03:11
322700 -- (-2078.767) [-2069.319] (-2078.603) (-2089.756) * [-2073.468] (-2087.265) (-2075.929) (-2076.301) -- 0:03:10
322800 -- (-2086.339) [-2067.554] (-2076.877) (-2088.331) * (-2082.832) (-2089.550) (-2075.891) [-2074.192] -- 0:03:10
322900 -- (-2081.137) [-2070.664] (-2074.013) (-2098.344) * (-2089.103) (-2091.818) [-2077.026] (-2080.707) -- 0:03:10
323000 -- (-2077.402) [-2076.457] (-2073.548) (-2085.804) * (-2078.880) (-2081.571) [-2083.193] (-2079.530) -- 0:03:10
Average standard deviation of split frequencies: 0.008210
323100 -- (-2081.560) [-2073.492] (-2073.481) (-2075.850) * [-2076.403] (-2083.091) (-2080.733) (-2073.805) -- 0:03:10
323200 -- [-2078.060] (-2074.981) (-2072.636) (-2078.577) * [-2070.872] (-2081.230) (-2090.077) (-2076.054) -- 0:03:10
323300 -- (-2075.074) [-2073.343] (-2075.867) (-2080.968) * (-2071.148) [-2079.545] (-2086.549) (-2079.540) -- 0:03:10
323400 -- (-2073.705) [-2072.716] (-2089.286) (-2084.698) * [-2069.628] (-2076.980) (-2077.880) (-2086.399) -- 0:03:10
323500 -- (-2080.776) (-2070.202) [-2074.698] (-2083.023) * [-2075.465] (-2080.924) (-2075.463) (-2089.275) -- 0:03:10
323600 -- (-2072.848) (-2080.535) [-2075.093] (-2076.166) * (-2077.105) (-2079.922) (-2076.280) [-2077.699] -- 0:03:10
323700 -- (-2073.307) (-2083.394) (-2075.668) [-2075.119] * [-2085.114] (-2077.479) (-2083.530) (-2084.196) -- 0:03:10
323800 -- (-2073.645) (-2074.484) [-2076.521] (-2080.033) * (-2088.511) (-2080.824) [-2078.439] (-2079.528) -- 0:03:10
323900 -- (-2074.697) (-2075.942) [-2073.993] (-2077.474) * (-2076.561) (-2088.988) (-2082.234) [-2076.049] -- 0:03:09
324000 -- (-2082.125) [-2072.690] (-2071.789) (-2082.310) * (-2076.380) (-2083.393) (-2081.870) [-2072.531] -- 0:03:09
Average standard deviation of split frequencies: 0.008103
324100 -- (-2082.668) [-2071.501] (-2074.273) (-2074.853) * (-2077.490) (-2084.937) (-2081.155) [-2075.543] -- 0:03:09
324200 -- [-2074.622] (-2075.843) (-2074.497) (-2078.310) * [-2077.561] (-2083.474) (-2079.878) (-2071.366) -- 0:03:09
324300 -- (-2080.253) [-2070.968] (-2085.420) (-2078.573) * (-2074.381) (-2073.139) [-2077.743] (-2071.869) -- 0:03:09
324400 -- (-2074.826) [-2079.814] (-2085.371) (-2076.466) * (-2085.501) (-2077.303) [-2075.110] (-2073.585) -- 0:03:09
324500 -- (-2077.497) [-2073.703] (-2078.498) (-2087.951) * (-2084.903) (-2072.512) (-2080.902) [-2069.760] -- 0:03:11
324600 -- (-2072.239) [-2069.095] (-2077.492) (-2084.901) * (-2078.239) (-2075.932) [-2075.460] (-2069.898) -- 0:03:11
324700 -- (-2074.360) (-2068.679) [-2075.964] (-2084.594) * [-2076.303] (-2078.598) (-2080.795) (-2077.019) -- 0:03:11
324800 -- (-2076.278) [-2072.128] (-2080.276) (-2084.538) * (-2079.569) [-2074.265] (-2083.030) (-2076.681) -- 0:03:11
324900 -- [-2075.460] (-2066.966) (-2087.790) (-2081.565) * (-2077.673) (-2077.549) (-2077.757) [-2070.473] -- 0:03:11
325000 -- (-2077.243) [-2068.934] (-2080.458) (-2081.315) * (-2074.401) (-2081.206) [-2075.264] (-2076.521) -- 0:03:11
Average standard deviation of split frequencies: 0.007745
325100 -- [-2076.477] (-2074.612) (-2076.663) (-2077.933) * (-2082.960) (-2081.383) (-2078.493) [-2080.646] -- 0:03:10
325200 -- (-2085.082) (-2076.224) (-2075.656) [-2082.788] * (-2080.332) [-2079.826] (-2077.488) (-2080.857) -- 0:03:10
325300 -- (-2073.467) (-2080.586) [-2076.587] (-2091.692) * (-2081.980) (-2089.117) [-2087.667] (-2074.243) -- 0:03:10
325400 -- (-2072.509) (-2072.251) [-2078.346] (-2091.770) * (-2078.354) (-2082.984) (-2078.785) [-2074.815] -- 0:03:10
325500 -- [-2071.967] (-2080.126) (-2075.964) (-2084.479) * [-2077.526] (-2081.873) (-2077.873) (-2084.554) -- 0:03:10
325600 -- (-2076.574) (-2079.470) [-2074.356] (-2082.738) * (-2078.020) [-2079.555] (-2077.567) (-2082.873) -- 0:03:10
325700 -- (-2077.571) [-2072.182] (-2082.147) (-2081.384) * (-2099.743) [-2073.024] (-2077.454) (-2082.256) -- 0:03:10
325800 -- (-2075.438) [-2070.777] (-2075.237) (-2080.662) * (-2085.604) (-2091.257) (-2082.348) [-2075.270] -- 0:03:10
325900 -- [-2073.566] (-2071.714) (-2074.365) (-2084.230) * (-2080.578) (-2077.649) [-2083.539] (-2076.391) -- 0:03:10
326000 -- (-2076.353) (-2073.952) [-2069.449] (-2084.463) * (-2085.268) [-2075.740] (-2083.662) (-2081.008) -- 0:03:10
Average standard deviation of split frequencies: 0.007847
326100 -- [-2076.640] (-2072.512) (-2073.145) (-2093.239) * (-2074.549) [-2071.955] (-2092.021) (-2083.841) -- 0:03:10
326200 -- (-2068.302) [-2079.116] (-2073.455) (-2085.072) * (-2075.194) [-2077.418] (-2092.563) (-2086.265) -- 0:03:10
326300 -- [-2073.323] (-2076.905) (-2070.393) (-2086.450) * [-2071.906] (-2078.792) (-2087.613) (-2088.055) -- 0:03:09
326400 -- (-2077.855) [-2073.269] (-2070.214) (-2089.949) * (-2075.769) [-2075.346] (-2084.800) (-2084.052) -- 0:03:09
326500 -- (-2076.944) (-2072.024) [-2072.016] (-2078.373) * (-2076.625) [-2071.492] (-2087.483) (-2084.586) -- 0:03:09
326600 -- (-2073.451) (-2074.183) [-2069.882] (-2081.116) * (-2083.922) [-2073.446] (-2089.373) (-2081.387) -- 0:03:09
326700 -- (-2077.878) (-2071.733) [-2076.086] (-2080.779) * [-2084.175] (-2074.467) (-2086.867) (-2093.988) -- 0:03:09
326800 -- (-2075.525) [-2067.951] (-2073.239) (-2078.408) * (-2079.968) [-2073.991] (-2086.819) (-2084.831) -- 0:03:09
326900 -- (-2079.830) (-2074.301) [-2074.632] (-2077.813) * (-2086.032) [-2078.163] (-2079.595) (-2080.848) -- 0:03:09
327000 -- (-2080.288) (-2073.903) [-2072.038] (-2081.974) * (-2090.505) (-2072.490) [-2081.619] (-2074.082) -- 0:03:09
Average standard deviation of split frequencies: 0.007986
327100 -- (-2070.736) [-2075.290] (-2075.829) (-2076.419) * (-2084.789) [-2079.569] (-2081.418) (-2075.159) -- 0:03:09
327200 -- (-2079.373) [-2070.546] (-2071.184) (-2077.937) * [-2075.696] (-2076.951) (-2082.180) (-2076.659) -- 0:03:09
327300 -- (-2085.195) [-2076.467] (-2078.406) (-2082.414) * [-2078.977] (-2080.845) (-2087.426) (-2076.293) -- 0:03:09
327400 -- [-2076.861] (-2080.983) (-2074.124) (-2082.282) * (-2085.964) (-2082.205) (-2078.167) [-2074.492] -- 0:03:09
327500 -- (-2082.728) [-2074.105] (-2081.284) (-2085.512) * (-2083.896) (-2083.864) [-2078.546] (-2080.942) -- 0:03:08
327600 -- (-2081.504) (-2075.306) [-2083.654] (-2088.114) * (-2084.209) (-2078.143) (-2081.129) [-2075.216] -- 0:03:08
327700 -- [-2074.261] (-2076.573) (-2079.953) (-2093.592) * (-2084.107) (-2079.029) [-2078.758] (-2078.643) -- 0:03:08
327800 -- (-2085.292) (-2083.843) [-2076.117] (-2094.148) * [-2075.989] (-2077.613) (-2085.644) (-2083.770) -- 0:03:08
327900 -- (-2076.673) (-2079.283) [-2075.747] (-2096.531) * (-2083.345) [-2079.014] (-2080.354) (-2081.254) -- 0:03:08
328000 -- (-2072.836) [-2079.608] (-2074.911) (-2087.176) * [-2079.937] (-2083.731) (-2080.663) (-2076.058) -- 0:03:10
Average standard deviation of split frequencies: 0.008291
328100 -- (-2073.318) (-2082.020) [-2073.103] (-2084.063) * (-2076.776) (-2081.697) (-2077.247) [-2078.197] -- 0:03:10
328200 -- [-2074.409] (-2081.355) (-2077.712) (-2082.328) * [-2080.658] (-2080.343) (-2074.782) (-2080.867) -- 0:03:10
328300 -- (-2072.955) [-2069.627] (-2076.197) (-2086.509) * (-2080.155) (-2083.976) (-2074.176) [-2075.106] -- 0:03:10
328400 -- (-2074.627) [-2072.965] (-2080.799) (-2086.678) * (-2082.029) (-2081.163) [-2074.450] (-2079.220) -- 0:03:10
328500 -- [-2073.448] (-2070.277) (-2073.221) (-2088.324) * (-2081.342) (-2082.309) [-2080.158] (-2082.059) -- 0:03:10
328600 -- (-2084.643) [-2068.888] (-2081.241) (-2083.979) * (-2076.843) (-2088.854) (-2084.634) [-2072.132] -- 0:03:10
328700 -- (-2081.344) [-2071.413] (-2088.386) (-2081.770) * (-2079.825) (-2092.964) (-2076.511) [-2074.307] -- 0:03:09
328800 -- [-2072.602] (-2074.799) (-2076.239) (-2077.974) * (-2077.331) (-2097.365) [-2076.451] (-2077.041) -- 0:03:09
328900 -- (-2070.164) [-2077.908] (-2072.562) (-2074.690) * (-2074.875) (-2083.969) (-2079.710) [-2068.795] -- 0:03:09
329000 -- (-2069.750) [-2074.815] (-2076.385) (-2080.211) * [-2077.063] (-2079.595) (-2084.868) (-2073.957) -- 0:03:09
Average standard deviation of split frequencies: 0.007855
329100 -- [-2072.628] (-2072.088) (-2080.566) (-2088.753) * (-2091.363) (-2080.541) (-2085.661) [-2073.261] -- 0:03:09
329200 -- (-2078.147) [-2070.444] (-2074.220) (-2082.852) * (-2086.796) [-2080.936] (-2083.853) (-2077.413) -- 0:03:09
329300 -- (-2083.407) (-2076.577) [-2077.259] (-2089.372) * (-2089.027) [-2083.120] (-2088.268) (-2074.544) -- 0:03:09
329400 -- (-2080.416) [-2074.262] (-2085.451) (-2080.305) * (-2090.090) (-2086.454) (-2081.020) [-2075.311] -- 0:03:09
329500 -- (-2079.085) (-2075.644) (-2079.479) [-2082.701] * (-2084.616) (-2089.624) (-2083.375) [-2073.914] -- 0:03:09
329600 -- (-2071.843) [-2073.954] (-2079.870) (-2084.740) * (-2079.576) [-2072.561] (-2078.514) (-2071.454) -- 0:03:09
329700 -- (-2072.598) [-2073.660] (-2082.254) (-2078.833) * (-2083.779) (-2077.266) [-2076.229] (-2073.061) -- 0:03:09
329800 -- [-2069.112] (-2071.443) (-2084.830) (-2086.379) * (-2080.720) (-2084.494) (-2084.284) [-2076.086] -- 0:03:08
329900 -- [-2070.299] (-2071.317) (-2083.718) (-2083.897) * [-2079.147] (-2087.020) (-2085.648) (-2073.291) -- 0:03:08
330000 -- (-2085.652) [-2072.789] (-2081.187) (-2083.551) * (-2076.305) (-2079.376) (-2089.381) [-2073.303] -- 0:03:08
Average standard deviation of split frequencies: 0.007956
330100 -- (-2072.769) [-2070.568] (-2078.737) (-2084.805) * (-2077.442) (-2075.589) (-2078.744) [-2074.212] -- 0:03:08
330200 -- [-2076.505] (-2068.951) (-2077.504) (-2083.646) * (-2076.427) (-2078.371) [-2073.926] (-2075.830) -- 0:03:08
330300 -- (-2075.022) (-2074.322) [-2074.052] (-2081.603) * (-2074.104) (-2084.372) (-2079.981) [-2076.355] -- 0:03:08
330400 -- (-2081.890) (-2078.513) [-2077.157] (-2080.252) * (-2083.266) [-2078.333] (-2078.674) (-2074.207) -- 0:03:08
330500 -- (-2080.564) (-2076.953) (-2080.507) [-2080.397] * [-2078.804] (-2082.660) (-2077.666) (-2081.054) -- 0:03:08
330600 -- (-2078.361) (-2074.046) (-2075.833) [-2075.984] * [-2077.710] (-2079.728) (-2085.039) (-2076.399) -- 0:03:08
330700 -- [-2076.556] (-2075.575) (-2077.263) (-2074.646) * (-2078.662) (-2079.874) [-2079.521] (-2085.761) -- 0:03:08
330800 -- [-2073.440] (-2070.616) (-2079.493) (-2079.231) * (-2076.430) (-2079.241) (-2077.862) [-2075.159] -- 0:03:08
330900 -- (-2074.262) [-2074.978] (-2078.639) (-2078.870) * (-2073.244) [-2084.769] (-2082.186) (-2078.173) -- 0:03:08
331000 -- (-2079.932) (-2074.579) [-2075.751] (-2083.605) * [-2075.805] (-2085.911) (-2080.930) (-2080.787) -- 0:03:07
Average standard deviation of split frequencies: 0.007767
331100 -- (-2073.515) [-2076.967] (-2074.080) (-2081.728) * (-2085.077) (-2085.037) [-2079.481] (-2077.751) -- 0:03:07
331200 -- (-2072.868) (-2082.316) [-2077.016] (-2077.798) * [-2074.961] (-2080.122) (-2081.265) (-2078.771) -- 0:03:07
331300 -- [-2070.262] (-2089.210) (-2075.931) (-2085.510) * [-2076.433] (-2074.844) (-2077.730) (-2075.023) -- 0:03:07
331400 -- [-2069.953] (-2084.665) (-2073.615) (-2083.729) * [-2073.074] (-2081.404) (-2082.143) (-2075.622) -- 0:03:07
331500 -- [-2078.643] (-2081.017) (-2074.708) (-2076.381) * [-2075.530] (-2086.350) (-2080.195) (-2079.025) -- 0:03:07
331600 -- (-2084.653) [-2074.788] (-2081.669) (-2083.918) * (-2091.946) (-2091.075) (-2086.892) [-2079.424] -- 0:03:09
331700 -- (-2076.514) (-2077.788) (-2083.799) [-2080.571] * (-2086.956) (-2090.227) [-2077.812] (-2078.138) -- 0:03:09
331800 -- (-2082.828) (-2083.343) (-2085.777) [-2079.102] * (-2083.702) (-2090.669) (-2079.843) [-2073.638] -- 0:03:09
331900 -- [-2074.945] (-2089.607) (-2088.115) (-2073.152) * (-2093.094) (-2083.354) (-2082.379) [-2070.119] -- 0:03:09
332000 -- (-2076.339) [-2081.634] (-2101.769) (-2075.020) * (-2080.244) (-2081.187) (-2080.666) [-2074.761] -- 0:03:09
Average standard deviation of split frequencies: 0.007867
332100 -- (-2072.396) (-2084.499) (-2083.830) [-2078.002] * (-2082.705) (-2081.337) (-2082.961) [-2074.235] -- 0:03:09
332200 -- (-2075.409) (-2085.469) [-2076.805] (-2079.905) * (-2079.796) [-2079.269] (-2088.302) (-2078.629) -- 0:03:08
332300 -- [-2074.607] (-2076.512) (-2077.190) (-2087.833) * (-2088.445) (-2082.396) (-2085.837) [-2082.704] -- 0:03:08
332400 -- [-2081.207] (-2079.815) (-2075.650) (-2085.237) * (-2091.607) (-2084.955) [-2080.421] (-2073.112) -- 0:03:08
332500 -- (-2075.838) [-2067.234] (-2077.743) (-2084.209) * (-2089.083) (-2082.390) (-2079.913) [-2070.250] -- 0:03:08
332600 -- (-2081.602) [-2072.509] (-2089.072) (-2076.140) * (-2083.417) [-2088.267] (-2079.536) (-2072.437) -- 0:03:08
332700 -- (-2076.136) [-2077.310] (-2085.430) (-2080.486) * (-2084.937) (-2079.611) (-2079.117) [-2072.754] -- 0:03:08
332800 -- (-2073.324) (-2072.928) (-2075.833) [-2071.288] * [-2081.369] (-2084.519) (-2082.930) (-2073.727) -- 0:03:08
332900 -- (-2083.813) [-2076.550] (-2078.638) (-2079.267) * (-2085.976) (-2086.280) [-2073.686] (-2074.437) -- 0:03:08
333000 -- (-2076.928) (-2081.506) (-2085.042) [-2077.430] * (-2082.725) (-2092.720) [-2076.723] (-2076.814) -- 0:03:08
Average standard deviation of split frequencies: 0.007963
333100 -- (-2080.436) [-2075.308] (-2079.393) (-2073.585) * [-2084.168] (-2089.087) (-2082.373) (-2080.644) -- 0:03:08
333200 -- (-2084.631) (-2073.074) (-2079.269) [-2075.685] * (-2081.051) (-2090.519) (-2082.030) [-2081.552] -- 0:03:08
333300 -- (-2092.530) [-2074.049] (-2080.726) (-2076.087) * (-2088.506) (-2087.665) (-2081.267) [-2083.958] -- 0:03:08
333400 -- (-2080.673) [-2071.439] (-2076.547) (-2081.233) * (-2086.032) (-2086.109) (-2084.991) [-2076.002] -- 0:03:07
333500 -- [-2074.737] (-2076.348) (-2091.655) (-2076.410) * [-2085.130] (-2089.089) (-2080.678) (-2075.357) -- 0:03:07
333600 -- [-2071.435] (-2073.866) (-2086.353) (-2088.627) * (-2079.711) (-2085.916) (-2082.330) [-2071.680] -- 0:03:07
333700 -- [-2072.473] (-2078.507) (-2090.342) (-2075.763) * (-2079.132) (-2089.444) [-2078.180] (-2077.456) -- 0:03:07
333800 -- [-2069.199] (-2069.655) (-2088.032) (-2073.343) * [-2083.220] (-2082.549) (-2082.050) (-2070.826) -- 0:03:07
333900 -- (-2083.861) (-2076.669) (-2082.545) [-2076.577] * [-2075.491] (-2077.855) (-2077.703) (-2074.858) -- 0:03:07
334000 -- (-2081.576) [-2076.533] (-2083.148) (-2080.071) * [-2075.895] (-2078.469) (-2077.813) (-2079.884) -- 0:03:07
Average standard deviation of split frequencies: 0.007941
334100 -- (-2083.709) [-2077.474] (-2081.200) (-2081.593) * [-2074.240] (-2082.489) (-2077.714) (-2076.382) -- 0:03:07
334200 -- (-2088.541) [-2075.185] (-2086.732) (-2079.184) * (-2076.940) (-2086.902) (-2081.778) [-2074.000] -- 0:03:07
334300 -- (-2090.270) (-2074.400) (-2079.929) [-2078.710] * (-2094.054) (-2084.780) [-2076.318] (-2076.556) -- 0:03:07
334400 -- (-2085.913) (-2077.075) (-2082.737) [-2074.862] * (-2085.471) (-2077.131) [-2077.448] (-2072.964) -- 0:03:07
334500 -- (-2080.170) (-2079.403) (-2080.814) [-2070.448] * (-2083.616) (-2077.104) [-2073.873] (-2076.167) -- 0:03:07
334600 -- (-2075.741) (-2080.542) [-2077.746] (-2085.490) * (-2084.730) (-2082.656) (-2078.454) [-2074.135] -- 0:03:06
334700 -- [-2078.867] (-2074.371) (-2085.696) (-2082.264) * (-2084.598) (-2080.525) (-2080.514) [-2071.650] -- 0:03:06
334800 -- (-2075.391) (-2074.536) (-2080.681) [-2070.300] * (-2083.608) (-2085.918) (-2088.597) [-2071.505] -- 0:03:06
334900 -- [-2073.743] (-2078.068) (-2084.758) (-2069.449) * (-2082.304) (-2094.190) (-2083.273) [-2067.052] -- 0:03:06
335000 -- [-2074.987] (-2077.412) (-2084.090) (-2071.433) * (-2087.800) (-2084.865) (-2087.036) [-2072.055] -- 0:03:06
Average standard deviation of split frequencies: 0.007916
335100 -- (-2075.935) [-2069.633] (-2086.362) (-2076.194) * (-2086.091) (-2087.141) (-2086.604) [-2076.469] -- 0:03:08
335200 -- (-2074.690) (-2076.357) (-2080.889) [-2070.415] * (-2084.598) (-2086.145) [-2075.080] (-2073.705) -- 0:03:08
335300 -- [-2073.345] (-2076.607) (-2082.500) (-2074.271) * (-2088.404) (-2085.901) (-2086.914) [-2070.267] -- 0:03:08
335400 -- [-2073.101] (-2081.401) (-2083.644) (-2073.178) * [-2079.219] (-2084.654) (-2088.304) (-2073.413) -- 0:03:08
335500 -- (-2080.597) (-2081.995) (-2083.585) [-2068.794] * (-2075.653) (-2086.028) [-2084.959] (-2074.459) -- 0:03:08
335600 -- (-2076.446) (-2084.210) (-2094.862) [-2072.656] * (-2075.000) (-2082.336) (-2085.920) [-2067.770] -- 0:03:08
335700 -- (-2078.960) (-2072.393) (-2075.472) [-2069.810] * (-2079.177) (-2080.465) (-2079.940) [-2069.280] -- 0:03:07
335800 -- (-2073.819) [-2070.110] (-2097.344) (-2084.994) * [-2074.980] (-2086.616) (-2076.241) (-2083.332) -- 0:03:07
335900 -- (-2081.585) [-2074.006] (-2082.149) (-2078.647) * (-2073.420) [-2073.872] (-2074.323) (-2089.639) -- 0:03:07
336000 -- [-2088.420] (-2077.984) (-2086.486) (-2087.581) * [-2076.986] (-2077.698) (-2076.795) (-2080.607) -- 0:03:07
Average standard deviation of split frequencies: 0.008415
336100 -- (-2083.266) [-2069.670] (-2084.537) (-2082.438) * (-2077.604) (-2081.741) [-2074.139] (-2090.052) -- 0:03:07
336200 -- (-2076.264) [-2070.892] (-2080.726) (-2082.927) * (-2079.292) (-2075.376) (-2078.457) [-2075.348] -- 0:03:07
336300 -- [-2072.974] (-2075.442) (-2081.896) (-2073.367) * (-2082.718) [-2073.097] (-2078.440) (-2074.576) -- 0:03:07
336400 -- (-2073.545) (-2073.357) (-2083.069) [-2081.625] * (-2078.113) (-2076.786) [-2075.101] (-2076.473) -- 0:03:07
336500 -- (-2074.016) (-2073.316) (-2079.219) [-2080.048] * (-2078.015) [-2084.390] (-2089.575) (-2076.031) -- 0:03:07
336600 -- [-2073.693] (-2080.569) (-2076.898) (-2075.897) * (-2081.478) (-2080.370) (-2085.570) [-2079.125] -- 0:03:07
336700 -- (-2080.311) (-2074.858) [-2075.852] (-2075.243) * (-2085.740) (-2074.717) (-2081.075) [-2070.433] -- 0:03:07
336800 -- (-2073.702) (-2084.924) (-2075.741) [-2071.918] * (-2093.118) (-2073.770) (-2082.508) [-2066.515] -- 0:03:07
336900 -- [-2071.292] (-2081.270) (-2082.175) (-2072.280) * (-2084.366) (-2085.001) (-2077.180) [-2073.572] -- 0:03:06
337000 -- (-2071.077) (-2085.578) [-2076.164] (-2073.045) * (-2084.619) (-2076.752) (-2075.285) [-2073.212] -- 0:03:06
Average standard deviation of split frequencies: 0.009107
337100 -- (-2073.578) (-2088.118) (-2084.549) [-2068.561] * (-2078.229) (-2071.871) (-2075.678) [-2075.363] -- 0:03:06
337200 -- (-2076.697) (-2078.568) (-2094.339) [-2068.524] * (-2085.271) (-2075.238) (-2074.807) [-2069.744] -- 0:03:06
337300 -- (-2081.108) (-2085.600) (-2079.812) [-2069.034] * (-2079.841) (-2076.759) (-2079.983) [-2072.141] -- 0:03:06
337400 -- (-2072.405) (-2077.407) (-2083.334) [-2072.785] * (-2082.888) (-2092.880) [-2083.062] (-2070.477) -- 0:03:06
337500 -- [-2071.448] (-2085.547) (-2084.600) (-2073.277) * (-2083.121) (-2087.418) (-2079.317) [-2069.960] -- 0:03:06
337600 -- (-2084.594) (-2086.843) (-2080.552) [-2071.752] * (-2084.172) (-2077.807) (-2084.322) [-2070.774] -- 0:03:06
337700 -- (-2082.272) [-2078.853] (-2083.281) (-2074.909) * (-2082.010) [-2077.295] (-2079.011) (-2070.529) -- 0:03:06
337800 -- (-2081.654) (-2077.819) [-2078.914] (-2077.784) * (-2088.137) (-2082.405) (-2081.678) [-2069.489] -- 0:03:06
337900 -- (-2079.772) [-2078.048] (-2096.111) (-2083.272) * (-2087.746) (-2085.376) (-2078.066) [-2072.246] -- 0:03:06
338000 -- (-2076.162) [-2074.061] (-2083.760) (-2086.384) * (-2089.237) (-2086.443) (-2076.669) [-2073.193] -- 0:03:06
Average standard deviation of split frequencies: 0.009560
338100 -- (-2076.856) [-2071.500] (-2086.787) (-2076.535) * (-2084.086) (-2076.479) [-2078.739] (-2075.166) -- 0:03:05
338200 -- (-2082.695) (-2069.526) (-2079.670) [-2075.429] * (-2083.309) (-2076.259) (-2075.826) [-2071.318] -- 0:03:05
338300 -- (-2078.457) (-2069.832) (-2082.303) [-2075.414] * (-2097.679) (-2080.279) (-2077.504) [-2072.064] -- 0:03:05
338400 -- [-2077.708] (-2081.992) (-2082.991) (-2076.680) * (-2082.355) (-2085.847) (-2072.844) [-2074.533] -- 0:03:05
338500 -- (-2074.448) (-2077.015) (-2078.908) [-2079.913] * (-2088.286) (-2084.907) [-2079.676] (-2073.009) -- 0:03:05
338600 -- (-2076.088) (-2073.182) [-2082.149] (-2080.389) * (-2088.449) (-2084.598) (-2077.731) [-2071.149] -- 0:03:07
338700 -- (-2074.246) [-2074.521] (-2075.406) (-2077.855) * (-2086.908) (-2078.295) (-2085.038) [-2072.214] -- 0:03:07
338800 -- (-2077.523) (-2079.934) [-2073.398] (-2080.020) * (-2079.387) (-2079.685) (-2082.247) [-2067.966] -- 0:03:07
338900 -- (-2082.848) (-2073.000) [-2073.665] (-2083.061) * (-2081.157) (-2077.269) (-2081.039) [-2067.137] -- 0:03:07
339000 -- (-2081.118) [-2078.079] (-2079.271) (-2074.243) * (-2082.873) (-2075.932) (-2091.668) [-2070.937] -- 0:03:07
Average standard deviation of split frequencies: 0.009847
339100 -- (-2082.182) (-2079.887) (-2080.847) [-2075.084] * (-2084.145) (-2078.517) (-2084.807) [-2069.869] -- 0:03:07
339200 -- [-2073.849] (-2074.680) (-2083.131) (-2074.082) * (-2084.017) (-2074.569) (-2092.327) [-2067.207] -- 0:03:07
339300 -- [-2074.988] (-2075.183) (-2081.696) (-2074.786) * (-2083.752) (-2080.390) (-2084.289) [-2068.294] -- 0:03:06
339400 -- (-2081.730) [-2072.176] (-2084.429) (-2076.644) * (-2084.523) (-2087.630) (-2082.477) [-2071.492] -- 0:03:06
339500 -- (-2083.897) [-2073.751] (-2081.408) (-2072.530) * (-2082.542) (-2080.398) (-2081.342) [-2070.478] -- 0:03:06
339600 -- (-2077.346) (-2082.946) [-2081.053] (-2071.361) * (-2085.036) (-2081.618) (-2084.905) [-2070.640] -- 0:03:06
339700 -- (-2077.646) (-2078.941) [-2079.301] (-2067.509) * (-2094.841) (-2077.355) (-2088.792) [-2079.279] -- 0:03:06
339800 -- (-2086.952) (-2075.674) (-2078.317) [-2069.477] * (-2082.270) [-2076.631] (-2085.270) (-2067.997) -- 0:03:06
339900 -- (-2081.368) (-2075.086) (-2085.700) [-2072.388] * [-2085.982] (-2078.374) (-2083.010) (-2076.646) -- 0:03:06
340000 -- (-2081.216) (-2075.425) [-2077.382] (-2083.671) * (-2085.501) (-2074.116) (-2075.826) [-2074.366] -- 0:03:06
Average standard deviation of split frequencies: 0.009424
340100 -- (-2083.569) [-2074.744] (-2079.596) (-2078.622) * (-2081.447) (-2075.737) (-2075.608) [-2074.004] -- 0:03:06
340200 -- (-2083.759) (-2074.028) (-2080.836) [-2075.172] * (-2076.998) (-2076.551) (-2076.339) [-2069.348] -- 0:03:06
340300 -- (-2081.307) [-2069.039] (-2079.995) (-2071.517) * (-2076.292) (-2094.374) (-2078.366) [-2076.394] -- 0:03:06
340400 -- (-2082.442) (-2075.677) (-2074.957) [-2072.264] * (-2079.512) [-2076.515] (-2072.780) (-2082.231) -- 0:03:06
340500 -- (-2078.069) (-2074.887) [-2073.348] (-2086.283) * [-2079.442] (-2077.152) (-2084.776) (-2078.416) -- 0:03:05
340600 -- (-2079.386) [-2075.580] (-2075.981) (-2086.229) * (-2078.653) [-2077.582] (-2082.262) (-2079.463) -- 0:03:05
340700 -- (-2083.482) (-2078.518) [-2077.581] (-2075.731) * (-2080.420) (-2083.429) [-2078.004] (-2083.317) -- 0:03:05
340800 -- (-2083.587) (-2074.359) [-2072.309] (-2079.816) * [-2079.295] (-2078.859) (-2077.936) (-2084.455) -- 0:03:05
340900 -- (-2080.111) (-2077.915) [-2072.165] (-2074.889) * (-2087.372) (-2075.367) (-2083.795) [-2074.618] -- 0:03:05
341000 -- (-2075.990) (-2075.918) [-2073.959] (-2076.554) * (-2079.938) (-2076.474) (-2084.705) [-2069.675] -- 0:03:05
Average standard deviation of split frequencies: 0.009553
341100 -- (-2079.633) (-2080.348) [-2075.233] (-2095.064) * (-2082.010) (-2075.442) (-2084.514) [-2077.885] -- 0:03:05
341200 -- (-2078.348) [-2076.230] (-2075.196) (-2081.232) * (-2084.567) [-2074.950] (-2078.644) (-2073.650) -- 0:03:05
341300 -- (-2079.031) [-2077.392] (-2077.587) (-2075.448) * (-2077.963) (-2083.840) (-2083.823) [-2071.284] -- 0:03:05
341400 -- (-2085.134) [-2070.792] (-2075.091) (-2071.821) * (-2078.024) [-2077.641] (-2081.747) (-2074.478) -- 0:03:05
341500 -- (-2082.706) (-2074.721) (-2077.220) [-2068.985] * (-2076.008) (-2086.741) (-2075.927) [-2068.793] -- 0:03:05
341600 -- (-2078.996) [-2073.398] (-2085.780) (-2071.176) * (-2083.247) (-2081.504) (-2071.800) [-2069.818] -- 0:03:05
341700 -- (-2077.902) [-2074.517] (-2080.200) (-2072.393) * (-2077.142) (-2094.896) (-2076.742) [-2067.774] -- 0:03:04
341800 -- (-2075.388) [-2070.940] (-2075.922) (-2074.368) * (-2077.864) (-2076.999) (-2082.459) [-2069.461] -- 0:03:04
341900 -- (-2077.938) [-2070.785] (-2084.960) (-2086.814) * (-2080.156) (-2081.400) (-2083.701) [-2074.564] -- 0:03:04
342000 -- (-2071.370) [-2074.863] (-2087.476) (-2080.393) * (-2075.164) (-2077.720) (-2083.163) [-2069.755] -- 0:03:04
Average standard deviation of split frequencies: 0.009645
342100 -- (-2078.520) [-2073.984] (-2084.752) (-2079.153) * (-2073.190) [-2074.250] (-2074.216) (-2077.793) -- 0:03:06
342200 -- (-2082.758) [-2073.303] (-2081.304) (-2078.253) * [-2069.795] (-2088.090) (-2080.640) (-2080.958) -- 0:03:06
342300 -- (-2081.659) [-2073.178] (-2085.202) (-2084.042) * [-2070.590] (-2079.050) (-2093.793) (-2080.998) -- 0:03:06
342400 -- [-2080.147] (-2086.274) (-2084.695) (-2082.099) * [-2070.972] (-2078.846) (-2078.045) (-2080.780) -- 0:03:06
342500 -- [-2079.390] (-2080.190) (-2088.671) (-2079.165) * [-2070.917] (-2082.861) (-2080.534) (-2086.054) -- 0:03:06
342600 -- (-2082.049) (-2082.211) (-2084.508) [-2083.979] * (-2073.934) [-2073.202] (-2078.994) (-2077.567) -- 0:03:06
342700 -- (-2079.206) (-2077.179) [-2086.177] (-2080.887) * [-2078.170] (-2074.381) (-2075.022) (-2078.890) -- 0:03:06
342800 -- (-2081.251) [-2078.818] (-2089.265) (-2082.481) * [-2070.825] (-2076.597) (-2083.239) (-2076.946) -- 0:03:05
342900 -- [-2077.902] (-2072.380) (-2082.002) (-2077.439) * (-2070.407) (-2081.208) (-2081.136) [-2074.533] -- 0:03:05
343000 -- [-2077.206] (-2077.848) (-2087.896) (-2087.447) * (-2073.062) (-2088.278) (-2086.053) [-2072.381] -- 0:03:05
Average standard deviation of split frequencies: 0.009340
343100 -- (-2076.118) (-2076.916) (-2082.830) [-2081.996] * [-2073.840] (-2077.299) (-2076.569) (-2080.067) -- 0:03:05
343200 -- [-2076.139] (-2079.914) (-2084.301) (-2083.418) * (-2072.532) (-2077.302) (-2084.989) [-2073.888] -- 0:03:05
343300 -- (-2073.192) [-2078.448] (-2085.996) (-2078.115) * [-2078.149] (-2078.384) (-2088.850) (-2079.300) -- 0:03:05
343400 -- (-2075.986) (-2077.313) (-2091.278) [-2078.667] * (-2074.500) (-2082.598) (-2089.395) [-2071.791] -- 0:03:05
343500 -- (-2080.711) [-2079.043] (-2087.096) (-2079.584) * [-2076.683] (-2075.380) (-2083.132) (-2072.368) -- 0:03:05
343600 -- (-2076.526) (-2077.891) (-2084.749) [-2076.308] * (-2085.740) (-2075.349) (-2076.635) [-2074.592] -- 0:03:05
343700 -- (-2078.800) [-2070.099] (-2076.762) (-2079.060) * (-2088.665) (-2076.723) (-2083.130) [-2071.691] -- 0:03:05
343800 -- (-2081.387) (-2073.143) [-2075.195] (-2086.135) * [-2076.407] (-2079.033) (-2085.522) (-2076.715) -- 0:03:05
343900 -- (-2085.946) (-2075.030) [-2075.816] (-2080.780) * (-2076.349) [-2074.992] (-2083.944) (-2073.372) -- 0:03:05
344000 -- (-2089.954) [-2077.968] (-2083.025) (-2082.376) * [-2074.440] (-2082.538) (-2092.014) (-2075.353) -- 0:03:04
Average standard deviation of split frequencies: 0.009471
344100 -- (-2086.350) [-2069.790] (-2077.276) (-2084.592) * (-2076.217) (-2081.830) (-2080.437) [-2077.033] -- 0:03:04
344200 -- (-2087.928) [-2070.768] (-2079.215) (-2080.882) * [-2078.129] (-2086.167) (-2081.454) (-2077.741) -- 0:03:04
344300 -- (-2092.582) [-2069.314] (-2082.674) (-2078.855) * (-2085.366) [-2081.501] (-2091.654) (-2079.579) -- 0:03:04
344400 -- (-2081.875) [-2071.602] (-2085.649) (-2084.076) * (-2073.780) [-2081.050] (-2091.685) (-2075.393) -- 0:03:04
344500 -- (-2072.226) [-2070.012] (-2079.066) (-2077.664) * [-2073.435] (-2083.339) (-2086.395) (-2081.314) -- 0:03:04
344600 -- (-2075.908) [-2069.258] (-2088.192) (-2078.780) * (-2075.235) [-2085.004] (-2096.052) (-2076.491) -- 0:03:04
344700 -- (-2081.286) [-2066.897] (-2087.468) (-2083.079) * (-2079.554) [-2081.859] (-2093.782) (-2072.694) -- 0:03:04
344800 -- (-2075.334) [-2070.597] (-2083.034) (-2091.302) * [-2075.507] (-2077.823) (-2093.137) (-2078.034) -- 0:03:04
344900 -- (-2077.144) (-2073.926) (-2084.334) [-2082.683] * (-2081.525) (-2084.301) (-2084.476) [-2081.223] -- 0:03:04
345000 -- (-2084.769) [-2075.314] (-2085.573) (-2088.318) * (-2081.301) (-2076.443) (-2091.070) [-2077.023] -- 0:03:04
Average standard deviation of split frequencies: 0.009481
345100 -- (-2077.193) [-2070.215] (-2076.476) (-2087.769) * (-2082.605) (-2079.609) [-2084.400] (-2075.858) -- 0:03:04
345200 -- (-2083.708) (-2076.049) [-2075.873] (-2078.252) * (-2082.944) (-2079.529) (-2090.365) [-2076.572] -- 0:03:03
345300 -- (-2087.938) (-2072.622) (-2075.799) [-2079.628] * (-2079.824) (-2090.039) (-2086.807) [-2071.944] -- 0:03:03
345400 -- (-2086.836) (-2071.505) [-2075.304] (-2074.596) * [-2072.825] (-2080.309) (-2085.542) (-2074.366) -- 0:03:03
345500 -- (-2093.258) (-2077.863) [-2074.465] (-2075.671) * (-2072.250) (-2087.745) (-2089.927) [-2074.147] -- 0:03:03
345600 -- (-2080.779) [-2071.679] (-2080.413) (-2076.078) * (-2080.063) (-2082.289) (-2081.224) [-2069.763] -- 0:03:05
345700 -- (-2078.535) (-2072.097) (-2076.429) [-2073.570] * (-2076.629) (-2083.724) (-2083.416) [-2074.815] -- 0:03:05
345800 -- (-2079.362) [-2071.722] (-2079.128) (-2072.389) * (-2067.207) (-2083.394) (-2080.121) [-2077.212] -- 0:03:05
345900 -- (-2079.471) (-2076.856) (-2085.111) [-2069.734] * [-2076.513] (-2074.005) (-2087.639) (-2074.127) -- 0:03:05
346000 -- (-2094.352) [-2077.488] (-2086.321) (-2070.283) * [-2069.123] (-2086.728) (-2080.411) (-2072.719) -- 0:03:05
Average standard deviation of split frequencies: 0.009689
346100 -- (-2080.878) [-2069.510] (-2083.869) (-2077.150) * (-2072.864) (-2085.905) (-2086.680) [-2069.824] -- 0:03:05
346200 -- (-2080.915) [-2075.105] (-2089.427) (-2069.798) * (-2075.543) (-2094.113) (-2080.273) [-2069.265] -- 0:03:05
346300 -- [-2075.952] (-2077.602) (-2086.708) (-2070.742) * (-2074.690) (-2109.998) (-2085.264) [-2071.531] -- 0:03:04
346400 -- [-2077.418] (-2071.519) (-2083.206) (-2069.825) * (-2078.489) (-2102.774) (-2091.487) [-2069.070] -- 0:03:04
346500 -- (-2072.945) (-2079.518) (-2076.087) [-2068.759] * (-2083.959) (-2095.903) (-2080.202) [-2072.003] -- 0:03:04
346600 -- (-2076.636) (-2077.887) [-2076.072] (-2068.746) * [-2071.671] (-2086.601) (-2077.285) (-2068.132) -- 0:03:04
346700 -- (-2088.967) [-2076.440] (-2080.894) (-2074.962) * (-2072.646) (-2080.218) (-2083.970) [-2070.454] -- 0:03:04
346800 -- (-2079.367) (-2073.939) (-2083.718) [-2068.482] * [-2073.520] (-2084.973) (-2084.470) (-2073.649) -- 0:03:04
346900 -- (-2090.789) [-2073.434] (-2077.603) (-2072.190) * (-2074.412) (-2083.698) (-2080.146) [-2070.033] -- 0:03:04
347000 -- (-2078.851) (-2081.068) (-2076.906) [-2071.638] * [-2069.898] (-2080.826) (-2077.554) (-2073.097) -- 0:03:04
Average standard deviation of split frequencies: 0.009504
347100 -- [-2074.781] (-2088.139) (-2077.864) (-2079.995) * (-2077.679) (-2074.501) (-2087.795) [-2068.761] -- 0:03:04
347200 -- (-2077.291) (-2094.680) (-2079.513) [-2075.858] * [-2067.884] (-2094.113) (-2086.608) (-2068.698) -- 0:03:04
347300 -- (-2078.449) (-2081.077) [-2073.415] (-2081.115) * (-2069.334) (-2080.943) (-2081.083) [-2073.252] -- 0:03:04
347400 -- (-2081.180) (-2082.491) [-2076.279] (-2072.982) * (-2076.018) [-2072.796] (-2085.384) (-2072.286) -- 0:03:04
347500 -- (-2076.507) (-2083.103) [-2076.585] (-2081.876) * (-2069.303) [-2073.862] (-2085.210) (-2072.323) -- 0:03:04
347600 -- (-2082.345) (-2080.256) [-2075.982] (-2078.495) * (-2073.399) [-2076.854] (-2082.663) (-2071.362) -- 0:03:03
347700 -- [-2081.130] (-2085.963) (-2077.870) (-2077.312) * (-2071.981) (-2092.627) (-2083.430) [-2071.526] -- 0:03:03
347800 -- (-2079.290) (-2078.553) [-2079.461] (-2073.940) * [-2076.094] (-2077.575) (-2089.675) (-2080.298) -- 0:03:03
347900 -- (-2083.016) (-2072.180) (-2083.302) [-2069.938] * (-2092.606) (-2082.962) (-2094.709) [-2069.651] -- 0:03:03
348000 -- (-2077.713) [-2078.037] (-2087.387) (-2067.244) * (-2088.088) (-2083.578) (-2090.961) [-2081.049] -- 0:03:03
Average standard deviation of split frequencies: 0.009440
348100 -- (-2075.586) (-2077.175) (-2090.480) [-2070.348] * (-2085.380) [-2079.394] (-2088.661) (-2072.876) -- 0:03:03
348200 -- [-2072.710] (-2078.419) (-2074.929) (-2077.126) * (-2087.333) (-2093.520) (-2082.219) [-2071.084] -- 0:03:03
348300 -- (-2074.775) (-2075.128) [-2076.456] (-2075.381) * (-2083.280) (-2081.467) (-2078.077) [-2068.516] -- 0:03:03
348400 -- (-2075.545) (-2079.643) (-2081.361) [-2074.458] * (-2088.558) (-2083.924) (-2078.749) [-2067.920] -- 0:03:03
348500 -- (-2074.734) [-2081.623] (-2083.928) (-2083.857) * (-2087.254) (-2083.344) (-2085.192) [-2068.583] -- 0:03:03
348600 -- (-2079.094) (-2079.831) [-2081.091] (-2079.315) * (-2082.560) (-2089.901) (-2081.323) [-2069.490] -- 0:03:03
348700 -- (-2076.714) (-2079.215) (-2083.866) [-2073.515] * (-2081.784) (-2078.612) (-2080.258) [-2076.465] -- 0:03:03
348800 -- [-2070.648] (-2080.101) (-2081.359) (-2081.359) * (-2078.210) [-2076.966] (-2081.119) (-2074.387) -- 0:03:02
348900 -- [-2074.774] (-2083.066) (-2087.873) (-2081.778) * (-2075.388) (-2077.050) (-2080.020) [-2069.366] -- 0:03:02
349000 -- [-2078.782] (-2074.897) (-2082.064) (-2084.714) * (-2080.216) (-2083.220) [-2083.308] (-2071.236) -- 0:03:02
Average standard deviation of split frequencies: 0.009218
349100 -- [-2076.270] (-2074.323) (-2087.384) (-2083.524) * (-2083.461) (-2075.422) (-2093.271) [-2073.169] -- 0:03:02
349200 -- (-2081.336) (-2079.505) [-2080.694] (-2081.329) * (-2076.881) (-2081.374) (-2080.961) [-2077.855] -- 0:03:04
349300 -- (-2077.993) (-2079.818) [-2076.439] (-2079.478) * (-2085.026) (-2083.144) (-2085.521) [-2074.051] -- 0:03:04
349400 -- (-2083.861) [-2079.036] (-2083.211) (-2075.843) * (-2085.387) (-2083.953) [-2078.263] (-2074.501) -- 0:03:04
349500 -- (-2091.517) [-2073.057] (-2080.578) (-2080.717) * (-2080.954) (-2078.543) (-2079.080) [-2072.982] -- 0:03:04
349600 -- (-2096.346) (-2080.403) (-2087.979) [-2084.005] * [-2073.759] (-2085.296) (-2083.256) (-2075.501) -- 0:03:04
349700 -- (-2084.972) (-2075.462) [-2080.217] (-2082.769) * [-2071.943] (-2081.039) (-2082.118) (-2074.255) -- 0:03:04
349800 -- (-2085.239) [-2077.322] (-2075.649) (-2084.456) * [-2073.412] (-2085.595) (-2082.640) (-2075.213) -- 0:03:04
349900 -- (-2083.931) (-2078.149) (-2074.427) [-2078.560] * (-2073.154) (-2083.463) (-2079.380) [-2073.997] -- 0:03:03
350000 -- (-2083.807) (-2084.534) [-2074.759] (-2075.775) * (-2078.654) (-2082.541) [-2082.179] (-2080.550) -- 0:03:03
Average standard deviation of split frequencies: 0.009463
350100 -- (-2083.862) (-2079.532) (-2078.175) [-2073.047] * (-2087.560) [-2076.573] (-2081.187) (-2083.869) -- 0:03:03
350200 -- (-2085.211) (-2082.535) (-2077.319) [-2069.955] * (-2088.214) (-2077.887) (-2085.622) [-2075.786] -- 0:03:03
350300 -- (-2077.059) (-2082.463) (-2077.165) [-2066.972] * (-2085.449) (-2081.000) (-2084.649) [-2075.422] -- 0:03:03
350400 -- [-2078.256] (-2083.412) (-2095.503) (-2072.513) * (-2084.972) (-2077.945) (-2074.177) [-2069.971] -- 0:03:03
350500 -- (-2087.138) [-2082.834] (-2089.479) (-2076.471) * (-2078.812) (-2086.988) (-2087.325) [-2071.654] -- 0:03:03
350600 -- (-2078.407) (-2078.966) (-2076.654) [-2074.536] * (-2078.803) [-2077.749] (-2089.328) (-2068.497) -- 0:03:03
350700 -- (-2078.606) (-2087.478) (-2076.608) [-2078.575] * (-2077.261) (-2080.159) (-2087.376) [-2070.111] -- 0:03:03
350800 -- (-2083.288) (-2082.280) (-2073.376) [-2074.465] * (-2075.731) (-2076.538) (-2087.565) [-2073.112] -- 0:03:03
350900 -- (-2082.683) (-2089.884) (-2075.644) [-2071.090] * (-2074.374) (-2080.497) (-2092.704) [-2072.513] -- 0:03:03
351000 -- (-2084.445) (-2086.105) (-2077.337) [-2066.676] * (-2078.345) (-2076.407) (-2087.083) [-2068.296] -- 0:03:03
Average standard deviation of split frequencies: 0.008744
351100 -- (-2083.332) (-2081.458) (-2081.318) [-2071.411] * (-2078.355) (-2085.792) (-2087.198) [-2074.348] -- 0:03:02
351200 -- (-2089.110) (-2085.106) [-2072.918] (-2070.282) * (-2077.171) (-2082.981) (-2076.349) [-2072.659] -- 0:03:02
351300 -- (-2082.327) [-2072.922] (-2072.526) (-2075.808) * (-2078.001) (-2086.906) (-2082.191) [-2067.721] -- 0:03:02
351400 -- (-2078.387) (-2074.136) (-2076.403) [-2070.902] * (-2079.725) (-2086.941) (-2075.327) [-2073.002] -- 0:03:02
351500 -- (-2082.281) (-2074.935) (-2084.051) [-2075.052] * (-2078.193) (-2092.849) [-2073.008] (-2068.641) -- 0:03:02
351600 -- (-2087.694) (-2077.021) (-2094.821) [-2069.595] * (-2084.852) (-2082.494) (-2074.563) [-2073.165] -- 0:03:02
351700 -- (-2079.916) (-2076.242) (-2086.898) [-2077.489] * (-2099.993) (-2082.997) (-2078.308) [-2073.131] -- 0:03:02
351800 -- (-2079.533) (-2072.939) (-2078.299) [-2071.189] * (-2082.459) (-2076.868) (-2088.597) [-2072.325] -- 0:03:02
351900 -- (-2084.169) [-2071.750] (-2076.199) (-2071.043) * (-2077.659) (-2085.191) (-2082.508) [-2070.442] -- 0:03:02
352000 -- (-2086.026) (-2078.568) (-2077.883) [-2068.749] * [-2076.089] (-2083.647) (-2085.388) (-2072.709) -- 0:03:02
Average standard deviation of split frequencies: 0.009103
352100 -- (-2078.035) [-2076.059] (-2081.382) (-2074.200) * [-2078.365] (-2079.413) (-2082.000) (-2076.985) -- 0:03:02
352200 -- (-2081.660) [-2078.611] (-2085.924) (-2079.276) * (-2077.655) [-2074.241] (-2075.629) (-2077.169) -- 0:03:02
352300 -- (-2084.740) (-2075.836) [-2073.450] (-2075.673) * (-2076.465) [-2081.009] (-2081.017) (-2078.871) -- 0:03:02
352400 -- (-2079.210) (-2084.879) [-2081.022] (-2081.013) * [-2076.042] (-2080.518) (-2082.207) (-2071.138) -- 0:03:01
352500 -- [-2082.680] (-2078.962) (-2082.358) (-2087.192) * (-2078.522) (-2080.527) (-2079.251) [-2067.882] -- 0:03:01
352600 -- (-2072.997) (-2079.274) [-2075.245] (-2086.876) * (-2070.616) (-2081.393) (-2084.365) [-2068.344] -- 0:03:01
352700 -- (-2079.233) [-2073.704] (-2079.493) (-2093.301) * [-2069.088] (-2085.615) (-2075.979) (-2077.886) -- 0:03:03
352800 -- [-2075.316] (-2083.378) (-2079.665) (-2094.085) * (-2077.302) (-2073.757) (-2076.000) [-2073.227] -- 0:03:03
352900 -- (-2076.377) (-2076.677) [-2076.532] (-2084.585) * (-2071.626) (-2083.314) [-2073.616] (-2079.589) -- 0:03:03
353000 -- (-2076.483) (-2075.327) (-2078.901) [-2070.362] * (-2082.230) [-2077.157] (-2075.551) (-2073.473) -- 0:03:03
Average standard deviation of split frequencies: 0.009266
353100 -- (-2080.179) [-2073.631] (-2082.253) (-2077.364) * (-2077.883) (-2072.046) (-2077.803) [-2075.544] -- 0:03:03
353200 -- (-2081.969) [-2073.741] (-2079.955) (-2070.535) * [-2071.442] (-2083.534) (-2075.568) (-2073.021) -- 0:03:03
353300 -- (-2077.860) [-2074.057] (-2080.761) (-2070.386) * [-2071.863] (-2087.160) (-2073.705) (-2079.616) -- 0:03:03
353400 -- (-2079.673) (-2077.449) (-2083.976) [-2077.552] * [-2074.644] (-2081.978) (-2085.468) (-2083.672) -- 0:03:02
353500 -- [-2076.103] (-2078.917) (-2077.654) (-2076.862) * [-2075.842] (-2082.613) (-2080.803) (-2075.542) -- 0:03:02
353600 -- (-2080.479) (-2076.058) (-2077.939) [-2073.159] * (-2072.992) (-2083.325) (-2083.046) [-2072.105] -- 0:03:02
353700 -- (-2082.093) (-2088.595) (-2076.473) [-2078.128] * (-2078.398) (-2088.335) (-2082.059) [-2072.823] -- 0:03:02
353800 -- (-2081.843) (-2073.389) (-2072.731) [-2069.600] * [-2070.483] (-2085.984) (-2086.656) (-2070.549) -- 0:03:02
353900 -- [-2077.881] (-2076.869) (-2079.671) (-2071.762) * (-2069.519) (-2084.250) (-2090.870) [-2070.314] -- 0:03:02
354000 -- (-2083.871) [-2078.065] (-2087.075) (-2079.945) * [-2070.198] (-2082.582) (-2077.320) (-2080.707) -- 0:03:02
Average standard deviation of split frequencies: 0.009432
354100 -- (-2086.600) [-2076.418] (-2083.273) (-2072.756) * [-2072.026] (-2090.521) (-2075.877) (-2073.621) -- 0:03:02
354200 -- (-2082.824) (-2084.635) (-2077.018) [-2069.458] * (-2081.828) (-2079.429) [-2078.120] (-2076.593) -- 0:03:02
354300 -- (-2077.335) (-2078.393) [-2077.278] (-2069.639) * (-2078.547) (-2089.595) (-2078.600) [-2069.370] -- 0:03:02
354400 -- [-2076.755] (-2076.539) (-2073.231) (-2073.108) * (-2080.642) (-2086.241) (-2084.187) [-2069.666] -- 0:03:02
354500 -- [-2078.373] (-2083.879) (-2074.037) (-2070.849) * (-2083.687) (-2084.355) (-2079.782) [-2070.847] -- 0:03:02
354600 -- (-2077.319) (-2083.411) [-2068.908] (-2072.368) * (-2076.664) (-2089.140) (-2084.863) [-2077.140] -- 0:03:02
354700 -- (-2075.293) (-2083.796) [-2070.973] (-2078.629) * [-2076.151] (-2090.273) (-2088.898) (-2074.713) -- 0:03:01
354800 -- [-2075.322] (-2081.331) (-2077.609) (-2082.880) * (-2078.013) (-2093.109) (-2089.984) [-2074.430] -- 0:03:01
354900 -- (-2073.430) [-2077.572] (-2085.208) (-2081.795) * (-2085.993) (-2096.620) (-2084.482) [-2078.935] -- 0:03:01
355000 -- [-2075.732] (-2084.869) (-2083.940) (-2075.389) * (-2088.381) (-2090.757) (-2082.473) [-2071.643] -- 0:03:01
Average standard deviation of split frequencies: 0.008987
355100 -- [-2075.000] (-2086.686) (-2078.466) (-2078.316) * [-2080.708] (-2088.224) (-2094.390) (-2071.200) -- 0:03:01
355200 -- (-2077.869) (-2087.195) (-2075.410) [-2075.273] * (-2078.953) (-2084.702) (-2094.046) [-2071.783] -- 0:03:01
355300 -- (-2081.732) (-2082.392) [-2070.624] (-2075.093) * [-2077.908] (-2082.284) (-2086.227) (-2076.604) -- 0:03:01
355400 -- [-2077.368] (-2075.226) (-2073.243) (-2078.213) * [-2081.854] (-2083.732) (-2088.783) (-2077.998) -- 0:03:01
355500 -- [-2074.109] (-2078.399) (-2080.305) (-2075.113) * (-2073.868) (-2082.864) (-2093.248) [-2066.381] -- 0:03:01
355600 -- (-2081.775) (-2082.018) [-2074.194] (-2077.338) * (-2078.742) (-2082.464) (-2105.638) [-2070.253] -- 0:03:01
355700 -- (-2074.560) [-2073.360] (-2076.467) (-2078.197) * (-2086.485) (-2080.050) (-2089.276) [-2072.072] -- 0:03:01
355800 -- (-2082.887) [-2072.232] (-2072.483) (-2075.953) * (-2085.667) (-2090.924) (-2091.496) [-2075.646] -- 0:03:01
355900 -- (-2075.327) (-2079.785) (-2074.393) [-2077.297] * [-2080.574] (-2082.140) (-2089.719) (-2073.625) -- 0:03:00
356000 -- (-2075.610) (-2082.695) (-2090.275) [-2075.513] * (-2083.568) (-2082.224) (-2081.251) [-2075.449] -- 0:03:00
Average standard deviation of split frequencies: 0.009379
356100 -- (-2084.665) (-2080.683) (-2083.343) [-2077.200] * (-2091.083) [-2076.410] (-2088.036) (-2069.685) -- 0:03:00
356200 -- (-2084.490) (-2078.118) (-2080.397) [-2074.889] * (-2079.415) (-2079.504) (-2079.322) [-2073.865] -- 0:03:02
356300 -- (-2091.622) (-2079.635) [-2078.228] (-2081.865) * [-2075.083] (-2082.669) (-2079.697) (-2073.884) -- 0:03:02
356400 -- (-2091.774) (-2075.162) [-2075.147] (-2083.469) * (-2083.217) (-2084.407) (-2079.707) [-2075.416] -- 0:03:02
356500 -- (-2086.849) [-2079.865] (-2069.267) (-2096.471) * (-2083.174) (-2077.924) (-2076.159) [-2071.000] -- 0:03:02
356600 -- (-2078.397) (-2073.546) [-2071.063] (-2097.378) * (-2090.692) (-2082.282) (-2083.434) [-2072.007] -- 0:03:02
356700 -- (-2078.853) (-2074.936) [-2072.930] (-2091.801) * (-2084.256) (-2083.709) [-2081.504] (-2079.253) -- 0:03:02
356800 -- [-2074.511] (-2077.992) (-2075.350) (-2091.812) * [-2081.686] (-2080.321) (-2080.934) (-2079.824) -- 0:03:02
356900 -- [-2077.454] (-2080.297) (-2075.545) (-2079.132) * (-2075.259) (-2078.155) [-2071.745] (-2076.404) -- 0:03:01
357000 -- (-2078.963) (-2082.015) (-2083.004) [-2078.472] * (-2075.517) (-2089.229) [-2075.525] (-2091.930) -- 0:03:01
Average standard deviation of split frequencies: 0.009954
357100 -- [-2076.399] (-2084.906) (-2076.926) (-2078.849) * [-2075.945] (-2084.444) (-2081.727) (-2073.989) -- 0:03:01
357200 -- (-2079.679) (-2077.942) [-2074.096] (-2079.986) * (-2079.948) (-2088.752) [-2077.540] (-2075.955) -- 0:03:01
357300 -- (-2080.319) (-2085.427) [-2075.615] (-2086.254) * (-2078.641) (-2082.667) (-2078.308) [-2077.634] -- 0:03:01
357400 -- (-2085.889) (-2084.405) (-2080.392) [-2076.706] * (-2075.866) (-2081.228) [-2073.051] (-2080.214) -- 0:03:01
357500 -- (-2093.371) (-2078.402) [-2071.483] (-2086.097) * (-2076.303) (-2081.004) (-2081.222) [-2073.554] -- 0:03:01
357600 -- (-2080.920) (-2082.219) [-2066.863] (-2081.416) * (-2078.462) [-2077.635] (-2099.083) (-2075.377) -- 0:03:01
357700 -- (-2077.587) (-2081.239) [-2071.650] (-2082.219) * (-2075.090) (-2075.510) (-2094.542) [-2078.152] -- 0:03:01
357800 -- (-2083.549) (-2077.114) [-2072.869] (-2082.671) * (-2077.379) (-2077.408) (-2082.453) [-2070.039] -- 0:03:01
357900 -- (-2091.328) (-2083.641) [-2075.946] (-2078.546) * (-2081.959) (-2081.573) (-2075.253) [-2072.542] -- 0:03:01
358000 -- (-2085.268) (-2076.847) (-2071.596) [-2075.979] * [-2072.252] (-2087.294) (-2076.212) (-2082.987) -- 0:03:01
Average standard deviation of split frequencies: 0.010041
358100 -- (-2098.133) (-2074.506) [-2071.928] (-2088.994) * (-2077.053) (-2076.684) [-2075.389] (-2080.870) -- 0:03:01
358200 -- (-2089.584) [-2074.190] (-2073.697) (-2088.136) * [-2074.266] (-2083.021) (-2078.953) (-2079.175) -- 0:03:00
358300 -- (-2087.472) [-2073.724] (-2073.657) (-2083.556) * [-2071.864] (-2086.919) (-2083.425) (-2074.093) -- 0:03:00
358400 -- (-2073.973) (-2075.544) [-2080.265] (-2086.505) * (-2077.590) (-2074.400) (-2084.208) [-2073.761] -- 0:03:00
358500 -- [-2078.245] (-2075.388) (-2085.191) (-2084.916) * (-2082.554) [-2077.390] (-2081.889) (-2076.910) -- 0:03:00
358600 -- (-2080.034) (-2077.128) [-2071.374] (-2078.095) * (-2081.334) [-2078.956] (-2083.417) (-2082.887) -- 0:03:00
358700 -- (-2079.492) (-2077.213) [-2072.110] (-2096.031) * (-2083.081) [-2076.379] (-2080.727) (-2083.306) -- 0:03:00
358800 -- (-2084.899) (-2077.159) [-2069.239] (-2077.909) * (-2088.555) (-2074.536) (-2087.667) [-2070.262] -- 0:03:00
358900 -- (-2080.010) [-2076.314] (-2070.308) (-2080.290) * (-2084.710) (-2077.490) (-2084.478) [-2070.661] -- 0:03:00
359000 -- (-2086.412) (-2078.085) (-2071.479) [-2074.366] * (-2081.742) (-2078.238) (-2085.233) [-2077.803] -- 0:03:00
Average standard deviation of split frequencies: 0.009562
359100 -- (-2085.872) (-2069.724) [-2072.508] (-2080.514) * (-2082.289) (-2081.157) (-2085.998) [-2070.604] -- 0:03:00
359200 -- (-2088.881) (-2069.848) [-2070.380] (-2076.814) * (-2081.819) (-2080.985) (-2084.558) [-2067.991] -- 0:03:00
359300 -- (-2093.744) (-2079.378) [-2070.816] (-2084.178) * (-2082.350) [-2076.492] (-2077.937) (-2071.738) -- 0:03:00
359400 -- (-2078.192) (-2076.600) [-2065.950] (-2087.046) * (-2087.170) [-2078.763] (-2088.147) (-2076.705) -- 0:03:00
359500 -- (-2079.908) [-2074.184] (-2070.942) (-2085.336) * (-2081.217) [-2082.944] (-2081.427) (-2071.585) -- 0:02:59
359600 -- (-2073.118) (-2078.082) [-2071.103] (-2081.881) * (-2075.012) (-2077.271) (-2085.449) [-2070.870] -- 0:02:59
359700 -- (-2083.247) (-2080.829) [-2070.793] (-2086.806) * (-2072.908) (-2084.211) (-2081.844) [-2071.658] -- 0:02:59
359800 -- (-2081.038) (-2079.890) [-2070.110] (-2086.054) * (-2076.942) (-2086.052) (-2080.677) [-2074.137] -- 0:03:01
359900 -- (-2089.980) (-2075.192) [-2066.343] (-2090.250) * (-2082.544) [-2082.910] (-2078.613) (-2079.179) -- 0:03:01
360000 -- (-2088.766) (-2074.928) [-2072.443] (-2083.926) * (-2077.746) [-2075.296] (-2085.240) (-2077.156) -- 0:03:01
Average standard deviation of split frequencies: 0.009649
360100 -- (-2091.343) (-2070.333) [-2069.115] (-2087.856) * (-2088.199) (-2078.279) (-2080.211) [-2078.907] -- 0:03:01
360200 -- (-2081.558) (-2075.231) [-2072.699] (-2083.443) * [-2083.865] (-2083.793) (-2080.316) (-2083.380) -- 0:03:01
360300 -- (-2086.799) (-2078.802) [-2077.934] (-2077.380) * [-2078.333] (-2080.621) (-2080.176) (-2082.317) -- 0:03:01
360400 -- (-2083.892) [-2072.187] (-2079.741) (-2079.122) * (-2077.563) (-2075.572) (-2084.728) [-2078.509] -- 0:03:01
360500 -- (-2080.552) [-2073.153] (-2074.015) (-2079.042) * (-2080.705) (-2083.713) (-2078.345) [-2074.945] -- 0:03:00
360600 -- [-2078.904] (-2077.621) (-2080.821) (-2090.302) * (-2084.172) (-2084.439) [-2074.552] (-2073.304) -- 0:03:00
360700 -- [-2076.677] (-2074.039) (-2072.599) (-2084.777) * [-2075.836] (-2082.199) (-2077.438) (-2072.585) -- 0:03:00
360800 -- (-2074.909) (-2081.763) [-2068.567] (-2087.081) * (-2081.124) (-2082.903) (-2075.199) [-2076.255] -- 0:03:00
360900 -- (-2076.133) (-2077.988) [-2070.413] (-2095.913) * (-2079.634) (-2080.316) (-2074.420) [-2075.018] -- 0:03:00
361000 -- [-2074.480] (-2076.454) (-2072.316) (-2080.880) * (-2085.038) (-2081.158) (-2081.172) [-2072.158] -- 0:03:00
Average standard deviation of split frequencies: 0.009471
361100 -- (-2080.095) (-2082.651) (-2071.976) [-2078.531] * (-2096.536) (-2082.635) (-2081.162) [-2077.442] -- 0:03:00
361200 -- (-2084.711) (-2076.011) (-2078.099) [-2077.279] * (-2077.630) (-2076.605) (-2082.078) [-2072.290] -- 0:03:00
361300 -- (-2086.553) [-2076.187] (-2085.853) (-2080.665) * (-2072.954) (-2079.613) (-2081.892) [-2070.278] -- 0:03:00
361400 -- [-2077.216] (-2087.091) (-2074.216) (-2083.249) * (-2080.377) (-2087.336) (-2080.529) [-2072.059] -- 0:03:00
361500 -- (-2076.049) (-2085.046) [-2074.657] (-2085.913) * (-2077.811) (-2101.622) [-2087.692] (-2073.244) -- 0:03:00
361600 -- (-2078.832) (-2079.725) (-2076.146) [-2073.000] * (-2080.881) [-2081.955] (-2079.349) (-2076.512) -- 0:03:00
361700 -- (-2073.454) (-2075.704) [-2072.688] (-2074.801) * (-2084.286) (-2091.314) (-2085.753) [-2076.846] -- 0:03:00
361800 -- (-2075.120) [-2074.431] (-2081.101) (-2081.638) * [-2081.375] (-2082.492) (-2079.163) (-2077.711) -- 0:02:59
361900 -- [-2073.020] (-2080.857) (-2070.135) (-2072.180) * [-2084.208] (-2087.755) (-2084.857) (-2079.758) -- 0:02:59
362000 -- (-2071.094) (-2078.673) (-2071.441) [-2079.322] * [-2083.836] (-2077.977) (-2083.438) (-2074.022) -- 0:02:59
Average standard deviation of split frequencies: 0.009782
362100 -- (-2079.381) (-2083.340) [-2074.757] (-2079.015) * (-2077.261) (-2074.437) (-2080.183) [-2071.532] -- 0:02:59
362200 -- (-2086.772) (-2079.617) (-2080.552) [-2076.616] * (-2083.494) (-2079.412) (-2081.911) [-2075.854] -- 0:02:59
362300 -- (-2078.648) [-2082.511] (-2077.699) (-2073.824) * (-2089.556) (-2077.847) (-2088.941) [-2078.291] -- 0:02:59
362400 -- (-2078.440) (-2077.178) [-2077.751] (-2083.266) * (-2083.779) (-2087.546) (-2081.499) [-2073.335] -- 0:02:59
362500 -- (-2077.857) (-2078.785) [-2068.974] (-2078.766) * (-2083.970) (-2079.196) (-2080.927) [-2070.660] -- 0:02:59
362600 -- (-2077.090) (-2078.211) (-2076.054) [-2076.428] * (-2087.934) [-2076.514] (-2078.185) (-2069.937) -- 0:02:59
362700 -- (-2074.733) (-2078.584) [-2068.557] (-2082.356) * (-2085.190) (-2075.866) (-2082.746) [-2068.947] -- 0:02:59
362800 -- (-2080.731) [-2076.072] (-2075.546) (-2081.586) * (-2079.199) [-2076.635] (-2086.617) (-2078.358) -- 0:02:59
362900 -- [-2075.575] (-2078.325) (-2080.429) (-2080.480) * (-2081.049) [-2073.724] (-2084.257) (-2077.193) -- 0:02:59
363000 -- [-2077.014] (-2083.145) (-2071.653) (-2081.167) * (-2079.122) (-2073.714) (-2084.504) [-2069.732] -- 0:02:58
Average standard deviation of split frequencies: 0.010013
363100 -- (-2074.050) (-2094.881) [-2076.177] (-2087.436) * (-2097.136) [-2078.244] (-2085.391) (-2077.556) -- 0:02:58
363200 -- (-2073.642) (-2090.942) [-2077.197] (-2076.468) * (-2099.225) (-2082.050) [-2077.372] (-2076.780) -- 0:02:58
363300 -- (-2074.566) (-2088.645) (-2084.067) [-2075.799] * (-2089.128) (-2083.411) (-2079.010) [-2075.251] -- 0:03:00
363400 -- (-2073.966) (-2081.669) (-2078.053) [-2074.364] * (-2076.583) [-2082.969] (-2076.585) (-2074.067) -- 0:03:00
363500 -- (-2075.815) (-2086.799) [-2075.232] (-2079.741) * (-2083.297) [-2078.510] (-2083.472) (-2078.548) -- 0:03:00
363600 -- [-2074.847] (-2083.525) (-2086.419) (-2088.783) * (-2081.232) [-2081.434] (-2084.869) (-2086.111) -- 0:03:00
363700 -- [-2072.349] (-2080.290) (-2081.478) (-2084.968) * [-2078.476] (-2082.438) (-2082.594) (-2080.091) -- 0:03:00
363800 -- (-2074.895) (-2085.706) [-2071.424] (-2084.291) * [-2078.296] (-2080.588) (-2088.979) (-2082.132) -- 0:03:00
363900 -- (-2084.238) (-2078.106) [-2073.706] (-2080.113) * (-2076.234) [-2073.830] (-2085.707) (-2094.320) -- 0:03:00
364000 -- (-2079.686) (-2075.813) [-2072.095] (-2073.951) * [-2077.885] (-2070.348) (-2087.022) (-2084.453) -- 0:02:59
Average standard deviation of split frequencies: 0.010172
364100 -- (-2086.324) (-2083.795) [-2069.848] (-2079.382) * (-2090.706) [-2071.946] (-2081.896) (-2077.760) -- 0:02:59
364200 -- (-2079.515) (-2078.207) (-2077.718) [-2077.981] * (-2088.745) [-2070.719] (-2079.583) (-2085.087) -- 0:02:59
364300 -- (-2074.894) (-2078.863) [-2072.860] (-2082.428) * (-2095.976) (-2069.560) [-2075.279] (-2081.021) -- 0:02:59
364400 -- (-2078.990) (-2080.922) (-2081.748) [-2077.558] * (-2085.664) (-2077.829) [-2078.124] (-2077.878) -- 0:02:59
364500 -- [-2084.315] (-2091.572) (-2079.904) (-2083.940) * (-2079.333) [-2073.902] (-2082.570) (-2073.524) -- 0:02:59
364600 -- (-2080.253) (-2086.445) (-2071.197) [-2074.498] * (-2087.722) (-2078.126) (-2084.819) [-2073.095] -- 0:02:59
364700 -- (-2078.526) (-2082.769) (-2075.111) [-2074.100] * (-2087.959) [-2072.130] (-2080.802) (-2080.263) -- 0:02:59
364800 -- (-2077.058) (-2079.719) [-2074.755] (-2077.776) * (-2086.694) [-2069.006] (-2084.895) (-2081.900) -- 0:02:59
364900 -- (-2077.654) (-2081.240) (-2069.805) [-2072.823] * (-2085.844) [-2068.548] (-2077.343) (-2082.757) -- 0:02:59
365000 -- (-2084.846) (-2086.510) [-2065.979] (-2077.209) * (-2086.482) [-2071.116] (-2080.010) (-2079.673) -- 0:02:59
Average standard deviation of split frequencies: 0.010326
365100 -- (-2085.032) (-2083.387) [-2070.350] (-2079.213) * (-2081.453) [-2072.132] (-2079.644) (-2090.190) -- 0:02:59
365200 -- (-2090.609) (-2082.190) (-2071.047) [-2077.791] * (-2085.216) (-2074.717) (-2082.691) [-2075.760] -- 0:02:59
365300 -- (-2082.822) (-2089.782) [-2073.088] (-2077.101) * (-2084.224) (-2072.220) (-2078.299) [-2076.332] -- 0:02:58
365400 -- (-2088.267) (-2082.403) [-2069.831] (-2078.433) * (-2081.981) [-2070.061] (-2083.169) (-2077.748) -- 0:02:58
365500 -- (-2081.425) (-2082.569) [-2070.254] (-2076.792) * (-2082.140) (-2075.365) (-2080.439) [-2078.442] -- 0:02:58
365600 -- (-2084.118) (-2085.788) [-2068.792] (-2078.077) * (-2087.608) (-2073.334) [-2073.008] (-2080.169) -- 0:02:58
365700 -- [-2073.812] (-2086.667) (-2068.041) (-2076.926) * (-2087.173) (-2075.906) (-2077.888) [-2079.990] -- 0:02:58
365800 -- (-2088.870) (-2086.283) (-2070.521) [-2074.941] * (-2088.895) (-2082.996) [-2072.341] (-2076.308) -- 0:02:58
365900 -- (-2085.189) (-2090.158) (-2072.268) [-2070.718] * (-2085.694) (-2087.846) [-2074.146] (-2081.383) -- 0:02:58
366000 -- (-2082.715) (-2089.991) (-2072.976) [-2072.436] * (-2092.332) (-2079.986) [-2073.962] (-2083.741) -- 0:02:58
Average standard deviation of split frequencies: 0.010631
366100 -- (-2080.805) (-2077.337) [-2076.484] (-2075.281) * (-2088.699) [-2079.048] (-2077.859) (-2088.082) -- 0:02:58
366200 -- (-2083.007) (-2084.543) [-2076.346] (-2070.020) * (-2081.469) (-2079.605) [-2078.817] (-2091.435) -- 0:02:58
366300 -- (-2088.951) (-2087.938) (-2074.134) [-2078.098] * (-2081.578) (-2075.971) [-2075.392] (-2092.700) -- 0:02:58
366400 -- (-2092.878) (-2084.404) [-2073.150] (-2077.112) * (-2079.084) (-2074.423) [-2079.298] (-2093.100) -- 0:02:58
366500 -- (-2086.497) (-2087.619) (-2069.977) [-2072.743] * [-2074.355] (-2075.618) (-2080.897) (-2080.316) -- 0:02:58
366600 -- (-2084.441) (-2084.583) (-2080.939) [-2074.076] * (-2080.043) (-2080.245) [-2077.160] (-2081.753) -- 0:02:59
366700 -- (-2081.470) (-2087.368) (-2070.150) [-2072.655] * (-2074.799) (-2083.172) [-2077.946] (-2083.898) -- 0:02:59
366800 -- (-2078.677) (-2092.146) [-2069.317] (-2075.198) * (-2081.277) [-2077.213] (-2082.938) (-2082.906) -- 0:02:59
366900 -- (-2077.936) (-2080.473) [-2069.447] (-2081.109) * (-2078.826) (-2088.449) [-2075.326] (-2093.039) -- 0:02:59
367000 -- (-2081.089) (-2087.775) [-2075.711] (-2078.723) * (-2080.321) (-2075.874) [-2073.070] (-2085.532) -- 0:02:59
Average standard deviation of split frequencies: 0.010600
367100 -- (-2078.593) (-2082.827) (-2074.937) [-2075.375] * (-2089.753) (-2074.775) [-2075.877] (-2088.975) -- 0:02:59
367200 -- (-2078.720) (-2089.279) [-2073.478] (-2081.735) * (-2095.216) (-2075.566) [-2073.076] (-2081.145) -- 0:02:59
367300 -- [-2082.850] (-2096.528) (-2077.981) (-2079.070) * (-2085.060) [-2076.614] (-2088.693) (-2079.773) -- 0:02:59
367400 -- (-2082.201) (-2092.422) (-2086.021) [-2078.256] * (-2077.083) [-2074.783] (-2079.440) (-2083.778) -- 0:02:59
367500 -- (-2083.261) (-2086.162) [-2071.938] (-2074.502) * [-2080.718] (-2077.620) (-2075.625) (-2084.145) -- 0:02:58
367600 -- (-2083.194) (-2086.388) [-2075.521] (-2081.746) * (-2077.411) [-2073.416] (-2078.478) (-2083.001) -- 0:02:58
367700 -- (-2080.803) (-2082.450) [-2072.108] (-2081.509) * (-2074.197) [-2075.325] (-2080.708) (-2076.125) -- 0:02:58
367800 -- [-2084.959] (-2085.366) (-2069.900) (-2079.005) * [-2071.562] (-2080.079) (-2077.120) (-2078.138) -- 0:02:58
367900 -- (-2075.181) (-2098.609) [-2070.068] (-2080.122) * [-2071.880] (-2080.439) (-2076.040) (-2079.097) -- 0:02:58
368000 -- (-2084.068) (-2082.025) [-2070.286] (-2094.373) * (-2081.150) [-2073.576] (-2073.067) (-2083.397) -- 0:02:58
Average standard deviation of split frequencies: 0.010464
368100 -- (-2074.989) (-2090.092) [-2071.796] (-2078.479) * [-2075.859] (-2078.554) (-2079.366) (-2082.752) -- 0:02:58
368200 -- (-2087.967) (-2081.413) (-2073.930) [-2076.229] * (-2084.024) [-2068.544] (-2085.190) (-2078.243) -- 0:02:58
368300 -- (-2077.058) (-2090.051) [-2077.983] (-2071.545) * (-2084.908) [-2067.529] (-2086.962) (-2074.608) -- 0:02:58
368400 -- (-2075.754) (-2086.508) [-2070.415] (-2072.380) * (-2079.368) [-2068.942] (-2083.688) (-2077.556) -- 0:02:58
368500 -- (-2077.520) (-2090.959) (-2068.990) [-2082.343] * (-2079.615) [-2071.523] (-2085.440) (-2070.734) -- 0:02:58
368600 -- (-2080.661) (-2087.593) [-2071.570] (-2078.650) * (-2082.640) [-2076.787] (-2085.699) (-2070.249) -- 0:02:58
368700 -- (-2077.993) (-2101.177) [-2070.900] (-2073.169) * (-2077.673) (-2081.352) (-2084.981) [-2071.353] -- 0:02:58
368800 -- (-2083.006) (-2112.530) [-2072.862] (-2088.520) * (-2075.990) [-2076.671] (-2074.852) (-2074.729) -- 0:02:57
368900 -- (-2077.903) (-2104.551) [-2073.446] (-2073.060) * (-2078.152) (-2070.427) (-2085.583) [-2071.213] -- 0:02:57
369000 -- (-2084.315) (-2082.298) (-2082.040) [-2076.289] * (-2078.563) (-2074.633) (-2078.492) [-2073.203] -- 0:02:57
Average standard deviation of split frequencies: 0.010142
369100 -- (-2090.360) (-2079.756) (-2077.708) [-2069.283] * (-2076.024) [-2070.679] (-2078.093) (-2080.988) -- 0:02:57
369200 -- (-2081.727) (-2087.713) [-2072.775] (-2071.655) * (-2081.157) (-2074.362) [-2082.010] (-2071.702) -- 0:02:57
369300 -- (-2072.052) (-2091.434) [-2074.309] (-2078.280) * (-2086.075) (-2074.244) (-2078.633) [-2073.635] -- 0:02:57
369400 -- (-2073.569) (-2083.318) [-2071.492] (-2084.485) * (-2081.979) (-2072.892) [-2076.461] (-2088.660) -- 0:02:57
369500 -- (-2083.818) (-2091.892) [-2076.097] (-2080.793) * (-2080.938) [-2071.702] (-2078.110) (-2076.451) -- 0:02:57
369600 -- [-2080.039] (-2082.380) (-2077.957) (-2079.692) * (-2089.157) [-2069.989] (-2082.960) (-2072.753) -- 0:02:57
369700 -- [-2075.607] (-2084.595) (-2076.996) (-2075.210) * (-2081.946) (-2070.470) (-2081.638) [-2073.399] -- 0:02:57
369800 -- [-2071.307] (-2076.923) (-2079.486) (-2071.121) * (-2086.473) [-2068.682] (-2087.158) (-2071.643) -- 0:02:57
369900 -- (-2070.414) [-2071.098] (-2077.561) (-2080.458) * (-2083.115) [-2070.762] (-2092.997) (-2083.900) -- 0:02:57
370000 -- [-2074.231] (-2072.793) (-2074.021) (-2079.616) * (-2084.563) [-2069.940] (-2086.135) (-2078.414) -- 0:02:58
Average standard deviation of split frequencies: 0.010553
370100 -- [-2072.517] (-2081.132) (-2071.535) (-2071.205) * (-2085.042) [-2069.941] (-2079.590) (-2074.594) -- 0:02:58
370200 -- (-2079.904) (-2080.387) [-2070.070] (-2074.435) * (-2089.939) (-2070.481) (-2082.760) [-2071.217] -- 0:02:58
370300 -- (-2085.576) (-2081.490) [-2071.404] (-2078.261) * (-2089.677) [-2071.657] (-2076.318) (-2081.375) -- 0:02:58
370400 -- (-2086.080) (-2087.121) [-2070.015] (-2079.534) * (-2085.869) (-2083.661) [-2079.758] (-2077.346) -- 0:02:58
370500 -- (-2076.445) (-2080.771) [-2068.676] (-2082.694) * (-2079.558) (-2083.630) (-2079.186) [-2076.051] -- 0:02:58
370600 -- [-2069.259] (-2080.207) (-2074.341) (-2076.367) * (-2081.448) [-2077.281] (-2077.392) (-2070.692) -- 0:02:58
370700 -- [-2069.422] (-2086.466) (-2074.601) (-2078.659) * (-2077.598) (-2073.914) (-2078.154) [-2070.441] -- 0:02:58
370800 -- (-2075.779) (-2083.438) [-2070.031] (-2088.958) * (-2079.448) (-2073.616) (-2076.101) [-2075.598] -- 0:02:58
370900 -- (-2074.480) (-2076.495) [-2072.246] (-2087.536) * (-2084.307) [-2071.141] (-2075.972) (-2074.582) -- 0:02:58
371000 -- [-2070.241] (-2085.457) (-2075.513) (-2077.542) * (-2089.776) [-2072.749] (-2080.624) (-2076.557) -- 0:02:58
Average standard deviation of split frequencies: 0.010922
371100 -- [-2066.074] (-2077.988) (-2074.652) (-2079.129) * (-2083.093) [-2074.099] (-2076.463) (-2069.675) -- 0:02:57
371200 -- (-2071.581) [-2075.278] (-2075.176) (-2081.982) * (-2082.355) (-2077.450) (-2075.345) [-2069.485] -- 0:02:57
371300 -- [-2070.285] (-2071.390) (-2077.077) (-2079.515) * (-2078.554) [-2073.547] (-2089.141) (-2067.595) -- 0:02:57
371400 -- (-2072.622) (-2075.230) [-2074.310] (-2072.177) * (-2079.633) (-2080.153) (-2080.705) [-2070.938] -- 0:02:57
371500 -- [-2070.585] (-2085.791) (-2073.673) (-2076.133) * (-2080.188) [-2069.007] (-2081.416) (-2076.004) -- 0:02:57
371600 -- (-2070.303) (-2090.378) (-2072.409) [-2074.357] * (-2083.442) [-2068.581] (-2076.871) (-2067.749) -- 0:02:57
371700 -- (-2071.642) (-2084.918) [-2071.249] (-2075.690) * (-2084.532) (-2076.564) (-2082.190) [-2072.548] -- 0:02:57
371800 -- (-2070.670) (-2076.026) [-2071.137] (-2072.735) * (-2082.333) [-2072.238] (-2084.286) (-2071.470) -- 0:02:57
371900 -- (-2076.660) (-2079.249) (-2075.011) [-2072.034] * (-2084.812) (-2077.467) (-2083.103) [-2078.311] -- 0:02:57
372000 -- (-2075.000) (-2077.279) (-2076.995) [-2070.281] * (-2089.358) [-2072.716] (-2083.650) (-2077.752) -- 0:02:57
Average standard deviation of split frequencies: 0.010749
372100 -- (-2082.406) (-2074.834) (-2075.450) [-2066.332] * (-2078.824) [-2072.327] (-2077.287) (-2079.098) -- 0:02:57
372200 -- [-2072.606] (-2072.013) (-2073.758) (-2074.533) * (-2083.946) (-2080.922) (-2076.274) [-2073.088] -- 0:02:57
372300 -- (-2077.201) [-2071.191] (-2072.862) (-2075.030) * (-2089.423) [-2079.184] (-2076.393) (-2074.214) -- 0:02:57
372400 -- [-2069.388] (-2078.993) (-2078.096) (-2069.826) * (-2078.975) (-2082.395) (-2082.263) [-2072.302] -- 0:02:56
372500 -- (-2077.020) (-2071.639) (-2080.692) [-2072.807] * (-2087.036) [-2077.709] (-2090.374) (-2073.249) -- 0:02:56
372600 -- (-2072.827) [-2072.097] (-2081.032) (-2077.241) * (-2088.290) (-2074.556) (-2081.895) [-2069.603] -- 0:02:56
372700 -- (-2075.240) (-2075.983) (-2083.460) [-2071.437] * (-2093.892) (-2071.882) (-2079.991) [-2072.627] -- 0:02:56
372800 -- (-2076.773) (-2085.185) (-2093.492) [-2067.531] * (-2083.787) [-2072.458] (-2080.770) (-2071.261) -- 0:02:56
372900 -- (-2081.742) (-2079.537) (-2087.800) [-2070.095] * (-2080.577) [-2074.594] (-2084.019) (-2072.110) -- 0:02:56
373000 -- (-2073.458) (-2081.831) (-2076.214) [-2068.201] * (-2090.549) [-2068.937] (-2078.749) (-2075.635) -- 0:02:56
Average standard deviation of split frequencies: 0.010791
373100 -- [-2071.397] (-2079.448) (-2073.867) (-2076.631) * (-2082.334) [-2072.671] (-2081.406) (-2079.520) -- 0:02:56
373200 -- (-2070.949) (-2089.811) (-2072.112) [-2072.060] * (-2077.526) (-2075.056) (-2075.877) [-2073.012] -- 0:02:56
373300 -- [-2072.710] (-2082.025) (-2068.629) (-2069.285) * [-2073.762] (-2073.680) (-2082.807) (-2076.861) -- 0:02:56
373400 -- (-2077.281) [-2075.800] (-2068.116) (-2074.147) * (-2078.090) [-2072.626] (-2078.790) (-2077.100) -- 0:02:56
373500 -- (-2086.513) [-2073.496] (-2077.818) (-2070.286) * (-2077.816) [-2073.172] (-2078.476) (-2081.766) -- 0:02:57
373600 -- (-2087.279) [-2072.970] (-2075.703) (-2067.727) * (-2086.761) [-2071.307] (-2077.315) (-2082.207) -- 0:02:57
373700 -- (-2080.903) [-2068.404] (-2079.600) (-2068.641) * (-2076.939) [-2075.779] (-2070.186) (-2084.079) -- 0:02:57
373800 -- (-2083.373) [-2068.970] (-2085.621) (-2073.643) * (-2090.636) [-2072.976] (-2070.674) (-2080.030) -- 0:02:57
373900 -- [-2078.014] (-2073.528) (-2079.247) (-2074.991) * (-2079.679) (-2070.553) [-2072.683] (-2082.097) -- 0:02:57
374000 -- [-2074.265] (-2070.233) (-2086.153) (-2082.255) * (-2075.811) (-2072.799) (-2080.969) [-2080.786] -- 0:02:57
Average standard deviation of split frequencies: 0.010332
374100 -- (-2076.803) [-2067.412] (-2081.779) (-2079.921) * (-2077.649) [-2071.255] (-2080.932) (-2088.617) -- 0:02:57
374200 -- (-2075.115) [-2068.698] (-2078.731) (-2090.596) * (-2076.464) [-2071.948] (-2076.762) (-2088.034) -- 0:02:57
374300 -- [-2071.948] (-2076.276) (-2082.580) (-2078.076) * [-2080.051] (-2078.697) (-2077.464) (-2085.524) -- 0:02:57
374400 -- (-2076.301) (-2070.974) [-2076.298] (-2074.741) * [-2083.419] (-2080.250) (-2076.031) (-2085.091) -- 0:02:57
374500 -- (-2073.874) [-2068.612] (-2078.239) (-2080.658) * [-2083.494] (-2080.511) (-2072.100) (-2079.998) -- 0:02:57
374600 -- (-2077.416) [-2071.071] (-2073.872) (-2083.918) * (-2080.556) (-2081.970) [-2070.233] (-2083.115) -- 0:02:56
374700 -- (-2081.125) (-2078.775) (-2076.928) [-2073.931] * (-2074.657) (-2079.492) (-2070.955) [-2088.916] -- 0:02:56
374800 -- (-2088.712) (-2074.423) (-2077.700) [-2070.973] * (-2085.078) [-2077.736] (-2076.012) (-2091.148) -- 0:02:56
374900 -- (-2086.167) (-2076.826) (-2082.202) [-2070.904] * (-2079.249) [-2075.162] (-2071.561) (-2087.318) -- 0:02:56
375000 -- [-2076.118] (-2081.048) (-2079.641) (-2071.884) * (-2079.151) [-2076.008] (-2076.549) (-2081.351) -- 0:02:56
Average standard deviation of split frequencies: 0.010446
375100 -- (-2077.575) (-2071.565) (-2083.764) [-2073.600] * [-2077.451] (-2080.955) (-2076.785) (-2079.030) -- 0:02:56
375200 -- (-2078.563) [-2069.993] (-2086.973) (-2080.683) * [-2079.508] (-2075.307) (-2071.199) (-2079.395) -- 0:02:56
375300 -- (-2082.813) [-2065.276] (-2085.184) (-2074.015) * [-2077.309] (-2079.932) (-2073.919) (-2082.101) -- 0:02:56
375400 -- (-2081.348) [-2066.519] (-2087.685) (-2077.022) * (-2082.866) (-2068.376) [-2069.268] (-2086.079) -- 0:02:56
375500 -- (-2077.158) (-2070.729) (-2077.339) [-2074.759] * (-2080.591) (-2071.581) [-2068.418] (-2089.594) -- 0:02:56
375600 -- (-2081.865) [-2079.095] (-2083.734) (-2077.182) * (-2079.252) (-2087.051) [-2071.845] (-2081.561) -- 0:02:56
375700 -- (-2077.371) [-2071.586] (-2093.166) (-2078.068) * (-2081.852) (-2071.615) [-2069.152] (-2083.239) -- 0:02:56
375800 -- (-2080.455) [-2069.901] (-2082.489) (-2080.587) * (-2076.389) (-2082.616) (-2073.296) [-2082.962] -- 0:02:56
375900 -- (-2077.228) (-2074.979) [-2085.525] (-2084.420) * (-2077.397) (-2069.926) [-2077.187] (-2079.437) -- 0:02:55
376000 -- (-2080.695) [-2078.250] (-2087.595) (-2084.255) * (-2082.377) [-2067.222] (-2074.453) (-2085.997) -- 0:02:55
Average standard deviation of split frequencies: 0.010635
376100 -- (-2081.141) [-2092.333] (-2083.789) (-2089.257) * [-2079.408] (-2069.673) (-2074.906) (-2081.390) -- 0:02:55
376200 -- (-2081.930) (-2082.827) (-2090.894) [-2078.584] * (-2095.242) [-2069.205] (-2076.761) (-2082.323) -- 0:02:55
376300 -- [-2076.627] (-2081.107) (-2080.456) (-2075.042) * (-2084.891) (-2074.430) [-2076.496] (-2081.302) -- 0:02:55
376400 -- [-2069.943] (-2083.672) (-2076.185) (-2083.440) * (-2082.180) (-2074.716) [-2073.812] (-2085.827) -- 0:02:55
376500 -- [-2072.373] (-2080.037) (-2078.753) (-2074.467) * (-2078.863) (-2079.861) [-2073.046] (-2097.060) -- 0:02:55
376600 -- (-2071.915) (-2078.308) (-2073.974) [-2077.476] * [-2074.642] (-2075.279) (-2071.512) (-2090.168) -- 0:02:55
376700 -- [-2070.321] (-2078.549) (-2075.082) (-2074.472) * (-2081.069) (-2080.982) (-2072.601) [-2081.628] -- 0:02:55
376800 -- (-2068.649) [-2077.288] (-2089.491) (-2076.126) * (-2087.944) [-2074.433] (-2081.410) (-2088.676) -- 0:02:55
376900 -- [-2070.118] (-2076.409) (-2090.487) (-2076.500) * (-2085.562) [-2077.728] (-2078.001) (-2082.565) -- 0:02:55
377000 -- [-2070.516] (-2087.653) (-2085.766) (-2071.096) * (-2094.406) [-2071.989] (-2075.772) (-2085.712) -- 0:02:56
Average standard deviation of split frequencies: 0.010284
377100 -- (-2076.637) (-2078.429) (-2086.248) [-2073.266] * (-2091.007) (-2067.914) (-2082.028) [-2080.671] -- 0:02:56
377200 -- [-2071.101] (-2081.405) (-2087.990) (-2068.581) * (-2083.619) (-2072.000) (-2080.618) [-2081.877] -- 0:02:56
377300 -- [-2068.746] (-2076.576) (-2084.936) (-2069.510) * (-2079.676) [-2073.238] (-2081.942) (-2077.098) -- 0:02:56
377400 -- [-2075.052] (-2076.363) (-2086.717) (-2080.283) * (-2079.062) (-2082.107) [-2075.553] (-2087.836) -- 0:02:56
377500 -- [-2076.938] (-2078.971) (-2083.206) (-2072.282) * (-2084.112) (-2075.061) [-2071.020] (-2080.342) -- 0:02:56
377600 -- (-2070.328) (-2072.097) (-2087.086) [-2074.522] * (-2086.607) (-2074.998) (-2072.191) [-2081.319] -- 0:02:56
377700 -- (-2073.063) (-2075.989) (-2093.809) [-2076.289] * (-2081.339) [-2078.039] (-2079.786) (-2078.615) -- 0:02:56
377800 -- (-2076.502) [-2072.482] (-2096.272) (-2074.442) * (-2082.206) (-2076.104) (-2079.103) [-2078.121] -- 0:02:56
377900 -- (-2081.565) (-2074.200) (-2095.258) [-2079.522] * (-2080.272) [-2072.442] (-2076.056) (-2089.699) -- 0:02:56
378000 -- (-2084.902) [-2074.385] (-2075.101) (-2086.226) * (-2078.000) (-2074.224) (-2083.838) [-2081.347] -- 0:02:56
Average standard deviation of split frequencies: 0.010329
378100 -- (-2082.897) (-2075.838) [-2074.660] (-2087.286) * (-2080.234) (-2078.755) [-2072.021] (-2078.954) -- 0:02:55
378200 -- (-2073.292) (-2071.440) [-2077.159] (-2092.291) * (-2087.165) [-2077.267] (-2078.587) (-2080.718) -- 0:02:55
378300 -- (-2079.341) [-2074.060] (-2076.716) (-2082.160) * (-2082.680) (-2081.622) (-2082.974) [-2077.685] -- 0:02:55
378400 -- [-2068.991] (-2074.830) (-2082.709) (-2083.995) * (-2080.045) (-2080.521) [-2077.320] (-2087.680) -- 0:02:55
378500 -- [-2065.541] (-2083.021) (-2080.973) (-2084.231) * (-2087.584) [-2078.107] (-2079.975) (-2084.997) -- 0:02:55
378600 -- [-2068.499] (-2086.065) (-2076.818) (-2078.989) * (-2092.457) (-2081.720) [-2074.495] (-2095.930) -- 0:02:55
378700 -- (-2069.727) (-2075.713) (-2084.751) [-2071.147] * (-2090.390) (-2077.243) [-2075.150] (-2088.767) -- 0:02:55
378800 -- [-2071.548] (-2076.143) (-2078.491) (-2071.499) * (-2077.460) [-2070.417] (-2077.983) (-2088.789) -- 0:02:55
378900 -- (-2073.247) (-2072.947) (-2081.815) [-2073.005] * (-2077.734) (-2084.011) (-2079.728) [-2082.092] -- 0:02:55
379000 -- (-2086.539) [-2070.723] (-2080.556) (-2072.333) * [-2077.320] (-2073.500) (-2084.125) (-2076.366) -- 0:02:55
Average standard deviation of split frequencies: 0.010194
379100 -- (-2083.916) [-2070.608] (-2076.737) (-2081.258) * (-2075.287) [-2073.854] (-2084.216) (-2078.279) -- 0:02:55
379200 -- (-2082.341) [-2075.730] (-2080.079) (-2082.174) * (-2081.435) [-2077.247] (-2094.356) (-2075.241) -- 0:02:55
379300 -- (-2079.686) [-2070.630] (-2074.194) (-2082.885) * (-2078.736) [-2069.642] (-2085.319) (-2076.590) -- 0:02:55
379400 -- (-2078.941) (-2078.139) [-2072.803] (-2080.195) * (-2078.284) [-2069.753] (-2073.684) (-2080.920) -- 0:02:55
379500 -- (-2075.682) (-2084.526) (-2078.554) [-2073.530] * (-2076.395) [-2075.927] (-2085.981) (-2082.177) -- 0:02:54
379600 -- (-2081.720) (-2081.730) [-2076.641] (-2070.102) * [-2075.168] (-2077.576) (-2074.685) (-2082.403) -- 0:02:54
379700 -- (-2086.768) (-2089.321) (-2081.340) [-2076.523] * (-2074.927) [-2071.722] (-2075.538) (-2078.047) -- 0:02:54
379800 -- (-2081.183) [-2077.788] (-2084.849) (-2076.122) * (-2079.178) [-2072.965] (-2080.842) (-2076.430) -- 0:02:54
379900 -- (-2089.538) [-2071.145] (-2080.717) (-2075.403) * (-2079.742) [-2076.782] (-2077.556) (-2077.405) -- 0:02:54
380000 -- (-2077.403) (-2076.831) [-2073.618] (-2073.035) * [-2077.250] (-2083.811) (-2082.408) (-2080.632) -- 0:02:54
Average standard deviation of split frequencies: 0.009921
380100 -- (-2081.491) (-2069.474) (-2081.236) [-2076.400] * (-2077.245) (-2078.323) (-2086.404) [-2081.943] -- 0:02:54
380200 -- (-2078.113) [-2070.503] (-2080.642) (-2079.623) * (-2078.387) (-2076.332) (-2091.206) [-2081.164] -- 0:02:54
380300 -- (-2072.968) [-2071.931] (-2078.981) (-2085.347) * (-2076.045) [-2072.010] (-2080.203) (-2079.165) -- 0:02:54
380400 -- (-2077.398) (-2071.632) (-2086.839) [-2077.339] * (-2087.145) (-2073.551) (-2081.364) [-2079.283] -- 0:02:54
380500 -- (-2072.436) (-2070.651) (-2079.600) [-2076.699] * (-2078.313) [-2069.870] (-2075.909) (-2075.191) -- 0:02:55
380600 -- (-2070.972) (-2071.520) (-2080.681) [-2069.705] * (-2082.174) (-2070.128) [-2071.328] (-2077.732) -- 0:02:55
380700 -- [-2073.147] (-2071.052) (-2080.366) (-2076.425) * (-2080.763) (-2079.750) [-2068.839] (-2077.849) -- 0:02:55
380800 -- (-2074.286) (-2073.758) [-2081.518] (-2079.011) * (-2083.156) (-2079.474) [-2074.434] (-2073.891) -- 0:02:55
380900 -- [-2069.909] (-2074.680) (-2077.900) (-2079.787) * (-2090.385) (-2078.659) [-2074.152] (-2072.396) -- 0:02:55
381000 -- (-2082.197) (-2077.050) (-2079.852) [-2072.200] * (-2090.255) (-2078.273) [-2068.977] (-2079.746) -- 0:02:55
Average standard deviation of split frequencies: 0.009575
381100 -- (-2081.183) [-2073.725] (-2079.187) (-2075.226) * (-2091.478) (-2069.504) [-2071.377] (-2083.461) -- 0:02:55
381200 -- (-2091.423) [-2070.128] (-2078.684) (-2078.072) * (-2086.015) (-2076.129) [-2076.657] (-2084.166) -- 0:02:55
381300 -- (-2078.951) (-2072.526) (-2084.492) [-2074.800] * (-2084.948) [-2069.376] (-2079.992) (-2075.024) -- 0:02:55
381400 -- (-2076.223) [-2075.955] (-2085.142) (-2073.575) * (-2086.010) (-2072.364) [-2070.671] (-2081.795) -- 0:02:55
381500 -- (-2073.666) (-2074.382) (-2087.096) [-2073.403] * (-2087.781) (-2068.528) [-2072.907] (-2083.126) -- 0:02:55
381600 -- (-2086.341) [-2077.539] (-2087.045) (-2070.038) * (-2080.368) [-2068.554] (-2071.019) (-2086.390) -- 0:02:55
381700 -- (-2102.702) (-2078.043) (-2088.266) [-2072.272] * (-2078.392) (-2074.838) [-2070.379] (-2090.448) -- 0:02:54
381800 -- (-2092.117) [-2076.537] (-2089.823) (-2077.417) * (-2081.486) [-2070.675] (-2069.312) (-2074.985) -- 0:02:54
381900 -- (-2079.928) (-2077.708) (-2085.146) [-2074.784] * (-2087.559) [-2069.420] (-2081.663) (-2076.152) -- 0:02:54
382000 -- (-2074.645) (-2078.637) (-2087.141) [-2070.315] * (-2087.182) [-2072.714] (-2072.886) (-2075.885) -- 0:02:54
Average standard deviation of split frequencies: 0.009552
382100 -- (-2080.191) (-2078.558) (-2086.583) [-2072.412] * (-2086.719) [-2069.823] (-2073.109) (-2072.605) -- 0:02:54
382200 -- (-2078.933) (-2080.678) (-2078.207) [-2074.482] * (-2091.785) [-2071.378] (-2079.583) (-2082.241) -- 0:02:54
382300 -- (-2082.635) (-2082.415) [-2077.105] (-2076.721) * (-2081.939) [-2070.652] (-2076.203) (-2079.344) -- 0:02:54
382400 -- (-2071.431) [-2079.296] (-2080.443) (-2074.816) * (-2081.717) [-2072.945] (-2074.722) (-2082.588) -- 0:02:54
382500 -- [-2070.764] (-2078.547) (-2080.127) (-2071.597) * (-2082.155) (-2083.114) (-2070.754) [-2077.607] -- 0:02:54
382600 -- [-2074.180] (-2084.104) (-2084.372) (-2072.038) * (-2081.279) (-2078.868) [-2070.155] (-2077.474) -- 0:02:54
382700 -- (-2082.356) (-2078.024) (-2080.758) [-2074.847] * (-2078.423) [-2072.834] (-2082.650) (-2079.001) -- 0:02:54
382800 -- [-2079.838] (-2078.786) (-2080.284) (-2072.904) * [-2073.088] (-2078.589) (-2073.356) (-2082.136) -- 0:02:54
382900 -- [-2076.667] (-2090.485) (-2086.494) (-2077.744) * (-2086.920) (-2080.622) [-2072.196] (-2083.136) -- 0:02:54
383000 -- (-2079.303) (-2086.006) (-2078.292) [-2074.147] * (-2080.943) (-2080.622) [-2076.070] (-2076.099) -- 0:02:53
Average standard deviation of split frequencies: 0.009666
383100 -- (-2076.911) (-2082.524) [-2072.456] (-2077.133) * (-2082.666) (-2070.532) [-2072.533] (-2080.304) -- 0:02:53
383200 -- (-2087.452) [-2077.154] (-2077.927) (-2084.708) * (-2078.112) (-2083.936) [-2070.471] (-2075.829) -- 0:02:53
383300 -- (-2082.323) (-2075.726) [-2075.410] (-2070.763) * (-2079.847) (-2084.759) [-2068.272] (-2079.489) -- 0:02:53
383400 -- (-2076.667) (-2084.079) (-2073.996) [-2069.949] * (-2075.502) (-2083.833) [-2078.118] (-2086.675) -- 0:02:53
383500 -- (-2071.065) (-2075.491) [-2076.489] (-2081.426) * (-2081.567) (-2082.346) [-2076.127] (-2087.508) -- 0:02:53
383600 -- (-2078.239) (-2079.785) (-2080.628) [-2072.835] * (-2080.809) [-2078.964] (-2075.875) (-2086.777) -- 0:02:53
383700 -- (-2082.999) [-2075.214] (-2085.589) (-2075.225) * [-2078.244] (-2078.313) (-2073.330) (-2084.086) -- 0:02:53
383800 -- (-2076.656) (-2073.375) (-2081.210) [-2072.607] * (-2085.043) (-2082.362) [-2073.447] (-2084.109) -- 0:02:53
383900 -- (-2074.358) (-2078.630) (-2076.433) [-2074.968] * (-2081.319) (-2090.244) [-2068.541] (-2092.767) -- 0:02:53
384000 -- (-2077.052) [-2079.151] (-2073.678) (-2081.021) * (-2085.075) (-2073.315) [-2071.787] (-2089.519) -- 0:02:54
Average standard deviation of split frequencies: 0.009677
384100 -- (-2075.065) (-2073.097) (-2078.474) [-2072.948] * [-2075.336] (-2086.089) (-2077.459) (-2099.490) -- 0:02:54
384200 -- (-2079.238) (-2071.548) (-2082.006) [-2072.731] * (-2074.327) (-2079.619) [-2068.518] (-2084.164) -- 0:02:54
384300 -- (-2091.967) (-2078.119) [-2076.391] (-2077.825) * (-2081.716) (-2072.127) [-2080.358] (-2082.890) -- 0:02:54
384400 -- (-2085.974) (-2074.552) [-2078.999] (-2069.741) * [-2079.923] (-2072.654) (-2077.147) (-2090.402) -- 0:02:54
384500 -- (-2080.900) [-2076.251] (-2082.415) (-2075.241) * (-2085.633) [-2070.757] (-2076.909) (-2078.806) -- 0:02:54
384600 -- [-2075.301] (-2077.372) (-2079.116) (-2077.831) * (-2080.499) [-2070.948] (-2079.954) (-2078.129) -- 0:02:54
384700 -- [-2073.588] (-2074.891) (-2078.811) (-2081.547) * (-2082.825) [-2072.554] (-2080.658) (-2080.805) -- 0:02:54
384800 -- (-2075.941) (-2076.557) (-2083.701) [-2077.262] * (-2088.773) [-2072.160] (-2089.062) (-2083.347) -- 0:02:54
384900 -- (-2075.866) (-2088.400) (-2080.296) [-2071.282] * (-2086.142) [-2073.429] (-2080.059) (-2086.398) -- 0:02:54
385000 -- [-2072.421] (-2090.275) (-2086.091) (-2071.718) * (-2089.703) [-2075.341] (-2077.041) (-2079.577) -- 0:02:54
Average standard deviation of split frequencies: 0.009720
385100 -- (-2068.675) (-2076.949) (-2087.087) [-2069.790] * (-2076.782) [-2074.568] (-2079.054) (-2084.787) -- 0:02:54
385200 -- (-2074.902) (-2068.449) (-2090.508) [-2074.655] * (-2079.063) (-2077.438) [-2078.405] (-2092.440) -- 0:02:53
385300 -- (-2078.012) (-2073.297) (-2081.875) [-2066.639] * (-2080.409) [-2073.331] (-2077.825) (-2081.349) -- 0:02:53
385400 -- (-2076.285) (-2071.848) (-2079.072) [-2071.926] * (-2084.263) [-2076.982] (-2076.653) (-2087.245) -- 0:02:53
385500 -- (-2076.237) (-2072.624) [-2079.828] (-2080.534) * (-2081.799) [-2075.901] (-2074.536) (-2084.277) -- 0:02:53
385600 -- (-2075.518) [-2074.557] (-2095.792) (-2080.390) * (-2090.115) (-2078.299) [-2078.843] (-2079.784) -- 0:02:53
385700 -- (-2088.472) (-2077.315) (-2087.574) [-2075.307] * [-2083.361] (-2077.842) (-2077.851) (-2080.424) -- 0:02:53
385800 -- (-2084.887) [-2076.103] (-2091.369) (-2077.981) * (-2088.821) (-2075.603) (-2074.414) [-2079.690] -- 0:02:53
385900 -- (-2086.811) [-2072.749] (-2089.415) (-2072.879) * (-2096.225) (-2073.748) [-2066.698] (-2079.609) -- 0:02:53
386000 -- (-2084.640) (-2073.565) (-2080.503) [-2076.688] * (-2096.214) (-2072.224) [-2071.451] (-2076.536) -- 0:02:53
Average standard deviation of split frequencies: 0.010255
386100 -- (-2080.235) [-2079.649] (-2077.038) (-2071.079) * (-2088.147) (-2074.401) [-2069.918] (-2080.149) -- 0:02:53
386200 -- (-2079.182) [-2076.730] (-2078.414) (-2072.232) * (-2084.713) (-2071.150) [-2069.488] (-2078.284) -- 0:02:53
386300 -- (-2074.146) (-2072.453) (-2082.997) [-2070.535] * (-2086.006) (-2072.388) [-2075.732] (-2083.423) -- 0:02:53
386400 -- (-2073.061) (-2079.061) (-2080.468) [-2074.365] * (-2086.858) [-2074.531] (-2085.119) (-2078.437) -- 0:02:53
386500 -- (-2073.783) (-2080.806) (-2080.832) [-2079.977] * (-2085.737) (-2079.932) [-2072.900] (-2083.821) -- 0:02:53
386600 -- [-2071.598] (-2075.615) (-2081.756) (-2084.639) * (-2078.909) (-2087.946) [-2073.774] (-2078.935) -- 0:02:52
386700 -- [-2071.588] (-2080.323) (-2083.261) (-2086.632) * (-2077.386) (-2080.583) [-2071.394] (-2094.233) -- 0:02:52
386800 -- [-2072.098] (-2079.411) (-2082.867) (-2091.216) * (-2079.076) [-2072.442] (-2074.465) (-2080.209) -- 0:02:52
386900 -- [-2068.934] (-2075.794) (-2079.146) (-2087.632) * [-2082.207] (-2072.072) (-2079.749) (-2076.960) -- 0:02:52
387000 -- [-2071.138] (-2080.312) (-2079.096) (-2086.216) * (-2084.214) [-2068.684] (-2080.464) (-2080.051) -- 0:02:52
Average standard deviation of split frequencies: 0.009809
387100 -- [-2070.209] (-2075.810) (-2080.975) (-2088.364) * (-2084.123) [-2072.672] (-2080.194) (-2091.763) -- 0:02:52
387200 -- (-2072.580) [-2072.440] (-2077.895) (-2078.634) * (-2089.493) (-2074.338) [-2070.830] (-2087.192) -- 0:02:52
387300 -- (-2072.894) [-2075.367] (-2080.177) (-2077.545) * (-2082.837) (-2075.120) (-2079.043) [-2085.725] -- 0:02:52
387400 -- (-2075.883) [-2074.825] (-2083.287) (-2076.096) * (-2084.150) [-2074.725] (-2075.088) (-2083.336) -- 0:02:52
387500 -- (-2079.167) (-2081.252) (-2079.783) [-2075.779] * (-2091.451) (-2074.728) (-2074.693) [-2080.521] -- 0:02:53
387600 -- (-2075.014) (-2084.294) (-2085.986) [-2072.773] * (-2085.356) [-2068.661] (-2080.379) (-2082.046) -- 0:02:53
387700 -- (-2075.877) (-2074.108) (-2088.062) [-2072.415] * (-2089.545) [-2074.455] (-2080.544) (-2083.720) -- 0:02:53
387800 -- [-2071.459] (-2074.889) (-2085.081) (-2076.883) * (-2092.511) [-2068.829] (-2072.735) (-2085.209) -- 0:02:53
387900 -- (-2078.540) [-2078.151] (-2089.268) (-2075.166) * (-2091.531) (-2072.246) [-2074.753] (-2076.098) -- 0:02:53
388000 -- [-2068.127] (-2071.891) (-2095.012) (-2076.198) * (-2100.466) [-2077.113] (-2073.675) (-2083.044) -- 0:02:53
Average standard deviation of split frequencies: 0.009925
388100 -- [-2067.486] (-2073.867) (-2089.748) (-2084.860) * (-2111.366) [-2073.766] (-2073.222) (-2076.053) -- 0:02:53
388200 -- [-2070.646] (-2076.030) (-2084.772) (-2078.105) * (-2096.869) (-2070.122) (-2075.604) [-2076.565] -- 0:02:53
388300 -- [-2069.584] (-2072.812) (-2085.108) (-2067.888) * (-2089.712) [-2070.099] (-2073.825) (-2075.072) -- 0:02:53
388400 -- [-2067.719] (-2083.910) (-2087.640) (-2076.024) * (-2090.544) [-2070.239] (-2073.440) (-2080.732) -- 0:02:53
388500 -- [-2067.653] (-2081.637) (-2095.399) (-2074.813) * (-2098.946) [-2069.233] (-2077.406) (-2075.554) -- 0:02:53
388600 -- [-2073.749] (-2083.366) (-2094.963) (-2079.783) * (-2092.912) [-2071.439] (-2069.806) (-2080.230) -- 0:02:53
388700 -- [-2072.394] (-2080.492) (-2082.183) (-2076.035) * (-2087.073) (-2074.574) (-2065.542) [-2081.015] -- 0:02:52
388800 -- (-2077.731) (-2083.859) (-2084.969) [-2069.110] * (-2089.872) [-2071.904] (-2071.329) (-2079.829) -- 0:02:52
388900 -- (-2078.372) [-2081.890] (-2088.552) (-2075.676) * (-2082.705) (-2077.016) [-2070.924] (-2078.523) -- 0:02:52
389000 -- (-2089.732) [-2070.957] (-2085.687) (-2074.193) * (-2078.694) (-2074.491) [-2070.511] (-2078.969) -- 0:02:52
Average standard deviation of split frequencies: 0.009932
389100 -- [-2077.934] (-2072.757) (-2087.887) (-2077.161) * [-2077.548] (-2074.851) (-2071.362) (-2088.156) -- 0:02:52
389200 -- (-2084.286) [-2075.912] (-2084.281) (-2091.087) * (-2079.269) (-2077.034) [-2067.447] (-2085.990) -- 0:02:52
389300 -- (-2079.826) [-2074.456] (-2090.238) (-2087.233) * (-2081.879) (-2077.205) (-2071.904) [-2077.204] -- 0:02:52
389400 -- (-2079.718) [-2072.024] (-2095.260) (-2086.684) * (-2083.280) (-2076.312) [-2072.233] (-2083.120) -- 0:02:52
389500 -- (-2079.796) [-2068.932] (-2078.794) (-2074.562) * (-2081.980) (-2073.642) [-2071.490] (-2082.944) -- 0:02:52
389600 -- (-2083.495) (-2071.210) [-2079.175] (-2077.042) * (-2078.974) (-2077.304) [-2074.647] (-2078.673) -- 0:02:52
389700 -- (-2078.776) [-2073.953] (-2086.553) (-2077.022) * (-2086.912) (-2078.191) [-2071.217] (-2078.358) -- 0:02:52
389800 -- [-2073.680] (-2079.620) (-2082.479) (-2075.762) * (-2082.869) (-2079.816) (-2078.998) [-2079.472] -- 0:02:52
389900 -- (-2074.917) [-2077.060] (-2088.426) (-2071.652) * (-2082.235) (-2082.514) [-2077.003] (-2083.511) -- 0:02:52
390000 -- (-2077.487) (-2078.786) (-2080.439) [-2073.616] * (-2077.751) (-2088.050) [-2070.816] (-2087.365) -- 0:02:52
Average standard deviation of split frequencies: 0.010426
390100 -- (-2096.405) [-2071.237] (-2080.101) (-2073.799) * (-2086.791) (-2092.785) [-2074.122] (-2082.457) -- 0:02:51
390200 -- (-2088.243) (-2075.141) (-2084.694) [-2070.238] * (-2085.958) (-2078.865) [-2075.653] (-2097.744) -- 0:02:51
390300 -- (-2092.509) (-2074.373) (-2080.076) [-2074.983] * (-2088.395) (-2084.048) [-2067.288] (-2095.321) -- 0:02:51
390400 -- (-2091.772) (-2070.859) (-2079.882) [-2075.824] * (-2081.988) (-2086.101) [-2068.275] (-2084.088) -- 0:02:51
390500 -- (-2083.564) (-2078.436) [-2073.762] (-2075.275) * (-2078.838) (-2080.980) [-2069.976] (-2087.662) -- 0:02:51
390600 -- (-2087.286) (-2072.059) (-2082.816) [-2072.176] * (-2080.841) (-2076.309) [-2071.850] (-2090.958) -- 0:02:51
390700 -- (-2082.494) (-2076.650) (-2083.152) [-2072.658] * [-2077.235] (-2082.555) (-2074.584) (-2084.000) -- 0:02:51
390800 -- (-2085.889) [-2069.297] (-2080.776) (-2077.380) * (-2086.123) (-2084.296) [-2068.366] (-2078.549) -- 0:02:51
390900 -- (-2080.976) (-2074.774) (-2077.969) [-2071.562] * (-2093.527) (-2078.401) [-2068.230] (-2080.607) -- 0:02:51
391000 -- (-2078.402) (-2074.179) (-2077.777) [-2070.805] * (-2089.308) [-2076.003] (-2076.286) (-2077.081) -- 0:02:51
Average standard deviation of split frequencies: 0.010225
391100 -- (-2084.382) (-2067.951) (-2073.496) [-2069.019] * (-2085.004) (-2071.952) [-2070.111] (-2083.321) -- 0:02:52
391200 -- (-2082.471) [-2071.325] (-2084.219) (-2077.321) * (-2082.910) (-2075.609) [-2069.320] (-2080.694) -- 0:02:52
391300 -- (-2084.168) [-2071.744] (-2079.106) (-2085.598) * (-2085.751) (-2078.084) [-2069.340] (-2081.105) -- 0:02:52
391400 -- (-2082.759) (-2072.259) (-2080.022) [-2077.243] * (-2079.536) [-2087.544] (-2076.986) (-2084.357) -- 0:02:52
391500 -- (-2076.097) [-2072.945] (-2081.601) (-2070.956) * (-2083.320) (-2090.991) (-2076.578) [-2080.352] -- 0:02:52
391600 -- [-2069.549] (-2072.020) (-2079.067) (-2079.555) * (-2086.141) (-2090.703) [-2074.579] (-2077.070) -- 0:02:52
391700 -- (-2080.133) [-2077.600] (-2083.698) (-2075.186) * (-2094.357) (-2081.177) (-2072.655) [-2074.837] -- 0:02:52
391800 -- (-2084.273) [-2072.751] (-2086.472) (-2070.808) * (-2083.409) [-2074.135] (-2071.338) (-2074.626) -- 0:02:52
391900 -- (-2088.610) (-2073.816) (-2084.103) [-2075.895] * (-2081.465) (-2075.791) [-2071.664] (-2076.558) -- 0:02:52
392000 -- (-2085.328) [-2071.408] (-2082.064) (-2082.797) * (-2085.796) [-2068.610] (-2069.080) (-2078.974) -- 0:02:52
Average standard deviation of split frequencies: 0.010029
392100 -- (-2082.304) [-2067.065] (-2081.023) (-2074.606) * (-2082.842) [-2073.640] (-2075.199) (-2076.066) -- 0:02:52
392200 -- (-2085.755) [-2069.790] (-2083.755) (-2074.163) * (-2079.017) [-2071.711] (-2074.905) (-2092.934) -- 0:02:52
392300 -- [-2084.538] (-2096.152) (-2079.595) (-2070.970) * [-2081.568] (-2078.192) (-2074.796) (-2097.453) -- 0:02:51
392400 -- [-2072.735] (-2085.086) (-2077.681) (-2077.879) * (-2079.521) (-2085.560) [-2071.887] (-2085.403) -- 0:02:51
392500 -- (-2072.430) [-2075.219] (-2084.145) (-2071.316) * (-2083.450) (-2085.207) [-2075.552] (-2081.163) -- 0:02:51
392600 -- [-2071.021] (-2085.026) (-2081.495) (-2077.729) * (-2080.205) (-2078.264) [-2069.808] (-2085.179) -- 0:02:51
392700 -- [-2066.377] (-2072.467) (-2089.323) (-2076.588) * (-2080.003) (-2081.383) [-2071.529] (-2082.565) -- 0:02:51
392800 -- [-2074.663] (-2071.678) (-2084.741) (-2076.113) * (-2078.224) (-2091.482) [-2070.955] (-2078.702) -- 0:02:51
392900 -- (-2072.145) (-2069.924) (-2080.896) [-2071.937] * [-2079.555] (-2081.285) (-2071.627) (-2081.579) -- 0:02:51
393000 -- (-2073.465) [-2072.966] (-2079.432) (-2078.808) * (-2082.763) (-2080.583) [-2075.359] (-2082.158) -- 0:02:51
Average standard deviation of split frequencies: 0.010071
393100 -- (-2073.655) [-2073.419] (-2083.813) (-2078.354) * [-2081.577] (-2089.132) (-2075.255) (-2083.907) -- 0:02:51
393200 -- (-2079.294) (-2076.882) (-2077.808) [-2072.785] * (-2073.193) (-2083.925) [-2073.105] (-2082.018) -- 0:02:51
393300 -- (-2074.431) [-2070.848] (-2082.380) (-2080.265) * (-2076.081) [-2075.579] (-2076.410) (-2083.721) -- 0:02:51
393400 -- [-2070.996] (-2073.901) (-2081.360) (-2076.003) * (-2080.209) [-2072.965] (-2078.476) (-2074.905) -- 0:02:51
393500 -- (-2070.599) [-2071.822] (-2089.339) (-2078.426) * [-2075.398] (-2083.338) (-2073.933) (-2075.075) -- 0:02:51
393600 -- [-2071.896] (-2078.575) (-2083.948) (-2082.142) * (-2077.353) (-2079.200) [-2074.058] (-2083.041) -- 0:02:51
393700 -- (-2072.561) [-2075.595] (-2088.119) (-2086.718) * (-2080.803) [-2075.489] (-2072.773) (-2084.943) -- 0:02:50
393800 -- (-2074.686) [-2069.599] (-2077.422) (-2078.120) * (-2081.459) [-2074.673] (-2077.501) (-2085.647) -- 0:02:50
393900 -- (-2072.819) (-2072.497) (-2078.983) [-2081.186] * (-2079.962) (-2078.901) [-2073.172] (-2077.363) -- 0:02:50
394000 -- (-2079.840) [-2072.221] (-2077.051) (-2082.886) * [-2082.582] (-2081.980) (-2074.181) (-2081.809) -- 0:02:50
Average standard deviation of split frequencies: 0.009842
394100 -- [-2075.710] (-2078.011) (-2079.121) (-2079.538) * (-2079.368) (-2079.040) [-2076.941] (-2076.863) -- 0:02:50
394200 -- (-2077.528) (-2082.589) (-2080.205) [-2074.705] * (-2082.967) [-2077.451] (-2073.246) (-2079.547) -- 0:02:50
394300 -- [-2076.432] (-2079.395) (-2073.559) (-2077.405) * (-2081.849) (-2071.588) [-2073.356] (-2079.114) -- 0:02:50
394400 -- (-2079.512) (-2073.647) [-2075.968] (-2079.061) * (-2088.668) (-2079.510) (-2074.550) [-2073.937] -- 0:02:50
394500 -- (-2077.397) [-2072.791] (-2078.996) (-2073.791) * (-2079.138) (-2080.716) [-2068.865] (-2078.114) -- 0:02:50
394600 -- (-2083.904) [-2075.163] (-2082.453) (-2079.734) * (-2077.624) [-2077.033] (-2075.393) (-2083.912) -- 0:02:51
394700 -- (-2077.422) (-2076.820) (-2082.086) [-2081.995] * (-2079.091) [-2072.440] (-2079.248) (-2091.333) -- 0:02:51
394800 -- [-2071.757] (-2083.129) (-2083.167) (-2080.190) * (-2075.787) [-2071.316] (-2079.285) (-2076.974) -- 0:02:51
394900 -- (-2074.076) [-2075.260] (-2082.631) (-2079.709) * (-2082.404) [-2072.086] (-2092.092) (-2082.649) -- 0:02:51
395000 -- (-2072.699) [-2075.832] (-2089.561) (-2081.703) * (-2086.433) (-2072.281) (-2078.599) [-2073.075] -- 0:02:51
Average standard deviation of split frequencies: 0.009372
395100 -- [-2068.379] (-2077.759) (-2094.151) (-2076.039) * (-2083.234) (-2080.650) [-2078.361] (-2078.056) -- 0:02:51
395200 -- [-2071.413] (-2071.781) (-2081.266) (-2077.591) * (-2089.106) (-2080.478) (-2078.619) [-2076.796] -- 0:02:51
395300 -- [-2070.467] (-2078.647) (-2081.274) (-2071.302) * (-2082.792) (-2077.497) [-2080.071] (-2082.684) -- 0:02:51
395400 -- [-2074.728] (-2075.824) (-2086.506) (-2069.901) * (-2079.554) (-2075.168) [-2076.414] (-2082.087) -- 0:02:51
395500 -- [-2075.323] (-2073.748) (-2078.424) (-2072.508) * (-2082.388) [-2067.097] (-2075.458) (-2084.280) -- 0:02:51
395600 -- (-2073.918) (-2073.936) (-2077.524) [-2067.622] * (-2087.179) (-2068.781) [-2070.981] (-2091.660) -- 0:02:51
395700 -- (-2077.111) (-2071.881) (-2079.427) [-2069.742] * (-2082.211) [-2070.449] (-2073.215) (-2080.838) -- 0:02:51
395800 -- (-2072.178) [-2069.638] (-2089.032) (-2071.126) * (-2087.900) [-2073.775] (-2082.035) (-2082.341) -- 0:02:50
395900 -- (-2078.921) (-2075.092) (-2081.002) [-2073.191] * (-2085.920) (-2075.488) [-2077.139] (-2081.780) -- 0:02:50
396000 -- (-2075.139) (-2072.706) [-2080.271] (-2077.907) * (-2089.331) (-2079.597) [-2078.070] (-2088.400) -- 0:02:50
Average standard deviation of split frequencies: 0.009520
396100 -- (-2075.765) [-2076.761] (-2085.031) (-2077.222) * (-2080.115) [-2073.996] (-2077.388) (-2081.659) -- 0:02:50
396200 -- (-2074.190) (-2072.209) (-2086.624) [-2076.213] * (-2088.074) [-2073.269] (-2079.541) (-2084.364) -- 0:02:50
396300 -- (-2074.117) [-2070.971] (-2079.775) (-2081.007) * (-2087.299) (-2076.265) [-2075.259] (-2083.590) -- 0:02:50
396400 -- (-2080.271) [-2071.327] (-2079.294) (-2075.242) * (-2080.219) [-2075.881] (-2072.007) (-2079.500) -- 0:02:50
396500 -- (-2082.740) [-2072.585] (-2076.248) (-2072.816) * (-2089.007) [-2069.129] (-2074.935) (-2077.533) -- 0:02:50
396600 -- (-2081.536) (-2071.538) (-2076.460) [-2071.319] * (-2087.608) [-2068.586] (-2080.441) (-2082.595) -- 0:02:50
396700 -- [-2078.036] (-2074.808) (-2078.431) (-2071.002) * (-2084.809) [-2071.560] (-2074.462) (-2078.273) -- 0:02:50
396800 -- [-2073.915] (-2081.886) (-2086.093) (-2077.627) * (-2085.529) (-2078.529) (-2073.426) [-2074.224] -- 0:02:50
396900 -- (-2079.305) [-2074.825] (-2089.258) (-2073.753) * (-2082.899) [-2077.583] (-2078.579) (-2077.610) -- 0:02:50
397000 -- [-2083.782] (-2080.915) (-2073.433) (-2068.505) * (-2084.481) (-2077.788) [-2069.036] (-2082.089) -- 0:02:50
Average standard deviation of split frequencies: 0.009461
397100 -- (-2089.864) [-2070.913] (-2076.984) (-2078.442) * (-2075.848) (-2080.690) [-2067.332] (-2079.452) -- 0:02:50
397200 -- [-2073.501] (-2080.348) (-2080.607) (-2073.068) * [-2079.418] (-2079.984) (-2082.772) (-2074.131) -- 0:02:49
397300 -- (-2072.054) [-2082.179] (-2075.011) (-2077.845) * (-2080.285) (-2080.094) (-2083.186) [-2078.437] -- 0:02:49
397400 -- [-2070.852] (-2077.971) (-2075.730) (-2071.272) * (-2080.626) (-2076.129) [-2074.795] (-2073.577) -- 0:02:49
397500 -- [-2068.007] (-2085.673) (-2083.061) (-2071.928) * (-2082.553) (-2074.224) [-2073.162] (-2086.374) -- 0:02:49
397600 -- (-2071.381) (-2076.463) (-2080.703) [-2075.039] * (-2084.966) (-2075.369) [-2080.896] (-2084.420) -- 0:02:49
397700 -- [-2072.635] (-2070.379) (-2079.201) (-2084.049) * [-2077.669] (-2074.859) (-2080.228) (-2088.338) -- 0:02:49
397800 -- (-2078.116) [-2069.395] (-2078.149) (-2076.049) * (-2080.446) [-2074.824] (-2083.188) (-2081.066) -- 0:02:49
397900 -- (-2073.532) [-2071.055] (-2080.342) (-2075.740) * [-2077.931] (-2081.214) (-2085.236) (-2084.985) -- 0:02:49
398000 -- (-2087.643) (-2075.698) [-2080.838] (-2077.609) * (-2078.919) (-2084.923) [-2077.668] (-2085.577) -- 0:02:49
Average standard deviation of split frequencies: 0.009844
398100 -- (-2080.165) (-2078.871) (-2071.572) [-2076.012] * (-2079.410) (-2086.320) [-2076.148] (-2086.075) -- 0:02:50
398200 -- (-2090.069) (-2071.151) [-2072.286] (-2077.856) * [-2079.900] (-2093.575) (-2075.883) (-2091.452) -- 0:02:50
398300 -- (-2082.261) [-2076.699] (-2072.791) (-2077.478) * (-2078.947) (-2090.802) [-2076.803] (-2087.162) -- 0:02:50
398400 -- (-2076.108) (-2078.721) [-2073.616] (-2083.581) * (-2078.957) (-2085.292) (-2081.659) [-2077.327] -- 0:02:50
398500 -- (-2077.496) (-2081.318) (-2075.940) [-2074.700] * (-2077.409) (-2082.097) (-2080.440) [-2079.405] -- 0:02:50
398600 -- (-2075.442) (-2082.986) (-2077.897) [-2070.203] * (-2082.700) (-2084.694) (-2082.565) [-2077.631] -- 0:02:50
398700 -- [-2072.906] (-2080.945) (-2083.236) (-2074.240) * (-2083.343) [-2078.556] (-2079.580) (-2081.806) -- 0:02:50
398800 -- [-2069.158] (-2080.373) (-2079.892) (-2071.388) * (-2084.470) (-2080.942) [-2074.108] (-2082.625) -- 0:02:50
398900 -- [-2067.757] (-2089.922) (-2077.225) (-2078.190) * (-2082.255) (-2081.841) (-2078.070) [-2078.985] -- 0:02:50
399000 -- [-2070.632] (-2089.716) (-2079.109) (-2072.199) * [-2078.780] (-2082.046) (-2071.496) (-2079.667) -- 0:02:50
Average standard deviation of split frequencies: 0.010054
399100 -- (-2069.215) (-2083.632) (-2077.120) [-2074.057] * (-2081.250) (-2085.478) (-2076.055) [-2074.565] -- 0:02:50
399200 -- [-2078.991] (-2084.993) (-2084.101) (-2074.121) * [-2080.214] (-2088.695) (-2074.644) (-2078.668) -- 0:02:50
399300 -- (-2078.753) (-2085.811) [-2075.184] (-2072.966) * (-2076.522) (-2088.244) [-2070.426] (-2083.303) -- 0:02:49
399400 -- [-2069.188] (-2099.591) (-2084.752) (-2070.995) * (-2081.465) (-2095.844) [-2075.170] (-2080.171) -- 0:02:49
399500 -- [-2070.515] (-2091.963) (-2088.057) (-2075.402) * (-2078.212) (-2088.731) [-2073.398] (-2080.623) -- 0:02:49
399600 -- [-2073.920] (-2090.786) (-2082.538) (-2072.877) * (-2077.605) (-2097.530) [-2069.434] (-2089.688) -- 0:02:49
399700 -- [-2074.242] (-2078.112) (-2079.033) (-2074.372) * [-2077.677] (-2089.190) (-2075.204) (-2084.231) -- 0:02:49
399800 -- [-2074.739] (-2084.398) (-2074.832) (-2069.552) * (-2079.622) (-2088.809) [-2069.737] (-2081.275) -- 0:02:49
399900 -- [-2071.929] (-2081.292) (-2078.557) (-2068.784) * (-2082.275) (-2084.202) [-2070.780] (-2078.433) -- 0:02:49
400000 -- [-2075.054] (-2076.128) (-2089.012) (-2075.216) * (-2087.772) (-2080.223) [-2077.833] (-2076.071) -- 0:02:49
Average standard deviation of split frequencies: 0.009526
400100 -- (-2075.469) (-2078.239) (-2086.374) [-2074.678] * (-2081.042) (-2078.665) [-2077.298] (-2083.465) -- 0:02:49
400200 -- (-2072.935) (-2078.463) [-2071.376] (-2075.949) * (-2083.321) [-2074.529] (-2076.028) (-2078.444) -- 0:02:49
400300 -- (-2079.638) (-2070.981) (-2073.525) [-2074.229] * (-2075.642) [-2075.045] (-2073.624) (-2086.519) -- 0:02:49
400400 -- (-2082.609) (-2074.867) (-2081.285) [-2070.516] * (-2079.678) [-2077.113] (-2071.797) (-2087.811) -- 0:02:49
400500 -- (-2075.851) (-2072.717) (-2076.204) [-2073.095] * (-2082.109) (-2078.358) [-2070.193] (-2077.852) -- 0:02:49
400600 -- (-2078.012) (-2077.632) (-2075.320) [-2072.533] * (-2084.082) (-2078.478) [-2070.812] (-2082.644) -- 0:02:49
400700 -- (-2080.630) (-2072.492) (-2074.906) [-2067.918] * (-2083.814) (-2080.004) (-2079.171) [-2074.502] -- 0:02:49
400800 -- (-2077.539) [-2071.723] (-2079.116) (-2076.821) * (-2083.332) [-2075.127] (-2072.016) (-2075.965) -- 0:02:48
400900 -- (-2074.108) [-2071.694] (-2080.666) (-2075.816) * (-2088.378) (-2083.269) (-2076.658) [-2082.828] -- 0:02:48
401000 -- [-2074.274] (-2074.746) (-2079.622) (-2076.691) * (-2094.989) (-2079.295) (-2076.340) [-2073.221] -- 0:02:48
Average standard deviation of split frequencies: 0.009366
401100 -- (-2073.764) [-2074.004] (-2083.588) (-2074.106) * (-2083.393) (-2076.180) (-2090.614) [-2080.900] -- 0:02:48
401200 -- [-2072.049] (-2075.032) (-2088.759) (-2077.384) * [-2074.683] (-2088.934) (-2088.773) (-2080.114) -- 0:02:48
401300 -- (-2083.227) [-2070.971] (-2075.241) (-2076.355) * (-2077.657) (-2077.551) (-2080.832) [-2077.049] -- 0:02:48
401400 -- [-2075.239] (-2073.832) (-2078.487) (-2074.181) * (-2078.392) (-2077.452) [-2071.807] (-2080.046) -- 0:02:48
401500 -- (-2085.480) (-2073.713) (-2078.901) [-2078.469] * (-2085.009) (-2077.633) (-2078.650) [-2077.208] -- 0:02:48
401600 -- [-2085.252] (-2072.179) (-2087.030) (-2074.295) * (-2079.039) [-2081.789] (-2078.980) (-2080.513) -- 0:02:49
401700 -- (-2079.378) [-2070.287] (-2082.594) (-2076.500) * (-2082.972) (-2081.401) (-2073.164) [-2080.193] -- 0:02:49
401800 -- (-2081.193) (-2076.783) (-2084.995) [-2073.789] * (-2079.335) (-2080.356) [-2072.862] (-2088.214) -- 0:02:49
401900 -- (-2079.348) [-2074.035] (-2075.044) (-2079.394) * (-2082.968) (-2073.167) [-2068.723] (-2084.502) -- 0:02:49
402000 -- (-2079.524) (-2072.246) [-2075.004] (-2071.181) * (-2079.927) (-2077.421) [-2070.871] (-2086.965) -- 0:02:49
Average standard deviation of split frequencies: 0.009244
402100 -- (-2078.173) [-2073.624] (-2074.764) (-2072.776) * [-2086.529] (-2079.707) (-2072.903) (-2092.384) -- 0:02:49
402200 -- (-2084.167) (-2082.740) (-2073.579) [-2070.563] * (-2079.707) (-2086.801) [-2071.041] (-2092.980) -- 0:02:49
402300 -- (-2081.491) (-2075.540) [-2073.420] (-2072.062) * (-2077.925) (-2083.666) [-2070.616] (-2088.118) -- 0:02:49
402400 -- (-2081.116) (-2077.485) (-2079.728) [-2077.297] * [-2081.244] (-2078.938) (-2070.355) (-2076.895) -- 0:02:49
402500 -- (-2090.115) (-2072.857) [-2077.405] (-2080.605) * (-2081.119) (-2079.197) (-2075.113) [-2074.310] -- 0:02:49
402600 -- (-2096.539) [-2071.751] (-2074.786) (-2076.308) * [-2072.478] (-2084.810) (-2075.266) (-2076.922) -- 0:02:49
402700 -- (-2087.686) [-2073.444] (-2072.737) (-2073.241) * (-2086.104) (-2081.701) [-2072.342] (-2075.339) -- 0:02:49
402800 -- (-2090.986) [-2073.991] (-2080.281) (-2078.585) * [-2074.357] (-2082.342) (-2074.717) (-2072.986) -- 0:02:49
402900 -- [-2076.357] (-2077.430) (-2074.482) (-2069.042) * (-2086.678) [-2077.942] (-2080.269) (-2083.083) -- 0:02:48
403000 -- (-2080.126) [-2072.531] (-2074.617) (-2072.354) * (-2091.258) (-2080.816) [-2069.615] (-2072.314) -- 0:02:48
Average standard deviation of split frequencies: 0.008986
403100 -- (-2078.046) (-2075.145) (-2075.097) [-2070.361] * (-2083.676) (-2075.901) [-2071.714] (-2086.356) -- 0:02:48
403200 -- (-2077.347) (-2070.714) (-2084.005) [-2069.642] * (-2088.797) [-2078.668] (-2069.949) (-2088.024) -- 0:02:48
403300 -- (-2084.406) [-2074.926] (-2084.379) (-2074.669) * (-2084.431) (-2080.409) [-2075.024] (-2083.099) -- 0:02:48
403400 -- (-2086.131) [-2070.783] (-2074.382) (-2070.558) * (-2094.428) [-2077.665] (-2074.158) (-2086.185) -- 0:02:48
403500 -- (-2085.396) (-2067.749) [-2072.270] (-2071.970) * (-2085.465) (-2074.498) [-2071.489] (-2084.804) -- 0:02:48
403600 -- (-2089.469) [-2075.610] (-2083.808) (-2069.208) * (-2090.746) [-2078.607] (-2074.462) (-2089.938) -- 0:02:48
403700 -- (-2083.248) [-2075.811] (-2075.546) (-2076.591) * (-2086.081) (-2079.361) [-2072.193] (-2080.034) -- 0:02:48
403800 -- (-2084.227) (-2067.887) (-2081.540) [-2072.441] * (-2090.940) (-2078.081) [-2075.402] (-2078.792) -- 0:02:48
403900 -- (-2090.914) [-2067.579] (-2079.877) (-2077.314) * (-2090.356) [-2071.525] (-2078.306) (-2075.385) -- 0:02:48
404000 -- (-2094.880) (-2073.779) [-2075.234] (-2072.508) * (-2087.911) (-2080.630) [-2073.107] (-2096.208) -- 0:02:48
Average standard deviation of split frequencies: 0.009065
404100 -- (-2090.242) [-2071.695] (-2081.282) (-2083.518) * (-2081.328) (-2080.892) [-2074.321] (-2080.377) -- 0:02:48
404200 -- (-2080.077) [-2074.785] (-2083.054) (-2089.037) * (-2083.936) (-2077.105) (-2070.959) [-2074.530] -- 0:02:48
404300 -- (-2080.024) [-2070.660] (-2076.125) (-2077.047) * (-2083.466) (-2080.515) (-2077.487) [-2077.916] -- 0:02:47
404400 -- (-2091.607) [-2069.127] (-2077.285) (-2073.470) * (-2084.096) [-2076.140] (-2075.214) (-2080.958) -- 0:02:47
404500 -- (-2091.777) (-2069.540) [-2075.048] (-2071.557) * (-2079.255) (-2082.012) (-2079.689) [-2075.493] -- 0:02:47
404600 -- (-2087.634) (-2070.796) (-2074.168) [-2077.097] * (-2079.971) [-2079.722] (-2078.147) (-2083.093) -- 0:02:47
404700 -- (-2078.394) (-2071.909) (-2087.559) [-2072.665] * (-2087.216) [-2081.106] (-2084.324) (-2078.572) -- 0:02:47
404800 -- (-2082.502) (-2072.046) (-2089.895) [-2070.779] * (-2080.284) [-2077.006] (-2072.519) (-2078.808) -- 0:02:47
404900 -- (-2078.230) [-2077.544] (-2093.575) (-2071.474) * [-2079.936] (-2087.141) (-2074.727) (-2079.721) -- 0:02:47
405000 -- (-2086.004) [-2074.798] (-2095.676) (-2075.452) * (-2080.351) (-2081.898) (-2074.851) [-2072.521] -- 0:02:47
Average standard deviation of split frequencies: 0.008775
405100 -- (-2087.245) (-2076.438) (-2082.774) [-2073.955] * (-2079.813) (-2090.356) [-2069.874] (-2074.513) -- 0:02:48
405200 -- (-2083.943) (-2085.175) (-2079.350) [-2074.137] * (-2077.866) (-2087.965) [-2074.914] (-2081.561) -- 0:02:48
405300 -- (-2079.687) (-2082.790) (-2074.610) [-2067.208] * (-2079.386) (-2081.524) (-2079.834) [-2075.820] -- 0:02:48
405400 -- (-2085.209) (-2078.899) [-2071.650] (-2074.067) * (-2079.244) [-2075.331] (-2085.070) (-2073.825) -- 0:02:48
405500 -- (-2084.576) (-2074.262) [-2069.112] (-2073.739) * [-2072.699] (-2077.681) (-2077.058) (-2074.670) -- 0:02:48
405600 -- (-2078.085) (-2083.188) [-2070.307] (-2077.865) * [-2073.346] (-2077.730) (-2077.546) (-2076.606) -- 0:02:48
405700 -- (-2081.984) [-2072.591] (-2077.551) (-2074.669) * [-2074.268] (-2078.063) (-2078.051) (-2079.248) -- 0:02:48
405800 -- (-2083.379) [-2072.580] (-2073.989) (-2075.145) * (-2079.030) (-2078.665) (-2076.023) [-2078.980] -- 0:02:48
405900 -- (-2085.276) (-2073.499) [-2070.269] (-2083.710) * (-2077.444) (-2076.396) [-2079.069] (-2083.359) -- 0:02:48
406000 -- (-2077.211) [-2071.900] (-2069.415) (-2075.779) * (-2093.151) (-2073.377) [-2070.771] (-2082.636) -- 0:02:48
Average standard deviation of split frequencies: 0.008622
406100 -- (-2083.182) [-2072.710] (-2071.381) (-2072.965) * (-2089.562) [-2075.569] (-2070.749) (-2080.871) -- 0:02:48
406200 -- (-2076.791) (-2081.111) [-2077.151] (-2080.195) * (-2083.070) [-2068.790] (-2076.183) (-2082.063) -- 0:02:48
406300 -- (-2076.779) [-2076.371] (-2074.309) (-2079.496) * (-2089.411) (-2070.097) [-2073.192] (-2080.540) -- 0:02:48
406400 -- (-2083.263) (-2082.683) [-2073.824] (-2084.551) * (-2082.095) (-2071.695) [-2074.147] (-2084.023) -- 0:02:47
406500 -- (-2081.082) (-2084.953) [-2075.167] (-2073.143) * (-2080.674) (-2076.951) [-2072.930] (-2078.115) -- 0:02:47
406600 -- (-2080.146) (-2093.513) [-2075.407] (-2080.220) * [-2078.075] (-2073.004) (-2077.502) (-2078.607) -- 0:02:47
406700 -- [-2076.452] (-2088.522) (-2077.591) (-2081.676) * (-2089.940) (-2078.207) [-2076.859] (-2077.156) -- 0:02:47
406800 -- [-2078.824] (-2093.650) (-2079.827) (-2089.737) * (-2085.122) (-2075.522) (-2078.914) [-2074.804] -- 0:02:47
406900 -- (-2080.669) (-2081.742) [-2071.476] (-2079.128) * (-2089.623) [-2072.141] (-2078.982) (-2083.622) -- 0:02:47
407000 -- (-2089.091) (-2077.337) [-2071.087] (-2078.260) * (-2079.362) [-2082.155] (-2071.479) (-2088.648) -- 0:02:47
Average standard deviation of split frequencies: 0.008501
407100 -- (-2079.459) [-2068.374] (-2071.054) (-2075.397) * [-2077.643] (-2078.740) (-2079.057) (-2085.307) -- 0:02:47
407200 -- [-2074.835] (-2068.627) (-2068.730) (-2076.275) * (-2077.520) (-2071.708) [-2070.868] (-2089.128) -- 0:02:47
407300 -- (-2079.721) [-2070.796] (-2079.103) (-2081.134) * (-2079.228) [-2070.138] (-2073.770) (-2083.998) -- 0:02:47
407400 -- (-2081.602) (-2077.102) (-2073.437) [-2072.815] * (-2090.986) [-2073.505] (-2077.146) (-2079.541) -- 0:02:47
407500 -- (-2079.895) (-2074.390) (-2074.829) [-2074.985] * (-2088.706) (-2075.855) [-2074.366] (-2076.929) -- 0:02:47
407600 -- [-2074.857] (-2084.658) (-2076.635) (-2077.856) * (-2084.059) (-2079.162) [-2073.824] (-2083.450) -- 0:02:47
407700 -- (-2077.977) (-2080.719) [-2073.427] (-2074.482) * (-2082.608) [-2071.619] (-2077.271) (-2086.563) -- 0:02:47
407800 -- (-2081.946) (-2077.360) [-2071.012] (-2075.604) * (-2080.480) [-2069.401] (-2076.000) (-2081.736) -- 0:02:47
407900 -- (-2080.114) (-2076.665) [-2077.806] (-2077.820) * (-2080.696) [-2080.226] (-2074.140) (-2079.756) -- 0:02:46
408000 -- (-2084.444) [-2069.263] (-2077.472) (-2072.578) * (-2086.416) (-2075.349) (-2078.186) [-2082.255] -- 0:02:46
Average standard deviation of split frequencies: 0.008547
408100 -- (-2085.292) [-2070.914] (-2072.783) (-2073.296) * (-2084.621) (-2075.062) (-2082.208) [-2076.094] -- 0:02:46
408200 -- (-2086.026) (-2076.485) [-2078.677] (-2071.045) * (-2084.536) [-2083.060] (-2078.304) (-2078.080) -- 0:02:46
408300 -- (-2089.162) (-2077.945) (-2077.101) [-2076.052] * (-2079.906) (-2076.740) (-2075.881) [-2082.095] -- 0:02:46
408400 -- (-2091.315) (-2084.629) (-2077.315) [-2068.647] * [-2077.167] (-2072.065) (-2076.878) (-2078.438) -- 0:02:46
408500 -- [-2083.676] (-2084.322) (-2079.262) (-2070.287) * (-2077.618) [-2073.139] (-2074.486) (-2077.846) -- 0:02:46
408600 -- (-2079.421) [-2073.556] (-2075.741) (-2077.239) * (-2085.459) (-2081.468) [-2073.351] (-2076.528) -- 0:02:47
408700 -- (-2078.141) [-2075.984] (-2081.502) (-2076.561) * (-2087.345) [-2074.507] (-2079.497) (-2071.649) -- 0:02:47
408800 -- (-2084.142) [-2073.676] (-2077.170) (-2076.533) * (-2079.348) [-2076.135] (-2083.006) (-2074.470) -- 0:02:47
408900 -- (-2077.782) [-2071.647] (-2083.281) (-2078.300) * (-2083.270) (-2085.665) (-2078.921) [-2069.401] -- 0:02:47
409000 -- [-2075.445] (-2069.767) (-2084.453) (-2077.628) * (-2084.988) (-2081.553) (-2078.063) [-2068.166] -- 0:02:47
Average standard deviation of split frequencies: 0.008327
409100 -- (-2078.506) [-2073.145] (-2078.984) (-2077.401) * (-2085.997) (-2081.071) [-2070.773] (-2074.385) -- 0:02:47
409200 -- (-2077.257) (-2076.274) [-2082.793] (-2073.205) * (-2075.934) [-2075.250] (-2076.035) (-2076.601) -- 0:02:47
409300 -- [-2077.316] (-2074.052) (-2084.996) (-2074.366) * [-2076.185] (-2078.675) (-2077.385) (-2074.841) -- 0:02:47
409400 -- (-2083.007) (-2077.604) (-2083.274) [-2076.305] * (-2079.389) (-2075.788) (-2075.997) [-2070.214] -- 0:02:47
409500 -- (-2075.855) (-2072.740) [-2077.981] (-2072.286) * (-2081.480) [-2073.743] (-2080.287) (-2070.865) -- 0:02:47
409600 -- (-2078.812) (-2076.434) (-2080.340) [-2075.155] * [-2077.807] (-2076.521) (-2089.412) (-2075.057) -- 0:02:47
409700 -- (-2087.948) [-2074.265] (-2082.109) (-2068.717) * [-2077.791] (-2081.043) (-2080.959) (-2072.203) -- 0:02:47
409800 -- (-2084.294) (-2071.505) (-2079.641) [-2078.174] * (-2082.191) (-2076.893) (-2076.758) [-2076.716] -- 0:02:47
409900 -- (-2073.835) (-2073.204) (-2084.114) [-2072.775] * [-2075.494] (-2077.777) (-2082.084) (-2075.197) -- 0:02:46
410000 -- (-2079.571) (-2075.396) (-2077.405) [-2073.199] * [-2071.586] (-2085.325) (-2091.965) (-2068.697) -- 0:02:46
Average standard deviation of split frequencies: 0.008111
410100 -- (-2075.721) (-2080.878) (-2079.500) [-2068.431] * [-2072.367] (-2086.466) (-2074.225) (-2073.073) -- 0:02:46
410200 -- (-2077.943) (-2085.381) (-2087.343) [-2071.108] * [-2074.595] (-2083.059) (-2080.842) (-2079.703) -- 0:02:46
410300 -- [-2080.844] (-2089.924) (-2082.067) (-2073.092) * (-2085.558) (-2084.729) (-2081.306) [-2072.397] -- 0:02:46
410400 -- (-2080.548) (-2098.914) (-2076.774) [-2073.461] * [-2076.979] (-2079.868) (-2076.790) (-2074.575) -- 0:02:46
410500 -- (-2078.413) (-2085.478) (-2089.365) [-2082.163] * (-2087.148) (-2079.632) (-2078.752) [-2081.241] -- 0:02:46
410600 -- [-2078.233] (-2076.906) (-2086.484) (-2072.595) * [-2084.116] (-2079.607) (-2068.305) (-2077.294) -- 0:02:46
410700 -- (-2087.927) (-2079.565) [-2072.739] (-2075.965) * (-2083.878) (-2084.868) [-2083.116] (-2075.854) -- 0:02:46
410800 -- (-2080.463) (-2080.544) (-2070.892) [-2075.387] * (-2081.267) (-2086.241) (-2081.389) [-2073.239] -- 0:02:46
410900 -- (-2076.993) (-2073.251) [-2073.449] (-2075.428) * (-2083.551) (-2078.667) (-2081.659) [-2073.970] -- 0:02:46
411000 -- (-2087.834) [-2071.318] (-2074.451) (-2080.958) * (-2083.189) (-2079.404) [-2074.947] (-2080.059) -- 0:02:46
Average standard deviation of split frequencies: 0.008451
411100 -- (-2086.969) (-2075.187) [-2076.679] (-2084.374) * (-2077.773) (-2077.439) [-2075.348] (-2083.591) -- 0:02:46
411200 -- (-2085.997) [-2070.743] (-2078.301) (-2076.754) * (-2078.820) (-2081.695) [-2074.009] (-2082.534) -- 0:02:46
411300 -- (-2086.681) (-2071.308) [-2074.291] (-2084.920) * (-2077.572) (-2082.711) [-2066.532] (-2077.375) -- 0:02:46
411400 -- (-2076.480) (-2072.507) [-2073.654] (-2082.639) * (-2078.312) (-2077.598) [-2070.059] (-2078.705) -- 0:02:45
411500 -- (-2077.714) (-2070.491) [-2069.883] (-2082.478) * (-2081.060) (-2081.470) [-2068.533] (-2080.596) -- 0:02:45
411600 -- (-2089.912) [-2068.960] (-2074.461) (-2086.917) * (-2087.324) (-2082.647) [-2072.590] (-2089.019) -- 0:02:45
411700 -- (-2090.511) (-2074.417) [-2072.567] (-2086.133) * (-2077.795) (-2073.022) [-2070.057] (-2074.653) -- 0:02:45
411800 -- (-2085.244) (-2079.812) [-2070.192] (-2081.054) * (-2082.223) (-2087.861) [-2073.228] (-2083.449) -- 0:02:45
411900 -- (-2080.831) [-2073.718] (-2079.992) (-2078.233) * (-2080.999) (-2082.201) [-2070.169] (-2073.971) -- 0:02:45
412000 -- (-2086.433) (-2090.469) [-2072.852] (-2081.506) * (-2078.104) (-2078.246) [-2069.932] (-2073.469) -- 0:02:45
Average standard deviation of split frequencies: 0.008366
412100 -- (-2078.588) [-2079.067] (-2070.782) (-2076.904) * (-2073.151) (-2076.566) (-2077.131) [-2076.573] -- 0:02:46
412200 -- (-2075.703) (-2075.892) (-2083.861) [-2071.351] * (-2075.166) [-2071.610] (-2079.271) (-2074.704) -- 0:02:46
412300 -- (-2083.727) (-2080.432) (-2073.025) [-2071.988] * (-2078.492) (-2071.232) [-2073.437] (-2073.431) -- 0:02:46
412400 -- (-2088.805) (-2075.546) (-2081.285) [-2075.180] * (-2083.221) (-2083.165) [-2070.770] (-2073.423) -- 0:02:46
412500 -- (-2087.193) (-2078.244) (-2077.756) [-2072.574] * (-2084.941) (-2084.113) [-2069.665] (-2080.345) -- 0:02:46
412600 -- (-2089.527) (-2071.781) (-2085.374) [-2072.822] * (-2087.310) (-2089.694) [-2073.834] (-2075.574) -- 0:02:46
412700 -- (-2078.070) [-2072.051] (-2080.305) (-2072.016) * (-2088.759) (-2076.310) [-2077.760] (-2082.051) -- 0:02:46
412800 -- (-2079.751) [-2076.831] (-2079.329) (-2071.773) * (-2083.099) (-2078.819) [-2070.965] (-2083.749) -- 0:02:46
412900 -- [-2078.608] (-2081.993) (-2074.961) (-2078.769) * [-2079.286] (-2079.352) (-2078.827) (-2096.025) -- 0:02:46
413000 -- (-2080.853) (-2084.322) (-2075.493) [-2072.629] * (-2081.582) (-2079.702) [-2072.916] (-2081.035) -- 0:02:46
Average standard deviation of split frequencies: 0.008573
413100 -- [-2079.184] (-2086.696) (-2079.456) (-2073.029) * (-2085.032) [-2076.285] (-2075.202) (-2085.604) -- 0:02:46
413200 -- (-2085.174) [-2073.478] (-2071.887) (-2076.952) * (-2078.313) (-2075.619) [-2071.111] (-2078.710) -- 0:02:46
413300 -- [-2083.815] (-2078.219) (-2072.240) (-2076.635) * (-2081.977) [-2079.924] (-2075.288) (-2079.893) -- 0:02:46
413400 -- (-2082.408) (-2076.621) (-2071.856) [-2070.030] * [-2078.357] (-2078.647) (-2074.306) (-2083.474) -- 0:02:46
413500 -- (-2077.435) (-2083.467) (-2073.814) [-2068.867] * (-2082.678) [-2075.586] (-2073.786) (-2072.438) -- 0:02:45
413600 -- (-2083.733) (-2086.930) (-2073.090) [-2070.614] * (-2080.224) (-2076.743) (-2071.882) [-2076.443] -- 0:02:45
413700 -- (-2079.297) (-2084.610) [-2070.163] (-2077.807) * (-2074.631) [-2081.331] (-2074.083) (-2079.244) -- 0:02:45
413800 -- [-2073.255] (-2080.817) (-2071.198) (-2078.419) * (-2076.767) (-2081.871) [-2074.843] (-2080.533) -- 0:02:45
413900 -- (-2079.219) (-2079.124) [-2072.446] (-2094.273) * (-2086.834) (-2085.947) [-2075.980] (-2078.069) -- 0:02:45
414000 -- (-2077.454) (-2093.014) [-2070.001] (-2077.561) * (-2085.657) (-2081.859) [-2072.174] (-2070.314) -- 0:02:45
Average standard deviation of split frequencies: 0.008846
414100 -- (-2083.809) (-2085.474) [-2074.006] (-2071.653) * (-2073.064) (-2079.564) [-2070.683] (-2079.280) -- 0:02:45
414200 -- (-2077.241) (-2075.050) (-2079.304) [-2067.730] * (-2072.969) (-2083.040) [-2072.881] (-2077.533) -- 0:02:45
414300 -- (-2080.849) (-2072.965) (-2077.905) [-2071.118] * (-2078.510) (-2086.675) (-2077.414) [-2081.268] -- 0:02:45
414400 -- (-2087.114) [-2075.924] (-2072.014) (-2074.439) * [-2075.908] (-2078.681) (-2076.313) (-2074.586) -- 0:02:45
414500 -- (-2090.145) (-2084.097) (-2070.181) [-2074.322] * (-2078.717) (-2078.886) (-2076.683) [-2070.232] -- 0:02:45
414600 -- (-2085.389) (-2082.857) (-2073.313) [-2071.196] * (-2082.429) (-2076.038) (-2077.683) [-2072.462] -- 0:02:45
414700 -- (-2085.176) (-2090.981) [-2071.649] (-2074.878) * (-2089.219) (-2080.300) [-2079.044] (-2078.357) -- 0:02:45
414800 -- [-2084.054] (-2089.950) (-2071.858) (-2080.051) * (-2078.742) [-2077.265] (-2071.389) (-2072.474) -- 0:02:45
414900 -- [-2078.053] (-2084.231) (-2075.384) (-2080.164) * (-2077.438) [-2073.825] (-2076.435) (-2075.140) -- 0:02:44
415000 -- (-2079.171) (-2079.587) [-2071.151] (-2076.703) * (-2087.983) (-2073.329) [-2072.974] (-2077.858) -- 0:02:44
Average standard deviation of split frequencies: 0.008596
415100 -- (-2082.666) (-2080.477) [-2076.036] (-2076.650) * (-2083.327) (-2080.372) [-2075.493] (-2076.385) -- 0:02:44
415200 -- (-2079.413) (-2077.075) [-2074.344] (-2076.650) * (-2084.954) (-2084.310) [-2075.336] (-2073.787) -- 0:02:44
415300 -- (-2083.547) (-2077.512) (-2073.724) [-2069.643] * (-2079.499) (-2081.589) (-2078.611) [-2071.608] -- 0:02:44
415400 -- (-2078.349) (-2091.371) [-2074.777] (-2071.840) * (-2087.179) (-2080.553) (-2081.250) [-2075.769] -- 0:02:44
415500 -- (-2085.953) (-2089.170) (-2073.884) [-2069.373] * (-2088.785) (-2084.469) (-2082.451) [-2067.131] -- 0:02:44
415600 -- (-2090.743) (-2086.646) (-2077.918) [-2070.590] * (-2074.383) (-2085.647) (-2076.616) [-2068.322] -- 0:02:45
415700 -- (-2104.027) (-2089.662) (-2071.362) [-2069.934] * (-2077.397) (-2078.193) (-2080.351) [-2076.360] -- 0:02:45
415800 -- (-2091.499) (-2087.976) (-2072.348) [-2073.052] * [-2082.768] (-2085.691) (-2075.958) (-2072.917) -- 0:02:45
415900 -- (-2090.252) (-2083.797) [-2071.253] (-2081.681) * (-2080.758) (-2079.757) [-2072.430] (-2076.796) -- 0:02:45
416000 -- (-2084.290) (-2085.097) (-2072.713) [-2076.766] * (-2077.707) (-2080.282) [-2077.505] (-2074.492) -- 0:02:45
Average standard deviation of split frequencies: 0.008609
416100 -- (-2088.514) (-2086.806) (-2073.888) [-2072.539] * (-2075.681) (-2076.098) [-2072.766] (-2075.586) -- 0:02:45
416200 -- (-2090.772) (-2090.305) [-2080.999] (-2073.556) * (-2080.904) (-2075.276) [-2071.863] (-2081.879) -- 0:02:45
416300 -- (-2089.854) (-2085.232) (-2075.656) [-2075.635] * [-2078.853] (-2076.375) (-2076.457) (-2081.929) -- 0:02:45
416400 -- (-2087.375) (-2076.491) (-2086.882) [-2069.757] * (-2081.465) (-2081.405) [-2071.415] (-2079.057) -- 0:02:45
416500 -- (-2091.136) (-2092.759) (-2079.128) [-2069.469] * (-2081.651) [-2075.925] (-2073.870) (-2076.695) -- 0:02:45
416600 -- (-2086.252) (-2084.465) (-2084.089) [-2069.432] * (-2081.591) [-2074.757] (-2071.699) (-2083.012) -- 0:02:45
416700 -- (-2080.761) (-2089.972) (-2081.269) [-2071.644] * (-2088.539) (-2074.016) (-2073.728) [-2080.847] -- 0:02:45
416800 -- (-2085.918) [-2072.777] (-2077.342) (-2069.995) * (-2077.656) [-2074.633] (-2076.401) (-2076.066) -- 0:02:45
416900 -- (-2092.230) (-2075.299) [-2074.678] (-2074.762) * (-2074.211) (-2079.599) [-2080.272] (-2074.002) -- 0:02:45
417000 -- (-2079.382) [-2070.074] (-2083.820) (-2079.795) * (-2094.368) [-2081.433] (-2076.106) (-2081.314) -- 0:02:44
Average standard deviation of split frequencies: 0.008458
417100 -- (-2081.505) (-2081.788) (-2074.498) [-2077.999] * (-2080.381) [-2077.239] (-2073.780) (-2083.504) -- 0:02:44
417200 -- [-2078.898] (-2076.855) (-2072.835) (-2081.944) * (-2083.632) (-2077.260) [-2075.571] (-2083.645) -- 0:02:44
417300 -- (-2078.185) (-2070.952) (-2078.123) [-2072.479] * (-2074.861) [-2073.718] (-2075.922) (-2071.410) -- 0:02:44
417400 -- (-2079.952) [-2072.229] (-2086.518) (-2074.988) * (-2079.357) (-2074.900) [-2073.787] (-2069.876) -- 0:02:44
417500 -- (-2076.894) (-2076.079) (-2080.319) [-2074.155] * (-2076.487) (-2078.171) (-2077.486) [-2069.324] -- 0:02:44
417600 -- (-2075.742) [-2074.491] (-2078.593) (-2076.379) * (-2081.508) (-2083.548) (-2085.335) [-2072.230] -- 0:02:44
417700 -- (-2081.855) (-2079.484) [-2075.938] (-2079.964) * (-2079.379) [-2076.129] (-2078.609) (-2071.344) -- 0:02:44
417800 -- [-2082.149] (-2070.763) (-2075.757) (-2074.182) * (-2086.341) (-2073.746) (-2071.763) [-2067.492] -- 0:02:44
417900 -- (-2088.481) (-2074.457) (-2083.562) [-2071.416] * (-2086.866) (-2077.495) (-2072.980) [-2069.034] -- 0:02:44
418000 -- (-2082.490) [-2070.986] (-2077.661) (-2070.454) * (-2080.746) (-2085.704) [-2072.131] (-2074.403) -- 0:02:44
Average standard deviation of split frequencies: 0.008439
418100 -- (-2081.787) [-2072.930] (-2075.219) (-2069.933) * (-2083.080) (-2086.940) (-2070.769) [-2077.133] -- 0:02:44
418200 -- (-2082.820) [-2066.001] (-2077.679) (-2074.113) * (-2075.596) (-2087.303) [-2079.001] (-2088.187) -- 0:02:44
418300 -- (-2083.982) (-2073.948) (-2079.315) [-2069.907] * (-2076.868) (-2092.129) [-2075.828] (-2092.443) -- 0:02:44
418400 -- (-2085.026) [-2075.940] (-2077.521) (-2069.998) * [-2077.607] (-2085.686) (-2076.978) (-2083.454) -- 0:02:44
418500 -- (-2084.267) [-2073.752] (-2081.863) (-2072.140) * (-2075.814) (-2085.588) (-2087.123) [-2079.819] -- 0:02:43
418600 -- (-2079.330) (-2084.589) (-2073.495) [-2071.110] * [-2070.388] (-2084.494) (-2077.746) (-2080.012) -- 0:02:43
418700 -- (-2085.788) (-2082.740) [-2070.036] (-2079.520) * (-2075.834) (-2086.435) (-2080.528) [-2075.004] -- 0:02:43
418800 -- (-2076.698) (-2084.538) [-2072.492] (-2074.936) * (-2077.111) (-2091.008) [-2075.963] (-2077.365) -- 0:02:43
418900 -- (-2077.938) (-2077.007) (-2077.912) [-2073.982] * [-2077.075] (-2088.229) (-2077.552) (-2078.202) -- 0:02:43
419000 -- [-2076.575] (-2077.736) (-2074.915) (-2073.345) * (-2081.847) (-2083.525) [-2075.839] (-2080.055) -- 0:02:43
Average standard deviation of split frequencies: 0.008418
419100 -- (-2084.704) (-2081.300) [-2076.277] (-2077.790) * (-2083.187) (-2077.144) [-2072.372] (-2078.702) -- 0:02:44
419200 -- (-2077.958) (-2082.702) [-2069.350] (-2079.416) * (-2097.138) (-2084.935) (-2076.248) [-2082.206] -- 0:02:44
419300 -- (-2082.603) (-2079.284) [-2072.039] (-2076.858) * (-2087.718) (-2083.067) [-2074.249] (-2076.064) -- 0:02:44
419400 -- (-2081.692) (-2074.125) (-2074.670) [-2071.212] * (-2078.008) (-2085.638) (-2076.982) [-2074.114] -- 0:02:44
419500 -- (-2075.898) (-2083.641) (-2074.417) [-2068.902] * (-2084.327) (-2083.764) [-2076.070] (-2073.407) -- 0:02:44
419600 -- (-2073.595) (-2074.251) (-2071.677) [-2066.591] * (-2076.062) (-2080.746) (-2076.919) [-2073.382] -- 0:02:44
419700 -- (-2077.780) (-2076.197) (-2077.230) [-2075.163] * [-2075.636] (-2091.090) (-2076.770) (-2076.531) -- 0:02:44
419800 -- (-2079.851) (-2075.004) [-2070.290] (-2069.282) * (-2083.774) (-2083.088) [-2072.297] (-2072.338) -- 0:02:44
419900 -- (-2077.328) (-2072.588) [-2068.291] (-2077.438) * (-2085.059) (-2081.602) (-2082.111) [-2077.749] -- 0:02:44
420000 -- (-2081.748) [-2071.542] (-2075.486) (-2084.387) * (-2082.960) (-2083.910) (-2073.284) [-2074.735] -- 0:02:44
Average standard deviation of split frequencies: 0.008303
420100 -- (-2089.009) [-2072.428] (-2070.548) (-2080.895) * (-2082.101) (-2080.503) [-2071.794] (-2076.881) -- 0:02:44
420200 -- (-2084.592) (-2076.816) [-2071.970] (-2083.828) * (-2078.142) (-2081.068) [-2072.559] (-2074.163) -- 0:02:44
420300 -- (-2078.615) (-2074.805) [-2068.616] (-2081.459) * (-2075.328) (-2085.686) [-2074.090] (-2074.980) -- 0:02:44
420400 -- (-2082.983) (-2083.078) [-2077.322] (-2075.676) * (-2076.180) (-2082.846) [-2070.181] (-2084.225) -- 0:02:44
420500 -- (-2090.759) (-2077.776) [-2067.725] (-2076.921) * (-2081.717) (-2084.207) [-2072.390] (-2083.620) -- 0:02:43
420600 -- (-2086.020) [-2074.364] (-2070.844) (-2075.790) * (-2085.553) (-2084.752) (-2072.758) [-2078.140] -- 0:02:43
420700 -- (-2080.208) (-2074.723) [-2072.111] (-2080.292) * (-2078.308) (-2082.111) [-2072.455] (-2082.682) -- 0:02:43
420800 -- (-2080.636) [-2072.171] (-2076.895) (-2078.368) * (-2078.459) (-2081.421) (-2081.058) [-2082.172] -- 0:02:43
420900 -- (-2074.261) [-2073.690] (-2075.761) (-2086.673) * (-2083.503) (-2075.024) [-2074.401] (-2082.514) -- 0:02:43
421000 -- (-2074.293) (-2078.094) [-2075.687] (-2091.945) * (-2082.026) (-2081.118) [-2071.056] (-2082.310) -- 0:02:43
Average standard deviation of split frequencies: 0.008506
421100 -- (-2074.870) (-2080.244) [-2071.854] (-2087.801) * (-2087.018) (-2080.105) [-2070.347] (-2091.716) -- 0:02:43
421200 -- [-2074.958] (-2078.478) (-2073.287) (-2085.703) * (-2083.244) (-2075.438) [-2072.037] (-2096.621) -- 0:02:43
421300 -- (-2080.485) (-2078.516) [-2074.724] (-2090.578) * (-2079.897) (-2080.672) [-2073.913] (-2086.503) -- 0:02:43
421400 -- [-2073.746] (-2077.169) (-2081.221) (-2088.017) * (-2079.146) (-2076.352) [-2075.189] (-2082.155) -- 0:02:43
421500 -- [-2075.589] (-2072.497) (-2076.084) (-2086.636) * (-2073.679) (-2082.140) (-2087.002) [-2086.379] -- 0:02:43
421600 -- (-2079.695) [-2072.186] (-2073.694) (-2078.245) * (-2081.241) (-2085.174) (-2084.555) [-2078.192] -- 0:02:43
421700 -- (-2086.376) (-2072.935) [-2075.371] (-2075.141) * (-2082.182) (-2087.500) [-2086.979] (-2076.365) -- 0:02:43
421800 -- (-2086.546) [-2067.680] (-2074.831) (-2075.427) * (-2078.277) [-2076.367] (-2083.657) (-2077.761) -- 0:02:43
421900 -- (-2089.233) [-2070.724] (-2083.390) (-2072.179) * [-2075.306] (-2076.547) (-2079.055) (-2075.924) -- 0:02:43
422000 -- (-2088.407) [-2070.806] (-2082.959) (-2081.907) * (-2081.071) (-2090.786) (-2084.167) [-2075.612] -- 0:02:42
Average standard deviation of split frequencies: 0.008232
422100 -- (-2080.388) [-2068.890] (-2079.830) (-2077.988) * (-2078.667) [-2082.504] (-2080.420) (-2073.992) -- 0:02:42
422200 -- (-2078.698) [-2068.656] (-2076.233) (-2080.699) * (-2084.580) (-2082.758) [-2072.557] (-2076.815) -- 0:02:42
422300 -- [-2076.200] (-2071.740) (-2078.666) (-2084.514) * (-2076.981) (-2079.573) [-2069.189] (-2079.579) -- 0:02:42
422400 -- (-2076.180) [-2069.256] (-2080.622) (-2082.365) * (-2089.474) [-2078.222] (-2070.792) (-2080.446) -- 0:02:42
422500 -- (-2083.945) [-2071.004] (-2079.949) (-2072.249) * (-2082.711) [-2075.181] (-2077.853) (-2081.291) -- 0:02:42
422600 -- (-2083.953) (-2068.969) (-2083.944) [-2070.072] * (-2092.365) [-2079.930] (-2083.966) (-2081.842) -- 0:02:43
422700 -- (-2092.883) [-2071.783] (-2082.033) (-2074.570) * (-2082.789) [-2076.816] (-2085.144) (-2079.688) -- 0:02:43
422800 -- (-2086.481) (-2070.983) (-2077.819) [-2072.065] * [-2076.657] (-2083.940) (-2075.379) (-2086.178) -- 0:02:43
422900 -- (-2081.554) (-2077.086) (-2076.846) [-2071.240] * (-2078.557) (-2081.154) (-2084.520) [-2073.726] -- 0:02:43
423000 -- (-2095.892) (-2077.893) [-2072.916] (-2074.408) * (-2074.756) (-2081.481) [-2070.569] (-2078.806) -- 0:02:43
Average standard deviation of split frequencies: 0.008147
423100 -- (-2084.528) (-2085.268) [-2073.233] (-2069.383) * (-2074.133) (-2074.189) [-2075.829] (-2073.560) -- 0:02:43
423200 -- (-2092.860) (-2077.023) [-2077.630] (-2068.355) * (-2077.410) (-2081.620) [-2073.278] (-2086.517) -- 0:02:43
423300 -- (-2084.951) (-2079.415) (-2078.980) [-2072.644] * (-2083.568) (-2086.433) [-2074.290] (-2077.428) -- 0:02:43
423400 -- (-2084.385) (-2067.992) (-2077.642) [-2077.517] * (-2085.375) (-2085.913) [-2076.933] (-2080.955) -- 0:02:43
423500 -- (-2077.255) (-2077.667) (-2075.643) [-2073.653] * (-2079.735) [-2081.044] (-2080.423) (-2085.443) -- 0:02:43
423600 -- (-2079.817) (-2081.511) (-2078.878) [-2071.586] * (-2080.978) [-2083.033] (-2081.505) (-2080.536) -- 0:02:43
423700 -- (-2084.811) (-2080.752) [-2077.624] (-2067.614) * [-2075.643] (-2080.043) (-2077.203) (-2093.795) -- 0:02:43
423800 -- (-2078.387) (-2083.357) (-2071.949) [-2069.748] * (-2078.806) (-2084.895) (-2076.889) [-2081.397] -- 0:02:43
423900 -- (-2081.743) (-2081.627) (-2078.168) [-2073.878] * (-2073.481) [-2082.664] (-2084.930) (-2077.016) -- 0:02:43
424000 -- (-2077.312) [-2072.388] (-2077.294) (-2072.679) * [-2081.270] (-2088.783) (-2082.994) (-2076.319) -- 0:02:43
Average standard deviation of split frequencies: 0.008225
424100 -- (-2078.297) [-2071.658] (-2082.389) (-2071.844) * (-2081.718) (-2085.922) (-2078.556) [-2080.948] -- 0:02:42
424200 -- (-2085.065) [-2070.698] (-2079.313) (-2071.165) * (-2078.584) (-2083.654) (-2078.216) [-2081.191] -- 0:02:42
424300 -- [-2077.788] (-2070.783) (-2083.286) (-2072.357) * [-2078.285] (-2080.761) (-2078.347) (-2080.328) -- 0:02:42
424400 -- (-2075.227) [-2071.785] (-2074.440) (-2073.867) * (-2078.780) (-2080.849) [-2083.980] (-2075.002) -- 0:02:42
424500 -- (-2075.942) (-2069.291) (-2074.107) [-2070.424] * (-2080.299) (-2082.278) (-2083.413) [-2074.267] -- 0:02:42
424600 -- (-2076.389) [-2069.856] (-2076.867) (-2073.831) * [-2080.474] (-2088.514) (-2089.067) (-2085.481) -- 0:02:42
424700 -- (-2085.511) (-2071.940) (-2075.191) [-2072.093] * (-2081.000) (-2085.721) [-2082.935] (-2079.206) -- 0:02:42
424800 -- (-2080.477) [-2068.711] (-2082.010) (-2073.848) * (-2077.740) (-2081.105) (-2078.120) [-2074.958] -- 0:02:42
424900 -- (-2087.233) [-2071.857] (-2080.523) (-2078.779) * (-2080.824) (-2079.503) (-2075.990) [-2083.772] -- 0:02:42
425000 -- (-2083.293) (-2074.377) [-2078.551] (-2078.150) * (-2082.209) (-2086.691) (-2077.080) [-2080.133] -- 0:02:42
Average standard deviation of split frequencies: 0.008141
425100 -- (-2085.396) [-2071.593] (-2082.917) (-2077.432) * (-2076.683) [-2079.819] (-2081.933) (-2078.117) -- 0:02:42
425200 -- (-2078.229) [-2068.228] (-2085.716) (-2076.651) * (-2079.554) [-2073.919] (-2079.387) (-2085.109) -- 0:02:42
425300 -- [-2089.581] (-2073.709) (-2085.010) (-2072.193) * (-2090.061) [-2078.414] (-2075.475) (-2080.859) -- 0:02:42
425400 -- (-2075.612) [-2069.496] (-2089.217) (-2079.822) * (-2082.454) [-2075.715] (-2080.930) (-2086.059) -- 0:02:42
425500 -- (-2084.076) (-2078.497) (-2085.992) [-2069.289] * [-2081.974] (-2080.575) (-2078.941) (-2078.816) -- 0:02:42
425600 -- (-2074.863) (-2082.665) (-2086.601) [-2069.098] * (-2077.054) [-2079.588] (-2085.937) (-2075.338) -- 0:02:41
425700 -- (-2076.600) (-2081.919) [-2077.185] (-2069.822) * (-2077.716) (-2077.267) [-2080.601] (-2083.565) -- 0:02:41
425800 -- (-2075.945) (-2087.469) (-2077.573) [-2070.966] * (-2085.462) (-2100.039) (-2077.332) [-2080.670] -- 0:02:41
425900 -- [-2079.715] (-2081.343) (-2085.214) (-2070.682) * [-2071.698] (-2085.236) (-2083.002) (-2076.686) -- 0:02:41
426000 -- (-2072.928) (-2082.703) (-2084.561) [-2072.835] * [-2078.999] (-2081.864) (-2078.208) (-2079.971) -- 0:02:41
Average standard deviation of split frequencies: 0.008471
426100 -- (-2078.973) (-2068.083) (-2087.011) [-2076.096] * (-2077.626) (-2086.348) [-2074.619] (-2081.448) -- 0:02:42
426200 -- (-2082.011) [-2074.509] (-2087.826) (-2074.613) * (-2087.469) [-2082.027] (-2090.260) (-2081.716) -- 0:02:42
426300 -- (-2084.325) [-2066.430] (-2081.098) (-2072.806) * (-2082.452) (-2079.797) (-2087.171) [-2080.777] -- 0:02:42
426400 -- (-2089.926) [-2068.981] (-2082.003) (-2077.888) * (-2084.607) [-2074.257] (-2088.339) (-2078.433) -- 0:02:42
426500 -- (-2079.577) [-2072.533] (-2081.318) (-2073.074) * (-2076.674) [-2075.304] (-2081.071) (-2077.768) -- 0:02:42
426600 -- (-2077.251) (-2072.503) (-2082.368) [-2070.149] * [-2079.708] (-2085.159) (-2077.595) (-2084.684) -- 0:02:42
426700 -- (-2082.587) (-2076.048) (-2078.905) [-2070.707] * (-2082.114) (-2085.152) [-2080.397] (-2090.479) -- 0:02:42
426800 -- (-2078.903) [-2076.916] (-2076.755) (-2075.383) * (-2083.120) (-2091.747) (-2080.747) [-2084.647] -- 0:02:42
426900 -- (-2086.371) (-2075.680) [-2074.482] (-2079.426) * (-2076.178) (-2085.700) [-2074.085] (-2080.523) -- 0:02:42
427000 -- (-2101.229) (-2079.105) (-2080.198) [-2075.720] * (-2072.464) (-2085.115) [-2074.465] (-2083.081) -- 0:02:42
Average standard deviation of split frequencies: 0.008513
427100 -- (-2094.804) (-2075.130) (-2078.550) [-2069.139] * (-2072.721) (-2086.911) [-2073.873] (-2083.567) -- 0:02:42
427200 -- (-2098.086) (-2083.056) (-2077.719) [-2070.136] * [-2073.911] (-2083.023) (-2073.492) (-2077.646) -- 0:02:42
427300 -- (-2081.671) (-2078.051) (-2083.115) [-2067.485] * (-2079.274) (-2094.626) [-2067.457] (-2080.944) -- 0:02:42
427400 -- (-2089.362) (-2077.417) (-2086.358) [-2068.298] * (-2077.847) (-2084.130) [-2067.467] (-2084.544) -- 0:02:42
427500 -- (-2082.134) (-2073.719) (-2080.367) [-2071.632] * (-2073.733) (-2080.548) (-2074.763) [-2079.572] -- 0:02:42
427600 -- (-2080.321) (-2071.571) (-2080.236) [-2071.230] * (-2077.745) (-2078.038) (-2072.403) [-2074.358] -- 0:02:41
427700 -- (-2074.664) [-2072.740] (-2076.948) (-2076.237) * (-2082.861) (-2086.563) [-2070.125] (-2080.068) -- 0:02:41
427800 -- (-2077.135) [-2070.962] (-2090.252) (-2072.311) * (-2086.624) (-2091.809) [-2073.763] (-2082.744) -- 0:02:41
427900 -- (-2077.117) [-2074.894] (-2088.775) (-2074.514) * (-2082.638) (-2080.264) [-2069.650] (-2079.606) -- 0:02:41
428000 -- (-2080.340) [-2074.838] (-2076.364) (-2079.017) * (-2074.847) (-2081.501) [-2069.907] (-2082.267) -- 0:02:41
Average standard deviation of split frequencies: 0.008525
428100 -- [-2074.727] (-2075.413) (-2084.711) (-2090.436) * (-2076.165) (-2085.135) [-2072.987] (-2082.332) -- 0:02:41
428200 -- [-2073.740] (-2075.311) (-2082.525) (-2086.935) * (-2080.186) [-2080.639] (-2081.873) (-2082.405) -- 0:02:41
428300 -- (-2075.013) [-2079.979] (-2075.356) (-2090.840) * (-2079.075) (-2090.952) (-2075.171) [-2074.245] -- 0:02:41
428400 -- [-2079.209] (-2077.838) (-2073.379) (-2083.925) * [-2077.110] (-2087.731) (-2079.481) (-2076.256) -- 0:02:41
428500 -- [-2082.269] (-2076.106) (-2074.794) (-2075.608) * (-2083.194) (-2089.129) (-2081.297) [-2082.682] -- 0:02:41
428600 -- [-2072.365] (-2097.770) (-2078.236) (-2072.513) * (-2083.539) (-2083.992) [-2072.267] (-2081.274) -- 0:02:41
428700 -- (-2079.962) (-2095.948) (-2079.835) [-2069.639] * (-2083.637) [-2079.274] (-2076.858) (-2078.551) -- 0:02:41
428800 -- (-2078.202) (-2079.529) (-2076.056) [-2071.690] * (-2082.582) (-2081.592) (-2075.259) [-2074.817] -- 0:02:41
428900 -- (-2074.788) [-2070.876] (-2081.729) (-2084.825) * (-2086.083) (-2088.376) (-2078.859) [-2074.359] -- 0:02:41
429000 -- (-2075.448) [-2075.964] (-2077.027) (-2068.064) * (-2082.650) (-2094.474) (-2078.813) [-2078.978] -- 0:02:41
Average standard deviation of split frequencies: 0.008316
429100 -- (-2082.169) (-2071.305) (-2076.485) [-2070.369] * (-2084.273) (-2078.998) [-2078.840] (-2086.200) -- 0:02:40
429200 -- (-2078.511) [-2071.084] (-2081.809) (-2070.211) * (-2073.427) (-2077.729) (-2082.639) [-2080.760] -- 0:02:40
429300 -- (-2083.325) (-2070.351) (-2076.787) [-2072.076] * (-2079.110) (-2079.974) (-2084.558) [-2072.034] -- 0:02:40
429400 -- (-2083.161) [-2069.417] (-2079.138) (-2077.446) * (-2075.102) [-2078.574] (-2087.799) (-2081.801) -- 0:02:40
429500 -- (-2089.231) [-2078.701] (-2077.906) (-2076.924) * [-2076.889] (-2077.318) (-2081.894) (-2080.494) -- 0:02:40
429600 -- (-2086.811) (-2081.309) (-2075.262) [-2075.463] * [-2071.046] (-2073.915) (-2091.474) (-2078.723) -- 0:02:41
429700 -- (-2091.386) (-2078.750) (-2080.784) [-2076.838] * (-2074.507) [-2073.293] (-2080.325) (-2079.000) -- 0:02:41
429800 -- (-2083.941) (-2083.446) (-2083.886) [-2072.971] * (-2078.082) (-2078.273) (-2081.123) [-2073.374] -- 0:02:41
429900 -- (-2082.411) (-2084.134) [-2074.731] (-2073.774) * [-2073.781] (-2080.729) (-2082.477) (-2084.279) -- 0:02:41
430000 -- (-2086.308) (-2077.424) (-2076.176) [-2073.756] * (-2078.240) (-2087.182) (-2091.599) [-2078.029] -- 0:02:41
Average standard deviation of split frequencies: 0.008329
430100 -- (-2080.822) [-2076.484] (-2080.188) (-2077.775) * [-2075.260] (-2084.904) (-2083.754) (-2078.906) -- 0:02:41
430200 -- (-2088.529) (-2071.428) [-2073.669] (-2071.094) * (-2076.447) (-2079.793) (-2081.648) [-2078.337] -- 0:02:41
430300 -- (-2092.571) (-2080.533) [-2074.011] (-2074.553) * (-2076.598) (-2077.072) (-2078.336) [-2075.021] -- 0:02:41
430400 -- (-2096.135) (-2074.258) (-2074.160) [-2079.395] * (-2079.111) (-2081.813) (-2083.815) [-2075.407] -- 0:02:41
430500 -- (-2086.134) (-2079.029) (-2076.439) [-2078.090] * (-2076.216) (-2078.890) (-2082.851) [-2073.271] -- 0:02:41
430600 -- (-2081.852) (-2076.197) [-2077.616] (-2081.953) * [-2078.671] (-2084.723) (-2082.770) (-2075.349) -- 0:02:41
430700 -- (-2082.580) (-2073.005) (-2073.729) [-2072.246] * (-2083.306) (-2085.645) (-2078.835) [-2076.887] -- 0:02:41
430800 -- (-2079.304) [-2078.551] (-2080.761) (-2072.244) * (-2079.870) (-2082.398) (-2077.359) [-2084.066] -- 0:02:41
430900 -- (-2080.390) (-2079.287) (-2085.470) [-2070.374] * (-2085.265) (-2081.675) [-2072.389] (-2077.521) -- 0:02:41
431000 -- (-2081.350) (-2077.537) (-2081.393) [-2070.831] * (-2083.506) (-2078.679) (-2078.306) [-2073.771] -- 0:02:41
Average standard deviation of split frequencies: 0.008121
431100 -- (-2085.162) [-2072.537] (-2083.057) (-2078.070) * (-2076.994) (-2080.648) (-2083.939) [-2076.023] -- 0:02:40
431200 -- (-2079.913) (-2074.368) (-2088.427) [-2072.789] * (-2078.729) (-2080.555) (-2092.204) [-2075.567] -- 0:02:40
431300 -- (-2079.508) [-2071.954] (-2084.180) (-2079.950) * (-2091.779) (-2079.551) (-2088.900) [-2073.087] -- 0:02:40
431400 -- (-2097.642) (-2070.264) (-2084.072) [-2082.624] * (-2094.901) (-2076.576) (-2083.643) [-2073.860] -- 0:02:40
431500 -- (-2085.892) [-2069.088] (-2076.964) (-2086.020) * (-2086.325) (-2079.231) (-2081.930) [-2078.015] -- 0:02:40
431600 -- (-2079.528) (-2076.234) [-2073.080] (-2097.056) * (-2080.099) (-2078.439) (-2082.749) [-2079.444] -- 0:02:40
431700 -- (-2085.398) (-2068.954) [-2076.580] (-2080.132) * (-2079.282) (-2082.174) (-2087.796) [-2075.737] -- 0:02:40
431800 -- (-2085.166) [-2072.667] (-2075.218) (-2080.440) * [-2072.095] (-2084.454) (-2093.598) (-2077.576) -- 0:02:40
431900 -- [-2083.988] (-2072.408) (-2079.947) (-2074.199) * (-2078.881) (-2082.866) (-2084.663) [-2078.980] -- 0:02:40
432000 -- (-2087.180) (-2074.231) (-2079.707) [-2073.977] * [-2073.100] (-2078.837) (-2083.021) (-2080.101) -- 0:02:40
Average standard deviation of split frequencies: 0.008166
432100 -- (-2078.219) (-2078.053) (-2081.359) [-2069.686] * (-2074.174) (-2077.541) [-2081.818] (-2077.814) -- 0:02:40
432200 -- (-2079.228) [-2072.521] (-2075.038) (-2072.991) * [-2075.468] (-2083.814) (-2079.757) (-2074.631) -- 0:02:40
432300 -- (-2087.160) (-2083.016) (-2075.681) [-2074.599] * (-2078.674) (-2083.847) [-2072.569] (-2086.255) -- 0:02:40
432400 -- (-2082.052) (-2080.337) [-2081.893] (-2081.832) * (-2077.018) (-2087.082) [-2074.030] (-2085.968) -- 0:02:40
432500 -- (-2079.052) (-2079.390) [-2077.958] (-2076.675) * (-2079.823) (-2085.040) [-2074.906] (-2080.150) -- 0:02:40
432600 -- (-2091.263) [-2073.834] (-2081.513) (-2070.616) * (-2082.965) (-2078.359) (-2082.031) [-2079.405] -- 0:02:40
432700 -- (-2088.378) [-2080.605] (-2079.664) (-2072.915) * (-2084.322) (-2076.697) (-2083.039) [-2075.865] -- 0:02:39
432800 -- (-2088.334) [-2071.588] (-2076.186) (-2072.277) * (-2079.925) (-2084.592) [-2074.228] (-2081.431) -- 0:02:39
432900 -- (-2090.357) [-2072.445] (-2078.304) (-2078.795) * (-2075.133) (-2084.269) [-2073.094] (-2076.994) -- 0:02:39
433000 -- (-2085.181) (-2081.301) (-2077.209) [-2069.538] * (-2082.511) (-2074.860) (-2074.731) [-2082.659] -- 0:02:39
Average standard deviation of split frequencies: 0.008301
433100 -- (-2081.692) [-2070.800] (-2076.076) (-2079.294) * [-2077.750] (-2083.284) (-2073.910) (-2084.753) -- 0:02:40
433200 -- (-2074.780) [-2070.001] (-2079.595) (-2076.946) * (-2080.437) (-2081.418) [-2079.455] (-2084.494) -- 0:02:40
433300 -- (-2083.730) [-2071.483] (-2078.775) (-2083.330) * (-2083.982) [-2076.149] (-2076.366) (-2083.816) -- 0:02:40
433400 -- (-2079.329) [-2071.048] (-2075.297) (-2080.618) * (-2078.957) [-2074.958] (-2084.887) (-2084.461) -- 0:02:40
433500 -- [-2078.577] (-2075.567) (-2082.240) (-2076.974) * [-2075.768] (-2091.226) (-2086.707) (-2075.723) -- 0:02:40
433600 -- (-2075.884) [-2076.371] (-2083.885) (-2081.631) * (-2078.026) [-2078.517] (-2088.844) (-2075.377) -- 0:02:40
433700 -- (-2079.182) (-2081.192) (-2086.714) [-2074.908] * [-2077.229] (-2078.845) (-2080.260) (-2085.927) -- 0:02:40
433800 -- (-2086.878) (-2079.554) (-2080.906) [-2074.326] * (-2079.045) [-2075.422] (-2082.477) (-2080.536) -- 0:02:40
433900 -- (-2083.365) [-2070.685] (-2082.268) (-2070.288) * [-2076.412] (-2075.801) (-2081.890) (-2083.692) -- 0:02:40
434000 -- (-2084.232) (-2072.401) (-2091.233) [-2074.955] * (-2086.361) (-2080.728) [-2072.610] (-2088.503) -- 0:02:40
Average standard deviation of split frequencies: 0.008221
434100 -- (-2086.607) [-2071.776] (-2082.327) (-2075.170) * (-2079.235) (-2093.077) [-2073.228] (-2085.765) -- 0:02:40
434200 -- (-2080.132) (-2072.041) (-2082.239) [-2076.317] * (-2075.545) (-2082.191) [-2076.426] (-2087.476) -- 0:02:40
434300 -- (-2086.122) (-2075.477) [-2080.539] (-2076.882) * (-2080.051) (-2076.343) [-2072.013] (-2088.281) -- 0:02:40
434400 -- (-2082.684) (-2075.139) (-2080.643) [-2069.078] * (-2077.766) (-2074.082) [-2071.405] (-2089.980) -- 0:02:40
434500 -- [-2078.068] (-2076.868) (-2080.282) (-2067.777) * (-2084.487) [-2080.483] (-2076.329) (-2090.871) -- 0:02:40
434600 -- (-2078.946) (-2077.218) (-2076.066) [-2068.039] * (-2079.392) (-2078.281) [-2073.457] (-2085.126) -- 0:02:40
434700 -- (-2074.793) (-2079.257) (-2079.532) [-2067.874] * (-2082.047) (-2081.729) [-2073.136] (-2087.914) -- 0:02:39
434800 -- (-2083.424) [-2073.797] (-2083.507) (-2072.855) * [-2073.553] (-2082.088) (-2076.050) (-2096.037) -- 0:02:39
434900 -- (-2078.536) [-2072.553] (-2085.313) (-2072.842) * (-2086.334) (-2090.804) [-2077.810] (-2088.221) -- 0:02:39
435000 -- (-2080.427) (-2077.451) (-2091.204) [-2071.478] * [-2075.665] (-2082.412) (-2078.649) (-2088.208) -- 0:02:39
Average standard deviation of split frequencies: 0.008263
435100 -- (-2080.677) [-2070.648] (-2077.737) (-2072.946) * (-2080.045) (-2087.437) [-2072.245] (-2093.593) -- 0:02:39
435200 -- (-2076.886) [-2072.356] (-2082.247) (-2075.475) * (-2073.954) (-2077.752) [-2073.958] (-2086.837) -- 0:02:39
435300 -- [-2075.185] (-2070.641) (-2095.753) (-2080.882) * [-2074.622] (-2076.404) (-2076.698) (-2085.396) -- 0:02:39
435400 -- (-2077.670) [-2075.578] (-2078.617) (-2076.435) * [-2075.067] (-2075.090) (-2078.710) (-2080.565) -- 0:02:39
435500 -- (-2092.886) [-2077.672] (-2086.842) (-2075.352) * [-2071.877] (-2083.002) (-2080.733) (-2090.102) -- 0:02:39
435600 -- (-2088.341) [-2075.505] (-2082.408) (-2069.921) * (-2073.968) (-2077.851) [-2073.716] (-2087.360) -- 0:02:39
435700 -- (-2089.124) [-2079.437] (-2077.746) (-2070.258) * (-2074.063) (-2077.643) [-2078.265] (-2075.138) -- 0:02:39
435800 -- (-2082.775) (-2072.973) (-2083.175) [-2077.792] * (-2073.280) [-2074.729] (-2082.317) (-2077.432) -- 0:02:39
435900 -- (-2091.471) (-2075.740) (-2082.368) [-2072.329] * [-2075.115] (-2086.458) (-2080.170) (-2083.741) -- 0:02:39
436000 -- (-2095.774) [-2081.913] (-2083.159) (-2074.249) * (-2077.255) (-2079.841) (-2086.536) [-2079.828] -- 0:02:39
Average standard deviation of split frequencies: 0.008400
436100 -- (-2090.126) (-2090.264) (-2078.759) [-2077.843] * (-2076.565) [-2073.604] (-2091.881) (-2081.397) -- 0:02:39
436200 -- (-2091.378) (-2079.253) (-2078.126) [-2072.582] * (-2085.277) [-2073.330] (-2087.315) (-2087.823) -- 0:02:38
436300 -- (-2087.397) (-2082.061) [-2075.207] (-2072.950) * (-2082.127) [-2078.721] (-2076.291) (-2082.830) -- 0:02:38
436400 -- (-2087.220) (-2081.953) (-2076.684) [-2078.924] * [-2081.832] (-2078.669) (-2072.729) (-2088.207) -- 0:02:38
436500 -- (-2081.856) (-2076.234) (-2083.665) [-2074.259] * [-2076.992] (-2085.168) (-2078.379) (-2081.818) -- 0:02:38
436600 -- (-2086.765) (-2085.203) (-2073.904) [-2071.680] * (-2078.574) (-2089.670) [-2073.167] (-2084.273) -- 0:02:40
436700 -- (-2080.322) (-2083.256) (-2072.312) [-2069.860] * (-2075.049) (-2084.741) (-2074.377) [-2082.621] -- 0:02:39
436800 -- (-2076.594) (-2085.551) (-2080.873) [-2073.687] * (-2075.712) (-2081.280) [-2078.542] (-2079.225) -- 0:02:39
436900 -- [-2073.519] (-2085.806) (-2082.938) (-2072.795) * [-2079.366] (-2080.655) (-2073.358) (-2080.407) -- 0:02:39
437000 -- (-2077.323) (-2082.474) (-2078.916) [-2074.304] * (-2080.772) (-2081.227) [-2080.101] (-2079.179) -- 0:02:39
Average standard deviation of split frequencies: 0.008503
437100 -- (-2086.119) (-2094.201) (-2073.856) [-2068.589] * (-2077.501) [-2077.766] (-2080.187) (-2082.379) -- 0:02:39
437200 -- (-2087.758) (-2080.067) (-2077.722) [-2078.064] * (-2082.713) [-2080.997] (-2079.216) (-2077.820) -- 0:02:39
437300 -- (-2087.563) (-2078.670) (-2079.689) [-2073.068] * [-2077.660] (-2085.382) (-2075.799) (-2081.464) -- 0:02:39
437400 -- (-2080.423) (-2076.762) (-2074.901) [-2072.009] * (-2081.161) [-2078.378] (-2073.683) (-2078.698) -- 0:02:39
437500 -- (-2078.027) (-2081.412) (-2083.507) [-2073.546] * (-2083.714) (-2078.211) [-2075.476] (-2086.355) -- 0:02:39
437600 -- (-2089.587) (-2081.245) (-2086.357) [-2078.132] * (-2079.697) [-2077.956] (-2078.203) (-2082.514) -- 0:02:39
437700 -- (-2092.517) (-2077.994) (-2081.894) [-2074.615] * (-2086.679) [-2078.034] (-2073.222) (-2083.732) -- 0:02:39
437800 -- (-2081.357) [-2070.697] (-2087.041) (-2069.739) * (-2080.053) [-2078.644] (-2080.473) (-2079.577) -- 0:02:39
437900 -- (-2087.161) [-2068.467] (-2085.689) (-2074.975) * (-2079.050) (-2079.047) (-2071.365) [-2079.330] -- 0:02:39
438000 -- (-2088.909) [-2067.416] (-2087.230) (-2077.962) * (-2087.124) (-2074.913) [-2076.227] (-2086.866) -- 0:02:39
Average standard deviation of split frequencies: 0.008669
438100 -- (-2085.446) [-2069.830] (-2082.750) (-2081.170) * (-2094.566) (-2080.707) [-2076.163] (-2078.179) -- 0:02:39
438200 -- (-2083.801) [-2067.655] (-2078.110) (-2076.648) * (-2090.080) (-2080.438) [-2076.088] (-2083.276) -- 0:02:38
438300 -- (-2083.879) [-2075.045] (-2079.545) (-2078.293) * (-2082.226) [-2073.580] (-2075.261) (-2085.452) -- 0:02:38
438400 -- [-2075.129] (-2070.802) (-2081.396) (-2069.253) * (-2075.067) (-2077.629) [-2078.365] (-2084.721) -- 0:02:38
438500 -- (-2073.760) (-2072.400) (-2085.650) [-2074.966] * [-2081.295] (-2075.642) (-2084.008) (-2083.715) -- 0:02:38
438600 -- (-2076.000) [-2072.198] (-2074.543) (-2066.600) * (-2073.885) (-2079.468) [-2069.573] (-2074.986) -- 0:02:38
438700 -- [-2074.739] (-2078.790) (-2076.962) (-2067.413) * [-2082.354] (-2078.805) (-2069.321) (-2077.915) -- 0:02:38
438800 -- [-2073.951] (-2078.179) (-2083.848) (-2076.478) * (-2083.577) (-2087.049) (-2075.430) [-2072.022] -- 0:02:38
438900 -- (-2074.953) [-2070.570] (-2079.028) (-2076.736) * (-2074.656) (-2079.426) [-2073.161] (-2074.810) -- 0:02:38
439000 -- (-2078.079) [-2068.378] (-2079.029) (-2077.918) * (-2083.903) (-2088.548) (-2075.733) [-2075.259] -- 0:02:38
Average standard deviation of split frequencies: 0.008801
439100 -- [-2083.324] (-2070.463) (-2085.666) (-2082.829) * (-2084.160) (-2082.503) [-2067.999] (-2074.324) -- 0:02:38
439200 -- (-2084.596) [-2075.480] (-2081.461) (-2080.942) * (-2084.705) (-2077.682) [-2067.379] (-2076.222) -- 0:02:38
439300 -- (-2075.661) [-2076.144] (-2079.427) (-2079.463) * (-2083.279) (-2079.523) (-2074.504) [-2076.212] -- 0:02:38
439400 -- (-2083.001) (-2079.414) (-2076.948) [-2079.788] * (-2083.290) (-2080.677) [-2069.090] (-2074.529) -- 0:02:38
439500 -- [-2074.971] (-2073.040) (-2080.285) (-2076.002) * (-2081.478) (-2081.275) [-2070.920] (-2085.244) -- 0:02:38
439600 -- (-2076.096) [-2067.712] (-2086.342) (-2074.773) * (-2080.889) (-2086.330) [-2070.656] (-2079.565) -- 0:02:38
439700 -- (-2082.792) (-2075.208) (-2090.422) [-2071.845] * (-2078.931) (-2079.470) [-2070.043] (-2083.879) -- 0:02:38
439800 -- (-2077.694) (-2074.923) (-2096.935) [-2076.931] * (-2083.977) (-2081.443) (-2081.161) [-2076.843] -- 0:02:37
439900 -- [-2077.408] (-2075.039) (-2090.302) (-2077.239) * (-2076.663) (-2090.975) [-2073.609] (-2091.650) -- 0:02:37
440000 -- (-2082.328) [-2081.010] (-2084.211) (-2080.002) * [-2081.294] (-2087.107) (-2087.220) (-2084.889) -- 0:02:37
Average standard deviation of split frequencies: 0.008844
440100 -- (-2080.782) [-2071.513] (-2090.693) (-2076.785) * (-2083.365) (-2088.512) (-2077.151) [-2080.713] -- 0:02:39
440200 -- (-2078.479) [-2069.924] (-2090.371) (-2072.415) * (-2078.052) (-2091.100) [-2069.148] (-2084.750) -- 0:02:38
440300 -- (-2079.086) [-2070.424] (-2081.908) (-2078.818) * [-2076.402] (-2089.677) (-2069.300) (-2083.783) -- 0:02:38
440400 -- (-2087.088) [-2070.687] (-2081.834) (-2074.909) * (-2076.926) (-2089.641) [-2068.903] (-2083.436) -- 0:02:38
440500 -- [-2078.047] (-2074.527) (-2078.867) (-2081.277) * [-2077.389] (-2076.965) (-2072.276) (-2080.924) -- 0:02:38
440600 -- (-2078.000) (-2072.912) (-2075.350) [-2072.164] * (-2089.082) [-2075.755] (-2074.325) (-2083.158) -- 0:02:38
440700 -- (-2079.657) [-2069.820] (-2076.360) (-2077.858) * (-2088.970) [-2074.012] (-2070.805) (-2079.964) -- 0:02:38
440800 -- (-2080.401) (-2076.402) [-2075.525] (-2073.709) * (-2088.739) [-2078.411] (-2078.273) (-2089.525) -- 0:02:38
440900 -- (-2075.806) (-2074.888) [-2076.502] (-2078.143) * (-2078.197) [-2074.563] (-2078.128) (-2083.284) -- 0:02:38
441000 -- (-2078.140) (-2078.714) (-2076.065) [-2072.123] * (-2076.959) (-2077.414) [-2072.163] (-2084.486) -- 0:02:38
Average standard deviation of split frequencies: 0.008853
441100 -- (-2080.618) (-2080.924) [-2073.589] (-2078.310) * (-2081.881) (-2083.153) [-2069.754] (-2081.175) -- 0:02:38
441200 -- (-2083.276) [-2077.684] (-2078.330) (-2075.161) * (-2082.934) (-2088.893) [-2072.991] (-2080.812) -- 0:02:38
441300 -- (-2077.350) (-2079.856) [-2078.633] (-2074.016) * (-2079.053) (-2075.783) [-2071.050] (-2076.762) -- 0:02:38
441400 -- (-2085.186) [-2077.560] (-2077.494) (-2082.620) * (-2078.295) (-2082.330) [-2071.665] (-2075.851) -- 0:02:38
441500 -- (-2084.273) [-2078.315] (-2080.797) (-2082.694) * (-2084.905) (-2079.139) [-2070.087] (-2076.315) -- 0:02:38
441600 -- (-2084.722) (-2078.051) (-2084.300) [-2075.192] * (-2092.316) [-2076.375] (-2077.338) (-2075.149) -- 0:02:38
441700 -- (-2093.250) (-2079.350) (-2086.605) [-2075.568] * (-2092.469) (-2088.599) (-2078.553) [-2073.935] -- 0:02:37
441800 -- (-2090.868) (-2074.834) (-2076.879) [-2073.481] * (-2090.899) (-2076.183) [-2074.964] (-2073.358) -- 0:02:37
441900 -- [-2085.229] (-2077.017) (-2076.787) (-2073.624) * (-2100.840) (-2079.471) [-2073.654] (-2078.288) -- 0:02:37
442000 -- (-2080.446) [-2071.595] (-2078.852) (-2071.622) * (-2103.227) [-2081.513] (-2074.989) (-2080.330) -- 0:02:37
Average standard deviation of split frequencies: 0.008926
442100 -- (-2087.858) (-2071.832) [-2076.365] (-2080.784) * (-2104.805) (-2077.789) [-2072.355] (-2080.032) -- 0:02:37
442200 -- (-2081.471) [-2074.963] (-2080.088) (-2074.160) * (-2089.059) [-2081.701] (-2074.604) (-2081.215) -- 0:02:37
442300 -- (-2084.856) (-2074.209) (-2076.143) [-2072.376] * (-2092.836) [-2080.552] (-2077.383) (-2084.821) -- 0:02:37
442400 -- (-2090.677) (-2077.114) (-2076.985) [-2072.318] * (-2075.482) (-2078.237) [-2069.656] (-2076.143) -- 0:02:37
442500 -- (-2091.772) (-2073.174) (-2080.500) [-2072.621] * (-2080.807) (-2087.734) (-2067.048) [-2078.508] -- 0:02:37
442600 -- (-2091.432) [-2075.698] (-2085.506) (-2069.051) * (-2076.116) (-2084.085) [-2073.393] (-2078.598) -- 0:02:37
442700 -- [-2082.522] (-2072.763) (-2091.983) (-2078.620) * (-2082.287) (-2088.211) (-2074.591) [-2074.849] -- 0:02:37
442800 -- (-2090.159) (-2077.980) (-2090.079) [-2072.929] * (-2073.806) (-2090.021) [-2072.929] (-2076.435) -- 0:02:37
442900 -- (-2086.410) (-2079.598) (-2084.052) [-2081.991] * (-2080.069) (-2085.237) (-2075.562) [-2072.999] -- 0:02:37
443000 -- (-2090.351) (-2079.341) (-2083.063) [-2072.383] * (-2073.120) (-2084.207) [-2078.870] (-2078.821) -- 0:02:37
Average standard deviation of split frequencies: 0.008570
443100 -- (-2095.997) (-2076.988) (-2078.136) [-2072.900] * (-2080.062) (-2084.165) [-2078.431] (-2082.142) -- 0:02:37
443200 -- (-2086.572) (-2082.701) [-2074.772] (-2070.235) * (-2075.932) [-2079.814] (-2071.504) (-2077.194) -- 0:02:37
443300 -- [-2081.333] (-2079.486) (-2082.587) (-2073.850) * (-2083.396) (-2081.367) [-2079.309] (-2076.434) -- 0:02:36
443400 -- (-2088.444) (-2073.857) (-2084.051) [-2075.417] * (-2085.078) (-2081.320) [-2070.744] (-2075.560) -- 0:02:36
443500 -- (-2097.909) (-2072.889) [-2080.761] (-2075.151) * (-2082.683) [-2075.749] (-2076.479) (-2076.515) -- 0:02:36
443600 -- (-2086.118) (-2077.907) [-2079.715] (-2076.641) * (-2078.470) (-2081.303) (-2072.301) [-2074.982] -- 0:02:38
443700 -- (-2079.705) (-2076.306) [-2079.824] (-2071.226) * [-2077.704] (-2077.126) (-2074.051) (-2077.065) -- 0:02:37
443800 -- (-2079.527) [-2075.225] (-2075.948) (-2077.744) * (-2084.761) [-2075.197] (-2077.128) (-2079.994) -- 0:02:37
443900 -- (-2080.466) (-2075.544) (-2084.406) [-2077.662] * [-2085.789] (-2072.915) (-2087.248) (-2079.502) -- 0:02:37
444000 -- (-2076.472) (-2080.565) [-2080.350] (-2088.175) * (-2083.265) [-2076.277] (-2080.419) (-2078.710) -- 0:02:37
Average standard deviation of split frequencies: 0.008673
444100 -- (-2087.824) (-2072.918) [-2080.661] (-2075.113) * (-2075.375) (-2080.039) (-2078.865) [-2074.269] -- 0:02:37
444200 -- (-2083.266) [-2075.169] (-2084.214) (-2078.219) * [-2074.654] (-2096.856) (-2083.356) (-2076.439) -- 0:02:37
444300 -- (-2086.856) [-2069.646] (-2090.478) (-2069.612) * [-2076.136] (-2080.938) (-2082.022) (-2077.601) -- 0:02:37
444400 -- [-2076.746] (-2075.191) (-2087.499) (-2074.376) * [-2076.773] (-2088.041) (-2079.615) (-2078.036) -- 0:02:37
444500 -- (-2074.648) (-2087.407) (-2083.811) [-2072.745] * (-2081.244) (-2082.815) [-2072.093] (-2075.920) -- 0:02:37
444600 -- (-2074.405) (-2078.375) (-2086.342) [-2071.122] * (-2079.547) (-2076.063) [-2070.259] (-2084.281) -- 0:02:37
444700 -- (-2080.666) (-2083.146) (-2085.294) [-2067.027] * (-2074.778) [-2073.895] (-2072.678) (-2084.422) -- 0:02:37
444800 -- (-2082.029) (-2074.975) (-2082.195) [-2070.498] * (-2078.624) [-2072.728] (-2073.522) (-2081.105) -- 0:02:37
444900 -- (-2076.852) [-2071.673] (-2082.400) (-2082.083) * (-2080.009) [-2074.821] (-2074.881) (-2080.957) -- 0:02:37
445000 -- (-2088.391) [-2072.955] (-2086.335) (-2069.807) * (-2081.937) [-2072.124] (-2082.333) (-2077.427) -- 0:02:37
Average standard deviation of split frequencies: 0.008622
445100 -- (-2088.369) (-2069.676) (-2075.491) [-2069.871] * (-2075.784) (-2076.183) (-2088.594) [-2075.568] -- 0:02:37
445200 -- (-2100.109) [-2075.336] (-2078.573) (-2069.163) * [-2076.271] (-2078.046) (-2082.899) (-2074.672) -- 0:02:37
445300 -- (-2086.449) [-2075.057] (-2081.430) (-2068.670) * (-2074.501) (-2075.800) (-2085.967) [-2074.578] -- 0:02:36
445400 -- (-2081.098) [-2069.683] (-2076.446) (-2072.549) * (-2075.816) (-2083.125) (-2085.113) [-2078.198] -- 0:02:36
445500 -- (-2085.402) (-2073.752) [-2076.833] (-2073.181) * (-2078.055) [-2076.173] (-2082.965) (-2074.252) -- 0:02:36
445600 -- (-2083.683) [-2067.226] (-2078.965) (-2082.444) * (-2089.221) [-2075.982] (-2076.633) (-2085.509) -- 0:02:36
445700 -- (-2082.343) [-2069.565] (-2085.255) (-2083.701) * (-2085.131) (-2075.765) [-2073.217] (-2088.973) -- 0:02:36
445800 -- (-2075.466) (-2076.868) [-2078.301] (-2084.872) * (-2092.782) (-2071.955) [-2072.753] (-2080.988) -- 0:02:36
445900 -- (-2078.048) (-2077.671) (-2080.688) [-2079.699] * (-2087.489) (-2077.981) [-2074.742] (-2081.502) -- 0:02:36
446000 -- (-2083.469) [-2075.940] (-2078.599) (-2078.577) * [-2075.611] (-2079.972) (-2075.764) (-2076.277) -- 0:02:36
Average standard deviation of split frequencies: 0.008604
446100 -- [-2078.383] (-2078.024) (-2081.218) (-2080.704) * [-2082.108] (-2085.488) (-2078.928) (-2077.430) -- 0:02:36
446200 -- (-2078.109) (-2077.475) [-2074.475] (-2073.709) * (-2086.037) [-2071.905] (-2073.926) (-2075.961) -- 0:02:36
446300 -- [-2074.200] (-2081.748) (-2074.332) (-2079.729) * (-2083.134) (-2080.527) (-2073.937) [-2075.834] -- 0:02:36
446400 -- [-2079.583] (-2080.876) (-2076.820) (-2085.703) * [-2084.276] (-2080.230) (-2069.237) (-2074.511) -- 0:02:36
446500 -- (-2082.309) (-2075.954) (-2079.826) [-2080.983] * (-2076.191) (-2073.277) [-2071.849] (-2076.916) -- 0:02:36
446600 -- (-2083.781) [-2074.511] (-2077.940) (-2076.217) * (-2081.550) [-2072.678] (-2073.116) (-2082.309) -- 0:02:36
446700 -- (-2080.516) [-2069.854] (-2076.646) (-2079.323) * (-2075.111) (-2070.822) [-2067.358] (-2080.582) -- 0:02:36
446800 -- (-2077.494) (-2076.320) (-2071.001) [-2072.916] * [-2074.973] (-2084.730) (-2076.143) (-2082.039) -- 0:02:36
446900 -- [-2074.642] (-2074.561) (-2080.752) (-2073.406) * [-2076.898] (-2079.879) (-2077.713) (-2087.567) -- 0:02:35
447000 -- (-2078.857) (-2082.991) (-2078.407) [-2073.430] * [-2078.274] (-2083.130) (-2082.437) (-2081.167) -- 0:02:35
Average standard deviation of split frequencies: 0.008734
447100 -- (-2081.148) [-2079.851] (-2081.074) (-2093.916) * (-2083.778) (-2082.313) [-2084.858] (-2075.118) -- 0:02:37
447200 -- [-2083.598] (-2078.530) (-2079.929) (-2091.852) * (-2084.340) [-2083.844] (-2075.260) (-2077.395) -- 0:02:36
447300 -- (-2086.853) [-2071.095] (-2073.214) (-2087.188) * [-2075.253] (-2082.819) (-2073.937) (-2074.779) -- 0:02:36
447400 -- [-2076.201] (-2070.869) (-2075.716) (-2083.964) * (-2077.389) (-2091.110) (-2077.303) [-2075.259] -- 0:02:36
447500 -- [-2074.712] (-2075.017) (-2079.203) (-2077.557) * (-2081.079) (-2081.191) [-2075.446] (-2074.626) -- 0:02:36
447600 -- (-2080.820) (-2074.372) (-2072.571) [-2075.717] * (-2093.671) (-2075.587) [-2075.934] (-2083.737) -- 0:02:36
447700 -- [-2077.047] (-2075.110) (-2076.615) (-2076.568) * (-2078.351) [-2079.321] (-2073.133) (-2078.062) -- 0:02:36
447800 -- [-2072.457] (-2078.024) (-2075.235) (-2080.698) * (-2074.781) [-2074.066] (-2076.198) (-2073.770) -- 0:02:36
447900 -- [-2076.814] (-2078.889) (-2077.039) (-2085.249) * (-2078.718) [-2068.472] (-2075.970) (-2084.755) -- 0:02:36
448000 -- (-2081.532) [-2072.543] (-2075.866) (-2086.933) * (-2089.170) (-2085.876) [-2075.604] (-2083.006) -- 0:02:36
Average standard deviation of split frequencies: 0.008626
448100 -- (-2074.509) (-2077.212) (-2082.212) [-2081.962] * [-2077.554] (-2078.501) (-2081.229) (-2080.691) -- 0:02:36
448200 -- (-2077.324) [-2072.313] (-2076.873) (-2086.994) * (-2079.323) [-2070.669] (-2079.235) (-2083.161) -- 0:02:36
448300 -- [-2078.715] (-2071.731) (-2080.032) (-2092.328) * (-2075.056) [-2069.102] (-2082.922) (-2085.646) -- 0:02:36
448400 -- (-2074.414) [-2070.246] (-2078.693) (-2074.872) * [-2080.361] (-2072.982) (-2079.783) (-2094.925) -- 0:02:36
448500 -- (-2073.928) [-2070.494] (-2076.455) (-2075.980) * (-2082.930) [-2069.593] (-2076.219) (-2084.155) -- 0:02:36
448600 -- (-2076.055) [-2073.742] (-2082.566) (-2081.309) * (-2087.909) [-2075.488] (-2079.522) (-2078.135) -- 0:02:36
448700 -- (-2082.810) [-2070.369] (-2082.114) (-2076.588) * (-2090.827) [-2073.926] (-2080.334) (-2079.512) -- 0:02:36
448800 -- (-2079.007) [-2072.953] (-2076.958) (-2078.150) * (-2082.377) [-2068.996] (-2074.108) (-2086.408) -- 0:02:35
448900 -- (-2084.259) [-2071.024] (-2077.188) (-2077.016) * (-2089.501) (-2067.681) [-2080.030] (-2082.717) -- 0:02:35
449000 -- (-2082.848) (-2074.047) [-2076.234] (-2084.756) * (-2087.746) [-2068.545] (-2073.563) (-2086.050) -- 0:02:35
Average standard deviation of split frequencies: 0.008935
449100 -- (-2080.534) [-2072.082] (-2075.726) (-2081.868) * (-2080.003) [-2069.996] (-2075.237) (-2080.351) -- 0:02:35
449200 -- (-2082.050) [-2071.502] (-2075.958) (-2080.958) * [-2072.044] (-2069.602) (-2073.297) (-2083.403) -- 0:02:35
449300 -- (-2082.677) [-2069.274] (-2082.119) (-2079.422) * (-2076.564) [-2068.561] (-2080.581) (-2078.627) -- 0:02:35
449400 -- (-2080.065) (-2075.126) [-2076.057] (-2078.361) * (-2084.652) [-2070.154] (-2083.098) (-2074.635) -- 0:02:35
449500 -- (-2085.011) [-2070.826] (-2073.497) (-2080.657) * (-2087.465) [-2069.655] (-2073.928) (-2079.475) -- 0:02:35
449600 -- (-2097.451) [-2068.484] (-2076.965) (-2081.518) * (-2082.167) [-2072.057] (-2076.026) (-2076.832) -- 0:02:35
449700 -- (-2077.651) [-2072.583] (-2075.960) (-2081.357) * (-2084.372) [-2074.257] (-2082.017) (-2085.893) -- 0:02:35
449800 -- [-2079.479] (-2080.268) (-2076.838) (-2073.042) * (-2084.252) (-2075.883) [-2074.823] (-2084.517) -- 0:02:35
449900 -- (-2083.133) [-2071.992] (-2081.648) (-2074.559) * (-2084.654) (-2071.013) [-2080.896] (-2076.664) -- 0:02:35
450000 -- (-2082.023) (-2074.578) (-2086.196) [-2073.801] * (-2079.972) [-2072.335] (-2083.644) (-2085.446) -- 0:02:35
Average standard deviation of split frequencies: 0.009186
450100 -- (-2085.865) [-2072.563] (-2089.723) (-2084.847) * (-2091.909) [-2067.547] (-2091.507) (-2086.227) -- 0:02:35
450200 -- (-2082.813) [-2082.133] (-2089.410) (-2079.869) * (-2080.356) [-2072.209] (-2087.251) (-2085.231) -- 0:02:35
450300 -- [-2078.057] (-2079.653) (-2078.072) (-2075.177) * [-2084.101] (-2082.525) (-2080.749) (-2086.735) -- 0:02:35
450400 -- (-2084.715) (-2081.643) (-2078.795) [-2072.835] * (-2077.080) (-2073.461) [-2066.424] (-2081.142) -- 0:02:34
450500 -- (-2081.860) [-2070.735] (-2076.916) (-2080.366) * (-2086.684) [-2072.410] (-2070.067) (-2076.148) -- 0:02:34
450600 -- (-2083.496) [-2069.862] (-2076.712) (-2087.074) * (-2086.953) (-2073.375) [-2069.502] (-2090.329) -- 0:02:34
450700 -- (-2078.599) [-2073.869] (-2075.146) (-2085.076) * (-2081.805) (-2072.713) [-2071.372] (-2098.679) -- 0:02:36
450800 -- [-2075.705] (-2072.375) (-2078.939) (-2085.664) * [-2083.489] (-2080.348) (-2074.007) (-2088.861) -- 0:02:35
450900 -- [-2080.362] (-2079.442) (-2077.184) (-2084.945) * (-2084.093) (-2079.296) [-2074.332] (-2097.838) -- 0:02:35
451000 -- (-2085.884) (-2072.835) [-2083.747] (-2080.082) * [-2075.017] (-2077.256) (-2072.228) (-2093.586) -- 0:02:35
Average standard deviation of split frequencies: 0.009224
451100 -- (-2079.247) [-2077.720] (-2076.570) (-2092.029) * [-2085.953] (-2080.150) (-2076.546) (-2078.739) -- 0:02:35
451200 -- (-2086.875) (-2077.710) [-2078.663] (-2079.703) * (-2081.637) (-2085.553) (-2080.971) [-2077.567] -- 0:02:35
451300 -- [-2078.553] (-2081.397) (-2082.176) (-2082.303) * (-2082.873) (-2084.554) [-2079.338] (-2079.806) -- 0:02:35
451400 -- (-2081.229) (-2092.418) (-2083.075) [-2078.544] * (-2079.505) (-2082.615) [-2072.962] (-2072.302) -- 0:02:35
451500 -- (-2084.457) [-2077.814] (-2075.111) (-2092.034) * (-2079.668) [-2073.453] (-2076.027) (-2078.515) -- 0:02:35
451600 -- [-2076.305] (-2081.353) (-2078.795) (-2081.303) * (-2081.853) [-2072.031] (-2078.500) (-2084.053) -- 0:02:35
451700 -- [-2076.137] (-2084.654) (-2084.274) (-2083.630) * (-2084.011) (-2071.835) (-2079.716) [-2075.977] -- 0:02:35
451800 -- (-2076.072) (-2080.474) (-2080.010) [-2081.211] * (-2089.090) [-2071.712] (-2070.546) (-2079.174) -- 0:02:35
451900 -- (-2080.524) [-2075.863] (-2080.614) (-2082.085) * (-2082.992) (-2075.598) [-2073.089] (-2078.234) -- 0:02:35
452000 -- [-2071.802] (-2069.214) (-2079.186) (-2080.782) * (-2083.843) (-2073.706) [-2075.186] (-2083.191) -- 0:02:35
Average standard deviation of split frequencies: 0.009622
452100 -- (-2069.909) [-2069.931] (-2085.036) (-2077.393) * [-2076.935] (-2071.495) (-2084.181) (-2085.399) -- 0:02:35
452200 -- [-2069.666] (-2075.281) (-2080.060) (-2080.315) * (-2079.332) [-2068.984] (-2082.902) (-2084.796) -- 0:02:35
452300 -- [-2074.192] (-2072.245) (-2081.187) (-2076.694) * [-2073.644] (-2075.534) (-2075.900) (-2090.824) -- 0:02:34
452400 -- (-2079.996) [-2077.673] (-2085.320) (-2083.965) * (-2077.745) [-2069.521] (-2072.215) (-2079.682) -- 0:02:34
452500 -- (-2071.011) [-2072.792] (-2076.837) (-2082.117) * (-2076.690) [-2072.704] (-2082.991) (-2080.490) -- 0:02:34
452600 -- (-2075.888) (-2079.342) [-2075.905] (-2083.506) * (-2073.588) [-2077.087] (-2073.521) (-2081.605) -- 0:02:34
452700 -- (-2080.833) [-2076.404] (-2084.692) (-2082.806) * (-2076.465) (-2077.973) (-2072.969) [-2078.826] -- 0:02:34
452800 -- [-2079.441] (-2076.203) (-2075.694) (-2072.939) * (-2076.994) [-2069.094] (-2080.866) (-2078.131) -- 0:02:34
452900 -- [-2074.824] (-2075.538) (-2076.708) (-2076.162) * (-2076.815) (-2071.602) (-2071.054) [-2074.722] -- 0:02:34
453000 -- (-2082.406) (-2070.481) [-2070.370] (-2075.821) * (-2084.586) [-2073.222] (-2070.662) (-2083.540) -- 0:02:34
Average standard deviation of split frequencies: 0.009451
453100 -- (-2078.838) (-2072.342) [-2076.482] (-2077.449) * (-2085.145) [-2067.747] (-2076.017) (-2084.064) -- 0:02:34
453200 -- (-2073.401) [-2076.351] (-2077.267) (-2085.294) * (-2084.289) [-2071.249] (-2072.351) (-2083.994) -- 0:02:34
453300 -- [-2073.332] (-2077.731) (-2085.311) (-2075.325) * (-2076.537) (-2071.385) [-2070.625] (-2089.553) -- 0:02:34
453400 -- (-2074.358) (-2078.249) (-2079.964) [-2071.673] * (-2080.301) [-2072.756] (-2071.184) (-2084.030) -- 0:02:34
453500 -- [-2072.546] (-2091.602) (-2084.814) (-2072.883) * (-2081.504) (-2073.791) [-2068.796] (-2082.011) -- 0:02:34
453600 -- [-2071.306] (-2092.145) (-2081.946) (-2077.989) * (-2076.972) (-2078.999) [-2068.715] (-2078.643) -- 0:02:34
453700 -- [-2073.663] (-2088.490) (-2083.625) (-2083.721) * (-2085.329) (-2079.513) (-2074.418) [-2081.207] -- 0:02:34
453800 -- [-2074.436] (-2084.832) (-2080.979) (-2089.461) * (-2088.868) [-2077.639] (-2072.209) (-2081.380) -- 0:02:34
453900 -- [-2072.625] (-2096.247) (-2080.441) (-2077.331) * (-2084.198) (-2079.326) [-2075.167] (-2096.401) -- 0:02:34
454000 -- (-2078.072) (-2085.278) [-2073.988] (-2076.159) * (-2086.745) (-2074.377) [-2071.114] (-2094.433) -- 0:02:33
Average standard deviation of split frequencies: 0.009698
454100 -- (-2077.860) (-2075.546) [-2079.116] (-2078.009) * (-2087.369) (-2072.363) [-2070.658] (-2094.685) -- 0:02:35
454200 -- [-2075.261] (-2075.451) (-2074.000) (-2077.600) * (-2084.651) (-2076.898) [-2070.968] (-2093.440) -- 0:02:35
454300 -- (-2079.891) (-2076.604) [-2076.688] (-2089.639) * (-2079.587) [-2074.847] (-2071.593) (-2091.860) -- 0:02:34
454400 -- (-2071.085) (-2083.725) (-2080.186) [-2079.865] * (-2083.562) (-2078.721) [-2069.346] (-2083.622) -- 0:02:34
454500 -- [-2074.526] (-2089.549) (-2079.497) (-2074.674) * (-2089.644) [-2073.965] (-2067.824) (-2080.623) -- 0:02:34
454600 -- [-2076.847] (-2080.538) (-2082.773) (-2079.293) * (-2080.027) (-2071.187) [-2073.464] (-2093.650) -- 0:02:34
454700 -- (-2076.540) (-2090.752) (-2084.123) [-2076.316] * (-2077.163) [-2071.184] (-2074.416) (-2074.511) -- 0:02:34
454800 -- (-2080.307) [-2074.027] (-2080.601) (-2084.895) * (-2078.406) [-2079.289] (-2074.750) (-2084.947) -- 0:02:34
454900 -- (-2078.351) (-2073.610) (-2078.434) [-2073.567] * (-2089.873) (-2082.399) (-2079.288) [-2077.859] -- 0:02:34
455000 -- (-2077.822) (-2078.159) [-2075.886] (-2082.618) * (-2088.944) (-2079.113) (-2082.593) [-2074.327] -- 0:02:34
Average standard deviation of split frequencies: 0.009498
455100 -- (-2079.199) (-2070.438) (-2083.289) [-2079.735] * [-2085.366] (-2077.218) (-2078.646) (-2077.975) -- 0:02:34
455200 -- (-2081.830) (-2074.611) (-2081.097) [-2076.435] * (-2082.001) [-2075.404] (-2089.388) (-2081.349) -- 0:02:34
455300 -- (-2083.392) [-2073.131] (-2076.012) (-2082.466) * [-2079.110] (-2073.363) (-2088.289) (-2086.419) -- 0:02:34
455400 -- [-2080.426] (-2073.607) (-2079.142) (-2090.100) * (-2081.127) [-2077.137] (-2085.889) (-2082.479) -- 0:02:34
455500 -- (-2087.726) [-2068.077] (-2084.481) (-2091.022) * (-2088.612) [-2074.761] (-2087.122) (-2083.225) -- 0:02:34
455600 -- (-2081.041) (-2071.049) (-2076.740) [-2076.572] * (-2085.333) (-2079.587) (-2086.983) [-2080.856] -- 0:02:34
455700 -- (-2078.696) [-2068.617] (-2075.090) (-2079.024) * (-2085.063) (-2076.161) [-2080.300] (-2086.246) -- 0:02:34
455800 -- (-2078.557) [-2068.585] (-2080.220) (-2076.751) * (-2074.629) [-2074.608] (-2087.009) (-2082.904) -- 0:02:34
455900 -- [-2077.697] (-2073.557) (-2086.070) (-2089.168) * (-2079.408) (-2074.679) (-2091.465) [-2080.280] -- 0:02:33
456000 -- (-2080.260) (-2077.752) (-2085.897) [-2076.952] * [-2078.214] (-2075.961) (-2091.278) (-2079.653) -- 0:02:33
Average standard deviation of split frequencies: 0.009833
456100 -- [-2077.532] (-2076.963) (-2088.781) (-2079.606) * (-2085.998) (-2069.887) (-2084.182) [-2078.272] -- 0:02:33
456200 -- [-2070.667] (-2079.298) (-2083.311) (-2086.042) * (-2086.446) [-2068.689] (-2080.237) (-2074.828) -- 0:02:33
456300 -- (-2076.592) (-2077.608) [-2080.674] (-2083.573) * (-2079.596) (-2084.155) (-2094.752) [-2071.409] -- 0:02:33
456400 -- [-2068.728] (-2078.533) (-2078.719) (-2074.679) * (-2081.237) (-2076.731) (-2082.961) [-2076.867] -- 0:02:33
456500 -- (-2072.456) (-2078.819) (-2082.472) [-2072.163] * [-2077.298] (-2075.081) (-2077.446) (-2077.206) -- 0:02:33
456600 -- (-2071.464) (-2073.648) (-2089.470) [-2076.176] * (-2082.995) (-2078.261) (-2072.344) [-2077.827] -- 0:02:33
456700 -- [-2071.369] (-2073.683) (-2080.769) (-2075.383) * (-2078.273) (-2081.202) (-2073.805) [-2077.088] -- 0:02:33
456800 -- (-2079.638) (-2074.332) (-2086.900) [-2077.293] * (-2073.660) [-2071.878] (-2080.302) (-2078.684) -- 0:02:33
456900 -- (-2080.375) [-2077.826] (-2078.969) (-2081.841) * [-2073.132] (-2075.674) (-2075.564) (-2081.901) -- 0:02:33
457000 -- (-2083.839) (-2072.956) [-2079.404] (-2077.462) * (-2078.466) [-2072.411] (-2086.416) (-2097.246) -- 0:02:33
Average standard deviation of split frequencies: 0.009633
457100 -- (-2078.083) (-2070.861) [-2075.882] (-2079.036) * (-2074.549) [-2079.212] (-2080.082) (-2088.672) -- 0:02:33
457200 -- (-2081.923) (-2074.352) (-2077.085) [-2076.199] * (-2074.337) (-2075.411) [-2075.439] (-2087.640) -- 0:02:33
457300 -- (-2087.573) (-2074.180) (-2085.782) [-2081.387] * [-2074.042] (-2074.347) (-2085.882) (-2089.320) -- 0:02:33
457400 -- (-2077.871) [-2070.534] (-2090.680) (-2078.782) * (-2073.430) [-2070.836] (-2077.008) (-2084.787) -- 0:02:33
457500 -- (-2080.163) [-2072.746] (-2083.380) (-2080.917) * [-2078.437] (-2067.839) (-2074.817) (-2083.809) -- 0:02:32
457600 -- (-2073.769) [-2073.980] (-2085.394) (-2090.805) * [-2077.256] (-2073.503) (-2079.882) (-2084.874) -- 0:02:32
457700 -- [-2075.177] (-2075.928) (-2096.587) (-2084.381) * (-2082.788) (-2070.987) [-2074.956] (-2089.055) -- 0:02:34
457800 -- [-2078.694] (-2073.859) (-2082.937) (-2086.987) * (-2088.297) [-2078.678] (-2075.183) (-2093.332) -- 0:02:33
457900 -- (-2075.069) (-2080.393) [-2080.954] (-2096.142) * (-2090.494) [-2068.462] (-2078.146) (-2085.277) -- 0:02:33
458000 -- [-2072.334] (-2073.575) (-2079.755) (-2092.103) * (-2093.688) [-2070.932] (-2076.534) (-2087.672) -- 0:02:33
Average standard deviation of split frequencies: 0.009760
458100 -- [-2077.905] (-2074.557) (-2081.284) (-2078.965) * (-2084.093) [-2071.669] (-2075.620) (-2096.455) -- 0:02:33
458200 -- (-2073.668) [-2072.637] (-2081.753) (-2082.558) * (-2079.254) [-2074.253] (-2074.161) (-2078.805) -- 0:02:33
458300 -- (-2072.978) [-2070.644] (-2090.238) (-2079.331) * [-2075.889] (-2067.814) (-2069.208) (-2078.174) -- 0:02:33
458400 -- (-2070.604) [-2072.289] (-2078.606) (-2084.720) * (-2074.571) [-2070.449] (-2075.923) (-2085.117) -- 0:02:33
458500 -- [-2077.175] (-2073.267) (-2089.244) (-2085.785) * (-2079.011) (-2074.574) [-2074.347] (-2082.207) -- 0:02:33
458600 -- (-2073.570) [-2075.321] (-2082.906) (-2088.139) * (-2095.835) (-2077.261) (-2078.976) [-2081.948] -- 0:02:33
458700 -- (-2074.573) [-2077.641] (-2084.935) (-2083.420) * (-2091.561) (-2080.465) (-2078.642) [-2079.251] -- 0:02:33
458800 -- (-2081.577) [-2079.045] (-2079.954) (-2075.654) * (-2080.312) (-2074.807) [-2079.854] (-2086.208) -- 0:02:33
458900 -- (-2078.857) (-2081.149) [-2076.706] (-2078.680) * (-2078.490) [-2072.939] (-2074.150) (-2080.651) -- 0:02:33
459000 -- (-2078.597) [-2074.672] (-2079.348) (-2073.335) * (-2082.828) [-2076.184] (-2078.149) (-2075.883) -- 0:02:33
Average standard deviation of split frequencies: 0.009738
459100 -- (-2083.217) [-2077.462] (-2080.811) (-2079.439) * (-2089.128) (-2075.748) [-2070.082] (-2081.037) -- 0:02:33
459200 -- (-2084.408) [-2079.184] (-2078.692) (-2079.318) * (-2092.828) (-2086.825) [-2070.389] (-2081.547) -- 0:02:33
459300 -- (-2089.664) [-2073.460] (-2083.734) (-2084.944) * (-2084.716) (-2071.567) [-2069.900] (-2092.468) -- 0:02:33
459400 -- (-2082.181) [-2075.193] (-2077.845) (-2081.997) * (-2081.363) [-2070.615] (-2076.462) (-2087.707) -- 0:02:32
459500 -- (-2085.437) [-2077.557] (-2081.498) (-2086.570) * (-2079.628) (-2075.517) [-2070.502] (-2085.318) -- 0:02:32
459600 -- [-2079.864] (-2073.569) (-2080.066) (-2085.991) * (-2080.585) (-2084.933) [-2069.286] (-2086.645) -- 0:02:32
459700 -- [-2078.240] (-2070.644) (-2087.578) (-2086.423) * (-2077.448) (-2079.892) [-2071.335] (-2084.209) -- 0:02:32
459800 -- (-2079.213) (-2074.780) (-2094.748) [-2075.010] * (-2071.074) [-2072.593] (-2073.396) (-2073.261) -- 0:02:32
459900 -- (-2084.959) [-2074.816] (-2092.563) (-2076.521) * (-2075.297) (-2071.567) [-2070.516] (-2076.551) -- 0:02:32
460000 -- (-2084.997) (-2078.615) (-2088.617) [-2081.088] * [-2072.349] (-2073.586) (-2075.116) (-2080.201) -- 0:02:32
Average standard deviation of split frequencies: 0.009367
460100 -- (-2082.081) (-2074.330) [-2088.151] (-2089.410) * (-2078.835) (-2074.719) [-2069.057] (-2076.111) -- 0:02:32
460200 -- (-2083.757) (-2080.978) (-2078.206) [-2075.595] * (-2072.212) [-2075.365] (-2075.957) (-2082.714) -- 0:02:32
460300 -- (-2091.657) (-2082.149) (-2079.383) [-2076.179] * [-2076.983] (-2070.330) (-2082.398) (-2079.206) -- 0:02:32
460400 -- (-2078.872) (-2083.414) [-2076.267] (-2072.326) * (-2068.537) [-2073.653] (-2072.954) (-2081.451) -- 0:02:32
460500 -- (-2085.347) (-2084.188) (-2089.375) [-2073.051] * (-2077.938) [-2074.748] (-2073.994) (-2088.087) -- 0:02:32
460600 -- (-2083.507) (-2080.334) [-2082.664] (-2081.303) * (-2079.830) (-2084.919) [-2074.225] (-2078.467) -- 0:02:32
460700 -- (-2085.673) (-2087.668) [-2072.197] (-2077.063) * [-2076.088] (-2074.721) (-2075.129) (-2083.564) -- 0:02:32
460800 -- (-2082.152) (-2096.041) [-2075.091] (-2078.050) * (-2072.684) (-2075.879) (-2079.893) [-2075.508] -- 0:02:32
460900 -- (-2079.111) (-2079.870) [-2077.089] (-2091.719) * (-2075.574) (-2088.711) (-2068.891) [-2074.519] -- 0:02:32
461000 -- [-2075.904] (-2082.824) (-2079.689) (-2083.923) * (-2079.709) (-2084.565) [-2069.724] (-2077.421) -- 0:02:31
Average standard deviation of split frequencies: 0.009170
461100 -- [-2077.185] (-2095.274) (-2075.210) (-2082.996) * (-2079.799) (-2082.250) [-2073.405] (-2078.899) -- 0:02:31
461200 -- (-2084.238) (-2084.531) (-2080.168) [-2078.038] * (-2082.646) [-2078.143] (-2076.211) (-2075.510) -- 0:02:33
461300 -- (-2081.009) (-2081.793) (-2076.952) [-2083.544] * (-2083.362) (-2079.826) (-2077.731) [-2077.487] -- 0:02:32
461400 -- (-2082.273) [-2082.301] (-2076.723) (-2075.298) * (-2080.801) (-2085.997) (-2076.861) [-2077.225] -- 0:02:32
461500 -- (-2087.885) (-2078.943) (-2081.461) [-2073.252] * (-2075.289) (-2074.298) [-2072.068] (-2083.606) -- 0:02:32
461600 -- (-2088.211) (-2077.726) (-2082.543) [-2077.552] * (-2082.238) (-2074.777) (-2071.689) [-2081.696] -- 0:02:32
461700 -- (-2088.654) (-2084.033) [-2079.952] (-2084.516) * (-2074.073) (-2077.466) [-2069.385] (-2086.526) -- 0:02:32
461800 -- (-2085.442) [-2074.094] (-2078.619) (-2078.029) * [-2072.839] (-2073.806) (-2075.332) (-2084.015) -- 0:02:32
461900 -- [-2077.185] (-2084.952) (-2088.787) (-2072.051) * (-2075.542) (-2078.428) [-2069.805] (-2077.602) -- 0:02:32
462000 -- (-2078.465) (-2084.326) (-2085.838) [-2075.767] * (-2077.282) [-2077.906] (-2076.888) (-2083.025) -- 0:02:32
Average standard deviation of split frequencies: 0.009093
462100 -- [-2078.854] (-2091.870) (-2081.680) (-2079.262) * [-2073.150] (-2075.793) (-2075.109) (-2090.944) -- 0:02:32
462200 -- [-2074.598] (-2083.477) (-2080.388) (-2092.351) * (-2081.331) (-2075.792) (-2076.661) [-2080.053] -- 0:02:32
462300 -- [-2075.215] (-2078.989) (-2078.776) (-2089.586) * [-2074.679] (-2075.112) (-2077.466) (-2084.229) -- 0:02:32
462400 -- (-2089.167) [-2076.400] (-2081.696) (-2080.149) * (-2079.605) [-2067.585] (-2077.307) (-2090.676) -- 0:02:32
462500 -- (-2083.544) [-2081.075] (-2083.648) (-2084.580) * (-2081.184) [-2072.281] (-2076.455) (-2086.098) -- 0:02:32
462600 -- (-2085.295) [-2078.099] (-2086.545) (-2103.013) * (-2078.043) (-2071.980) [-2072.603] (-2080.989) -- 0:02:32
462700 -- (-2080.886) [-2076.346] (-2084.673) (-2092.381) * (-2079.779) (-2070.279) [-2078.900] (-2083.915) -- 0:02:32
462800 -- [-2073.908] (-2087.972) (-2080.845) (-2088.589) * (-2080.308) [-2067.706] (-2074.543) (-2089.113) -- 0:02:32
462900 -- [-2073.714] (-2090.604) (-2081.299) (-2096.854) * (-2077.699) [-2068.109] (-2080.648) (-2083.051) -- 0:02:31
463000 -- (-2078.227) (-2088.717) (-2087.075) [-2084.065] * [-2073.875] (-2072.503) (-2079.371) (-2090.200) -- 0:02:31
Average standard deviation of split frequencies: 0.009043
463100 -- (-2083.964) (-2089.927) (-2083.159) [-2074.671] * (-2071.683) (-2074.347) [-2077.266] (-2088.964) -- 0:02:31
463200 -- (-2085.745) (-2085.288) (-2085.617) [-2076.713] * (-2076.398) (-2072.344) [-2074.953] (-2085.991) -- 0:02:31
463300 -- (-2083.041) (-2084.691) (-2079.557) [-2075.470] * (-2072.457) [-2072.809] (-2069.116) (-2087.207) -- 0:02:31
463400 -- (-2084.834) (-2086.850) (-2077.583) [-2075.348] * (-2074.016) [-2074.627] (-2065.318) (-2088.485) -- 0:02:31
463500 -- (-2089.157) (-2085.605) (-2076.758) [-2079.016] * (-2077.120) (-2073.959) [-2075.164] (-2101.018) -- 0:02:31
463600 -- (-2091.434) [-2078.671] (-2082.952) (-2088.433) * (-2075.834) [-2070.681] (-2076.351) (-2088.869) -- 0:02:31
463700 -- (-2082.818) (-2088.535) (-2083.653) [-2075.867] * (-2079.643) [-2068.565] (-2079.466) (-2089.345) -- 0:02:31
463800 -- (-2087.439) (-2082.113) (-2076.756) [-2074.466] * (-2077.455) [-2066.798] (-2073.970) (-2084.259) -- 0:02:31
463900 -- (-2089.222) (-2082.908) [-2076.762] (-2079.672) * (-2090.304) [-2070.367] (-2081.945) (-2093.393) -- 0:02:31
464000 -- [-2080.999] (-2091.674) (-2079.728) (-2085.408) * (-2095.228) [-2067.870] (-2078.123) (-2085.005) -- 0:02:31
Average standard deviation of split frequencies: 0.008880
464100 -- (-2078.790) (-2082.386) [-2080.173] (-2097.346) * (-2079.993) [-2074.996] (-2078.895) (-2084.507) -- 0:02:31
464200 -- (-2080.560) [-2079.081] (-2082.258) (-2089.050) * [-2074.354] (-2078.194) (-2084.839) (-2087.022) -- 0:02:31
464300 -- (-2085.703) [-2078.370] (-2083.969) (-2089.473) * (-2095.907) [-2072.441] (-2077.218) (-2081.655) -- 0:02:31
464400 -- (-2079.182) [-2080.479] (-2089.584) (-2081.837) * (-2088.041) (-2073.428) (-2076.022) [-2075.174] -- 0:02:31
464500 -- (-2078.028) [-2072.316] (-2077.381) (-2092.318) * (-2075.566) [-2074.741] (-2075.570) (-2080.666) -- 0:02:31
464600 -- (-2079.180) [-2075.344] (-2078.987) (-2092.740) * (-2081.393) [-2080.286] (-2073.214) (-2086.579) -- 0:02:30
464700 -- (-2082.970) [-2076.513] (-2073.658) (-2084.110) * (-2076.576) (-2075.446) [-2069.626] (-2084.827) -- 0:02:32
464800 -- (-2087.409) (-2075.950) [-2077.083] (-2086.968) * (-2077.377) (-2079.744) [-2072.027] (-2079.294) -- 0:02:31
464900 -- [-2074.400] (-2075.717) (-2077.363) (-2077.489) * (-2082.643) (-2086.435) [-2068.415] (-2083.020) -- 0:02:31
465000 -- (-2075.647) (-2079.638) (-2074.633) [-2079.957] * (-2079.736) (-2079.991) [-2067.800] (-2085.168) -- 0:02:31
Average standard deviation of split frequencies: 0.008773
465100 -- [-2076.623] (-2079.256) (-2077.862) (-2079.014) * [-2075.980] (-2082.144) (-2077.212) (-2089.368) -- 0:02:31
465200 -- (-2075.088) [-2075.688] (-2083.266) (-2077.084) * (-2073.077) (-2075.533) [-2072.545] (-2092.599) -- 0:02:31
465300 -- [-2077.712] (-2076.174) (-2084.693) (-2074.493) * (-2078.234) (-2079.632) [-2067.449] (-2090.620) -- 0:02:31
465400 -- [-2075.874] (-2080.528) (-2082.836) (-2076.165) * (-2079.949) (-2081.650) [-2069.007] (-2085.243) -- 0:02:31
465500 -- (-2074.539) (-2090.647) (-2080.724) [-2075.308] * [-2082.301] (-2072.191) (-2075.506) (-2084.124) -- 0:02:31
465600 -- [-2078.103] (-2080.886) (-2079.401) (-2088.888) * (-2079.867) (-2068.584) [-2075.605] (-2084.516) -- 0:02:31
465700 -- (-2085.732) (-2085.280) [-2075.959] (-2076.817) * (-2079.651) (-2079.123) [-2070.981] (-2079.717) -- 0:02:31
465800 -- (-2084.669) (-2088.612) (-2081.836) [-2073.577] * (-2085.511) [-2075.028] (-2067.784) (-2084.417) -- 0:02:31
465900 -- (-2074.677) (-2092.318) (-2078.089) [-2082.082] * (-2082.703) [-2073.566] (-2069.936) (-2079.929) -- 0:02:31
466000 -- [-2074.058] (-2089.769) (-2076.004) (-2083.440) * (-2079.932) [-2069.906] (-2081.974) (-2077.543) -- 0:02:31
Average standard deviation of split frequencies: 0.008842
466100 -- (-2073.980) (-2097.985) (-2076.251) [-2080.342] * (-2076.561) (-2083.570) [-2073.916] (-2082.472) -- 0:02:31
466200 -- [-2080.752] (-2081.742) (-2077.030) (-2082.251) * (-2079.807) (-2083.482) [-2078.384] (-2093.462) -- 0:02:31
466300 -- [-2074.158] (-2082.544) (-2082.301) (-2079.532) * (-2075.956) [-2075.826] (-2079.352) (-2089.892) -- 0:02:31
466400 -- [-2079.752] (-2086.646) (-2087.270) (-2084.273) * (-2078.420) (-2074.930) [-2084.208] (-2081.717) -- 0:02:31
466500 -- [-2078.686] (-2074.949) (-2075.518) (-2077.678) * [-2074.405] (-2073.010) (-2078.422) (-2083.664) -- 0:02:30
466600 -- (-2083.752) [-2076.484] (-2080.488) (-2083.590) * (-2081.040) [-2077.195] (-2082.285) (-2081.477) -- 0:02:30
466700 -- [-2077.026] (-2077.943) (-2077.077) (-2077.551) * (-2079.156) (-2074.732) [-2077.406] (-2092.728) -- 0:02:30
466800 -- (-2086.012) (-2078.273) [-2075.209] (-2073.028) * (-2082.662) (-2068.387) [-2078.765] (-2088.784) -- 0:02:30
466900 -- (-2085.180) (-2083.453) (-2084.451) [-2074.763] * (-2081.132) (-2073.765) [-2074.750] (-2079.700) -- 0:02:30
467000 -- (-2080.052) [-2078.239] (-2081.595) (-2073.698) * (-2079.607) (-2078.302) [-2076.294] (-2088.115) -- 0:02:30
Average standard deviation of split frequencies: 0.008764
467100 -- (-2083.266) (-2083.896) (-2090.714) [-2073.571] * [-2076.792] (-2072.021) (-2078.893) (-2091.690) -- 0:02:30
467200 -- (-2078.521) [-2078.686] (-2091.922) (-2075.375) * (-2073.730) [-2071.570] (-2074.072) (-2076.006) -- 0:02:30
467300 -- [-2074.403] (-2081.109) (-2090.812) (-2077.439) * [-2075.593] (-2071.396) (-2074.038) (-2084.126) -- 0:02:30
467400 -- (-2082.307) (-2081.647) (-2083.732) [-2074.974] * (-2077.054) (-2078.758) [-2074.018] (-2077.661) -- 0:02:30
467500 -- (-2078.494) (-2087.278) (-2084.403) [-2076.310] * (-2075.161) [-2076.473] (-2071.052) (-2084.307) -- 0:02:30
467600 -- [-2073.692] (-2085.267) (-2079.629) (-2085.366) * (-2070.976) (-2089.695) [-2070.938] (-2094.017) -- 0:02:30
467700 -- [-2080.779] (-2083.329) (-2085.176) (-2089.280) * [-2076.505] (-2086.927) (-2070.586) (-2104.144) -- 0:02:30
467800 -- [-2075.846] (-2076.112) (-2079.624) (-2091.051) * (-2078.842) (-2095.761) [-2075.289] (-2082.489) -- 0:02:30
467900 -- (-2082.050) (-2084.190) [-2079.836] (-2076.750) * (-2074.648) (-2080.098) [-2077.675] (-2086.609) -- 0:02:30
468000 -- (-2092.363) (-2074.969) (-2082.268) [-2075.488] * (-2074.327) (-2076.376) [-2073.489] (-2079.715) -- 0:02:30
Average standard deviation of split frequencies: 0.008372
468100 -- (-2081.952) [-2075.808] (-2083.195) (-2079.455) * (-2077.611) [-2078.937] (-2070.966) (-2080.276) -- 0:02:31
468200 -- (-2091.166) [-2078.408] (-2080.957) (-2084.712) * (-2074.797) (-2074.751) [-2073.212] (-2082.861) -- 0:02:31
468300 -- (-2084.926) [-2083.672] (-2077.030) (-2087.062) * (-2079.863) (-2073.863) [-2069.506] (-2085.278) -- 0:02:31
468400 -- (-2080.545) [-2078.301] (-2080.400) (-2092.546) * (-2078.024) (-2076.165) [-2070.532] (-2080.559) -- 0:02:30
468500 -- (-2076.253) (-2070.964) (-2086.101) [-2077.697] * (-2076.553) [-2074.515] (-2069.029) (-2076.249) -- 0:02:30
468600 -- (-2080.203) [-2074.803] (-2079.801) (-2082.142) * (-2077.351) (-2071.649) [-2073.152] (-2079.715) -- 0:02:30
468700 -- (-2076.161) (-2074.942) [-2085.581] (-2083.194) * [-2072.928] (-2077.447) (-2072.076) (-2074.906) -- 0:02:30
468800 -- (-2075.320) [-2075.541] (-2085.163) (-2077.033) * (-2078.765) [-2071.143] (-2078.350) (-2076.284) -- 0:02:30
468900 -- [-2077.008] (-2080.924) (-2079.728) (-2084.763) * (-2078.289) (-2070.726) [-2077.400] (-2086.875) -- 0:02:30
469000 -- [-2079.461] (-2075.900) (-2081.617) (-2092.218) * (-2085.034) (-2075.177) [-2078.796] (-2077.761) -- 0:02:30
Average standard deviation of split frequencies: 0.008152
469100 -- (-2075.958) [-2071.577] (-2076.150) (-2089.574) * [-2080.066] (-2077.721) (-2078.327) (-2079.566) -- 0:02:30
469200 -- (-2088.972) [-2074.089] (-2079.400) (-2079.135) * (-2077.702) (-2076.972) [-2073.624] (-2085.433) -- 0:02:30
469300 -- (-2087.792) [-2066.755] (-2076.814) (-2071.188) * [-2079.646] (-2072.839) (-2080.939) (-2084.218) -- 0:02:30
469400 -- (-2084.627) [-2074.386] (-2081.685) (-2078.220) * (-2080.649) [-2076.670] (-2070.359) (-2081.674) -- 0:02:30
469500 -- [-2083.439] (-2076.011) (-2081.935) (-2073.175) * [-2079.317] (-2073.250) (-2075.847) (-2081.218) -- 0:02:30
469600 -- (-2073.663) (-2085.428) (-2080.403) [-2069.633] * [-2072.685] (-2080.463) (-2076.365) (-2097.336) -- 0:02:30
469700 -- (-2079.152) (-2086.644) (-2074.201) [-2074.234] * (-2076.087) (-2074.512) [-2072.636] (-2083.508) -- 0:02:30
469800 -- (-2085.148) [-2077.952] (-2077.817) (-2074.928) * (-2077.333) (-2074.888) [-2077.488] (-2087.494) -- 0:02:30
469900 -- (-2082.265) (-2074.154) (-2075.635) [-2076.673] * (-2081.987) (-2074.386) [-2073.565] (-2093.324) -- 0:02:30
470000 -- (-2082.761) (-2080.632) (-2079.908) [-2071.735] * (-2082.745) (-2074.218) [-2071.324] (-2079.941) -- 0:02:29
Average standard deviation of split frequencies: 0.008251
470100 -- (-2078.989) (-2078.855) [-2078.010] (-2071.954) * (-2086.261) (-2074.928) [-2077.354] (-2085.247) -- 0:02:29
470200 -- [-2076.132] (-2077.176) (-2079.153) (-2078.384) * [-2082.982] (-2074.408) (-2075.825) (-2082.628) -- 0:02:29
470300 -- [-2078.159] (-2085.688) (-2076.816) (-2071.308) * (-2087.489) [-2073.221] (-2082.215) (-2088.404) -- 0:02:29
470400 -- (-2080.127) (-2076.100) (-2084.216) [-2074.967] * [-2080.185] (-2077.847) (-2074.409) (-2079.734) -- 0:02:29
470500 -- (-2080.081) (-2080.014) (-2086.102) [-2072.657] * [-2076.077] (-2079.198) (-2076.287) (-2088.093) -- 0:02:29
470600 -- (-2080.194) [-2077.979] (-2089.000) (-2071.802) * (-2073.465) [-2072.209] (-2073.279) (-2087.541) -- 0:02:29
470700 -- (-2073.029) [-2071.268] (-2087.019) (-2078.426) * (-2076.586) (-2074.310) [-2074.852] (-2080.798) -- 0:02:29
470800 -- (-2078.289) [-2068.332] (-2080.110) (-2077.348) * [-2081.434] (-2068.051) (-2085.776) (-2082.222) -- 0:02:29
470900 -- (-2078.455) [-2075.745] (-2079.488) (-2085.566) * (-2085.839) (-2068.672) [-2076.400] (-2085.038) -- 0:02:29
471000 -- (-2087.069) [-2080.120] (-2081.951) (-2099.272) * (-2081.916) [-2073.631] (-2076.625) (-2079.251) -- 0:02:29
Average standard deviation of split frequencies: 0.008261
471100 -- (-2085.205) [-2073.245] (-2077.105) (-2098.071) * (-2082.879) [-2083.391] (-2075.432) (-2085.583) -- 0:02:29
471200 -- (-2085.503) [-2071.740] (-2078.019) (-2082.876) * (-2081.516) (-2081.221) (-2076.291) [-2075.424] -- 0:02:29
471300 -- [-2080.582] (-2072.970) (-2080.601) (-2081.126) * (-2084.175) (-2082.568) [-2075.331] (-2077.561) -- 0:02:29
471400 -- (-2083.630) [-2076.711] (-2082.266) (-2075.078) * (-2087.856) (-2076.804) [-2074.195] (-2077.393) -- 0:02:29
471500 -- (-2091.285) [-2067.846] (-2081.418) (-2078.691) * (-2077.824) [-2074.986] (-2072.135) (-2080.888) -- 0:02:29
471600 -- (-2085.146) [-2078.957] (-2075.974) (-2078.202) * (-2083.890) (-2075.564) [-2066.782] (-2080.635) -- 0:02:30
471700 -- (-2085.402) (-2077.201) [-2075.675] (-2076.794) * (-2082.707) (-2080.142) [-2068.827] (-2079.268) -- 0:02:30
471800 -- (-2081.107) [-2082.892] (-2081.454) (-2079.468) * (-2080.884) (-2069.747) (-2082.025) [-2078.375] -- 0:02:30
471900 -- [-2075.836] (-2079.680) (-2075.596) (-2082.475) * (-2091.981) (-2076.043) (-2085.995) [-2076.693] -- 0:02:29
472000 -- (-2079.940) (-2084.681) [-2077.335] (-2073.415) * (-2103.402) (-2076.269) (-2081.107) [-2080.827] -- 0:02:29
Average standard deviation of split frequencies: 0.008016
472100 -- (-2087.132) (-2077.156) (-2083.201) [-2071.861] * (-2086.508) (-2077.441) [-2081.438] (-2083.573) -- 0:02:29
472200 -- (-2079.062) (-2074.897) (-2084.125) [-2072.095] * (-2081.733) [-2072.811] (-2080.335) (-2099.536) -- 0:02:29
472300 -- (-2083.690) (-2074.083) (-2092.923) [-2079.790] * (-2079.592) [-2073.492] (-2075.962) (-2083.181) -- 0:02:29
472400 -- (-2080.167) (-2078.294) (-2080.471) [-2079.352] * (-2086.466) [-2079.825] (-2075.767) (-2084.139) -- 0:02:29
472500 -- [-2076.238] (-2084.380) (-2083.832) (-2085.983) * (-2079.521) (-2076.591) [-2076.406] (-2079.174) -- 0:02:29
472600 -- (-2078.235) [-2073.018] (-2083.725) (-2075.657) * (-2081.132) [-2077.452] (-2078.396) (-2074.743) -- 0:02:29
472700 -- (-2077.655) (-2075.317) (-2083.851) [-2073.381] * (-2085.955) (-2081.168) [-2078.677] (-2075.117) -- 0:02:29
472800 -- (-2080.506) (-2070.160) (-2075.766) [-2071.323] * (-2084.316) [-2073.845] (-2083.381) (-2081.238) -- 0:02:29
472900 -- (-2075.858) [-2071.197] (-2084.913) (-2071.767) * (-2087.576) (-2074.835) (-2082.078) [-2075.422] -- 0:02:29
473000 -- (-2081.061) (-2073.396) (-2081.867) [-2071.102] * (-2089.177) (-2073.860) [-2080.986] (-2089.543) -- 0:02:29
Average standard deviation of split frequencies: 0.007998
473100 -- [-2073.354] (-2082.660) (-2076.921) (-2073.972) * (-2092.737) [-2071.576] (-2077.024) (-2078.320) -- 0:02:29
473200 -- (-2074.602) (-2080.529) (-2079.651) [-2072.797] * (-2089.741) [-2076.138] (-2088.385) (-2077.950) -- 0:02:29
473300 -- (-2081.525) (-2074.800) (-2081.191) [-2073.303] * (-2080.054) (-2080.401) (-2078.333) [-2074.784] -- 0:02:29
473400 -- (-2083.381) (-2086.427) (-2077.665) [-2069.173] * (-2085.444) (-2076.994) [-2074.160] (-2079.562) -- 0:02:29
473500 -- (-2082.456) (-2082.842) [-2079.441] (-2078.501) * (-2087.274) (-2072.423) (-2078.226) [-2075.945] -- 0:02:28
473600 -- (-2077.355) (-2076.086) [-2076.393] (-2083.721) * (-2080.889) (-2081.606) [-2072.436] (-2080.400) -- 0:02:28
473700 -- [-2079.171] (-2073.415) (-2087.280) (-2087.183) * (-2084.361) (-2077.702) [-2068.448] (-2076.548) -- 0:02:28
473800 -- [-2077.370] (-2076.005) (-2085.660) (-2093.651) * (-2081.862) [-2074.381] (-2071.600) (-2079.420) -- 0:02:28
473900 -- (-2084.953) [-2073.482] (-2088.731) (-2092.256) * (-2079.694) [-2074.094] (-2076.110) (-2072.348) -- 0:02:28
474000 -- [-2071.848] (-2079.142) (-2082.436) (-2076.790) * (-2085.721) (-2075.102) (-2075.705) [-2079.759] -- 0:02:28
Average standard deviation of split frequencies: 0.008096
474100 -- [-2074.156] (-2071.818) (-2088.874) (-2078.535) * (-2088.405) [-2073.415] (-2072.904) (-2078.099) -- 0:02:28
474200 -- (-2073.408) (-2074.904) [-2080.730] (-2079.166) * (-2080.877) (-2077.483) [-2074.480] (-2074.648) -- 0:02:28
474300 -- (-2081.519) (-2079.736) [-2076.697] (-2076.415) * (-2078.257) (-2076.977) (-2082.336) [-2076.138] -- 0:02:28
474400 -- [-2074.303] (-2079.912) (-2073.521) (-2083.720) * (-2079.611) (-2070.790) [-2073.787] (-2088.430) -- 0:02:28
474500 -- (-2084.718) (-2081.786) [-2073.069] (-2078.265) * [-2080.345] (-2074.156) (-2080.079) (-2082.113) -- 0:02:28
474600 -- (-2083.310) (-2079.900) [-2078.224] (-2078.258) * [-2080.836] (-2074.501) (-2072.843) (-2080.452) -- 0:02:28
474700 -- (-2087.881) (-2089.124) [-2077.992] (-2070.271) * (-2086.550) (-2077.014) (-2076.165) [-2072.085] -- 0:02:28
474800 -- (-2087.230) (-2084.041) [-2076.118] (-2074.612) * [-2074.067] (-2077.816) (-2075.125) (-2074.746) -- 0:02:28
474900 -- (-2080.303) (-2079.990) (-2078.028) [-2069.291] * [-2075.763] (-2074.346) (-2076.558) (-2090.532) -- 0:02:28
475000 -- (-2083.856) (-2078.969) (-2079.598) [-2072.515] * (-2075.787) [-2074.385] (-2076.926) (-2085.659) -- 0:02:28
Average standard deviation of split frequencies: 0.008021
475100 -- [-2074.146] (-2080.441) (-2080.563) (-2073.499) * (-2077.186) (-2080.628) [-2075.916] (-2086.958) -- 0:02:29
475200 -- (-2084.100) (-2077.832) (-2086.211) [-2071.238] * [-2077.296] (-2071.285) (-2074.661) (-2083.312) -- 0:02:29
475300 -- (-2083.579) [-2075.974] (-2084.333) (-2075.986) * (-2081.598) (-2076.381) (-2079.210) [-2079.812] -- 0:02:29
475400 -- (-2086.698) (-2085.381) (-2080.548) [-2075.867] * (-2081.041) [-2075.063] (-2084.014) (-2081.722) -- 0:02:28
475500 -- [-2079.378] (-2081.852) (-2096.911) (-2077.238) * (-2085.922) (-2078.892) (-2084.677) [-2077.875] -- 0:02:28
475600 -- (-2076.561) (-2080.210) (-2084.880) [-2074.687] * (-2085.408) (-2069.369) [-2078.041] (-2078.811) -- 0:02:28
475700 -- (-2085.972) (-2083.070) (-2089.188) [-2078.301] * (-2092.732) (-2078.771) [-2070.672] (-2075.241) -- 0:02:28
475800 -- (-2081.517) [-2077.398] (-2080.061) (-2073.130) * (-2085.450) (-2073.925) (-2075.718) [-2085.654] -- 0:02:28
475900 -- (-2078.399) (-2078.610) [-2077.240] (-2077.634) * (-2084.847) [-2069.849] (-2069.461) (-2080.390) -- 0:02:28
476000 -- (-2078.562) (-2084.851) (-2078.179) [-2077.434] * (-2088.372) [-2075.566] (-2067.582) (-2080.278) -- 0:02:28
Average standard deviation of split frequencies: 0.008062
476100 -- (-2082.399) (-2073.903) (-2085.105) [-2073.089] * (-2094.396) [-2070.031] (-2070.867) (-2073.898) -- 0:02:28
476200 -- (-2081.216) [-2075.341] (-2081.621) (-2076.489) * (-2092.091) [-2075.435] (-2074.299) (-2080.698) -- 0:02:28
476300 -- (-2089.755) [-2079.446] (-2081.137) (-2069.886) * (-2089.672) [-2071.178] (-2079.595) (-2084.327) -- 0:02:28
476400 -- (-2085.945) [-2078.500] (-2086.364) (-2075.667) * (-2087.574) [-2071.406] (-2074.894) (-2078.093) -- 0:02:28
476500 -- (-2077.527) (-2081.096) [-2080.303] (-2068.797) * (-2081.446) (-2074.531) [-2074.617] (-2075.896) -- 0:02:28
476600 -- (-2073.325) (-2080.088) [-2082.537] (-2072.800) * (-2081.684) (-2071.718) [-2070.776] (-2080.088) -- 0:02:28
476700 -- (-2077.258) (-2077.890) (-2078.595) [-2070.203] * (-2082.191) (-2070.132) [-2070.341] (-2087.138) -- 0:02:28
476800 -- (-2074.985) (-2078.681) (-2085.135) [-2070.557] * [-2077.267] (-2079.545) (-2075.924) (-2079.853) -- 0:02:28
476900 -- [-2077.818] (-2075.602) (-2079.653) (-2086.822) * (-2081.844) (-2080.788) [-2070.633] (-2082.020) -- 0:02:28
477000 -- [-2072.214] (-2075.917) (-2087.684) (-2086.709) * (-2084.563) (-2070.951) [-2070.988] (-2078.997) -- 0:02:28
Average standard deviation of split frequencies: 0.008044
477100 -- (-2073.982) (-2082.833) (-2086.750) [-2074.242] * (-2082.294) (-2072.781) [-2073.766] (-2081.734) -- 0:02:27
477200 -- [-2071.402] (-2084.735) (-2091.667) (-2082.815) * (-2081.318) [-2071.341] (-2075.616) (-2077.588) -- 0:02:27
477300 -- [-2076.426] (-2082.364) (-2090.272) (-2082.091) * (-2085.742) (-2073.951) [-2075.680] (-2089.556) -- 0:02:27
477400 -- [-2075.620] (-2084.588) (-2090.928) (-2079.898) * (-2079.149) (-2078.438) [-2074.268] (-2084.348) -- 0:02:27
477500 -- [-2073.868] (-2072.364) (-2093.548) (-2075.915) * (-2084.331) [-2074.500] (-2077.368) (-2081.846) -- 0:02:27
477600 -- (-2078.391) [-2072.186] (-2099.248) (-2081.504) * (-2085.003) (-2068.833) [-2071.409] (-2080.652) -- 0:02:27
477700 -- (-2075.412) [-2076.588] (-2099.533) (-2077.298) * (-2079.546) (-2067.940) [-2068.871] (-2080.868) -- 0:02:27
477800 -- (-2079.700) (-2080.858) (-2092.113) [-2074.800] * (-2082.271) [-2071.867] (-2071.181) (-2075.285) -- 0:02:27
477900 -- [-2072.634] (-2086.107) (-2081.499) (-2074.205) * (-2081.196) [-2073.230] (-2071.037) (-2075.325) -- 0:02:27
478000 -- (-2079.549) [-2074.985] (-2089.724) (-2079.959) * (-2088.115) (-2083.556) [-2074.480] (-2082.980) -- 0:02:27
Average standard deviation of split frequencies: 0.007972
478100 -- [-2076.626] (-2083.889) (-2086.169) (-2075.835) * (-2081.947) (-2081.731) (-2073.939) [-2076.527] -- 0:02:27
478200 -- (-2077.483) (-2080.536) (-2091.245) [-2073.977] * (-2077.645) (-2080.892) [-2074.485] (-2083.537) -- 0:02:27
478300 -- (-2082.471) (-2076.890) (-2082.313) [-2072.367] * (-2078.591) (-2075.738) [-2074.241] (-2079.108) -- 0:02:27
478400 -- (-2078.844) (-2076.738) (-2088.358) [-2072.672] * (-2079.766) [-2074.917] (-2073.160) (-2078.453) -- 0:02:27
478500 -- (-2071.920) [-2076.881] (-2088.764) (-2078.442) * (-2085.368) (-2071.466) [-2071.041] (-2077.421) -- 0:02:27
478600 -- [-2076.565] (-2079.083) (-2076.990) (-2070.496) * (-2079.787) [-2075.159] (-2073.887) (-2097.271) -- 0:02:28
478700 -- (-2070.058) [-2069.139] (-2077.215) (-2071.710) * (-2077.186) [-2076.967] (-2077.415) (-2085.603) -- 0:02:28
478800 -- [-2071.188] (-2076.596) (-2077.880) (-2076.298) * [-2081.172] (-2076.569) (-2081.391) (-2083.188) -- 0:02:28
478900 -- [-2077.958] (-2073.108) (-2079.582) (-2077.849) * (-2078.174) [-2077.753] (-2080.950) (-2090.185) -- 0:02:27
479000 -- (-2078.867) [-2072.997] (-2081.739) (-2074.532) * (-2074.110) [-2079.548] (-2088.086) (-2097.007) -- 0:02:27
Average standard deviation of split frequencies: 0.007814
479100 -- (-2084.133) (-2089.367) (-2078.996) [-2074.508] * (-2077.172) (-2072.972) [-2080.719] (-2099.658) -- 0:02:27
479200 -- (-2075.946) (-2089.598) (-2085.796) [-2083.667] * (-2077.439) [-2077.062] (-2073.256) (-2093.863) -- 0:02:27
479300 -- [-2075.673] (-2078.572) (-2075.979) (-2078.630) * [-2072.376] (-2070.834) (-2080.325) (-2095.300) -- 0:02:27
479400 -- (-2070.830) (-2076.690) (-2072.603) [-2075.979] * (-2076.948) [-2074.462] (-2077.378) (-2096.530) -- 0:02:27
479500 -- [-2070.977] (-2074.797) (-2080.703) (-2081.016) * (-2082.768) (-2090.103) [-2069.540] (-2087.003) -- 0:02:27
479600 -- [-2076.141] (-2080.079) (-2080.462) (-2078.408) * (-2078.993) (-2081.625) [-2072.218] (-2085.068) -- 0:02:27
479700 -- [-2072.205] (-2087.974) (-2085.969) (-2075.716) * [-2073.720] (-2073.976) (-2074.362) (-2088.098) -- 0:02:27
479800 -- (-2081.932) (-2076.680) (-2086.635) [-2073.772] * (-2070.235) [-2069.883] (-2077.917) (-2086.710) -- 0:02:27
479900 -- (-2083.306) (-2070.380) [-2077.691] (-2078.818) * [-2075.397] (-2078.353) (-2083.417) (-2083.302) -- 0:02:27
480000 -- (-2071.969) (-2076.371) [-2075.506] (-2084.000) * [-2078.780] (-2083.191) (-2084.452) (-2097.899) -- 0:02:27
Average standard deviation of split frequencies: 0.007686
480100 -- (-2075.322) (-2079.273) [-2074.390] (-2081.644) * (-2075.355) [-2067.671] (-2076.418) (-2084.052) -- 0:02:27
480200 -- (-2079.544) (-2079.021) (-2078.919) [-2080.453] * (-2080.918) [-2069.500] (-2074.623) (-2086.325) -- 0:02:27
480300 -- (-2083.783) [-2079.792] (-2090.113) (-2075.085) * (-2088.086) [-2069.959] (-2077.912) (-2077.019) -- 0:02:27
480400 -- (-2076.636) [-2074.590] (-2081.984) (-2076.335) * (-2082.419) [-2070.043] (-2079.411) (-2076.569) -- 0:02:27
480500 -- (-2088.532) (-2074.834) (-2078.827) [-2076.367] * (-2084.420) (-2070.889) [-2075.163] (-2087.808) -- 0:02:27
480600 -- (-2086.751) [-2075.226] (-2079.761) (-2075.590) * (-2083.590) [-2070.327] (-2073.320) (-2085.973) -- 0:02:26
480700 -- (-2076.261) [-2070.448] (-2080.700) (-2080.245) * (-2094.450) [-2072.686] (-2083.911) (-2081.030) -- 0:02:26
480800 -- (-2072.843) [-2069.185] (-2079.895) (-2085.680) * (-2089.081) (-2070.537) [-2080.429] (-2080.706) -- 0:02:26
480900 -- (-2071.953) (-2070.170) [-2079.276] (-2077.683) * (-2079.136) [-2067.801] (-2073.649) (-2088.619) -- 0:02:26
481000 -- (-2073.741) (-2076.266) [-2077.512] (-2079.234) * [-2076.876] (-2073.697) (-2087.353) (-2083.507) -- 0:02:26
Average standard deviation of split frequencies: 0.007865
481100 -- (-2075.799) [-2071.669] (-2078.373) (-2072.859) * (-2078.808) (-2074.652) [-2078.641] (-2079.299) -- 0:02:26
481200 -- (-2082.950) [-2072.985] (-2077.710) (-2074.400) * (-2078.819) (-2072.575) (-2093.670) [-2077.829] -- 0:02:26
481300 -- (-2070.836) [-2069.817] (-2089.112) (-2079.085) * (-2075.426) (-2075.733) [-2089.835] (-2077.397) -- 0:02:26
481400 -- (-2078.161) [-2073.974] (-2079.638) (-2080.324) * [-2076.887] (-2070.596) (-2094.955) (-2076.381) -- 0:02:26
481500 -- (-2077.895) (-2074.994) (-2088.682) [-2071.147] * (-2076.211) [-2070.481] (-2084.610) (-2080.599) -- 0:02:26
481600 -- (-2096.035) (-2072.176) (-2081.204) [-2069.331] * (-2077.560) [-2074.018] (-2082.807) (-2085.478) -- 0:02:26
481700 -- (-2081.319) [-2073.288] (-2080.727) (-2080.052) * (-2074.074) [-2073.071] (-2081.612) (-2088.288) -- 0:02:26
481800 -- (-2081.940) [-2074.849] (-2078.868) (-2075.336) * (-2077.368) (-2069.348) (-2078.217) [-2074.268] -- 0:02:26
481900 -- (-2077.978) (-2072.594) (-2078.884) [-2078.802] * (-2082.137) [-2077.383] (-2086.505) (-2076.456) -- 0:02:26
482000 -- (-2083.517) (-2076.021) (-2087.134) [-2080.520] * (-2075.919) [-2071.566] (-2087.440) (-2078.051) -- 0:02:26
Average standard deviation of split frequencies: 0.007878
482100 -- [-2079.835] (-2075.358) (-2083.010) (-2079.459) * [-2076.165] (-2076.849) (-2079.516) (-2080.252) -- 0:02:27
482200 -- (-2073.956) (-2070.179) (-2079.818) [-2075.589] * (-2077.398) (-2081.609) (-2076.473) [-2077.755] -- 0:02:27
482300 -- [-2076.384] (-2071.388) (-2079.592) (-2086.614) * [-2068.950] (-2077.995) (-2076.309) (-2078.157) -- 0:02:27
482400 -- (-2078.514) (-2077.026) (-2079.417) [-2078.447] * (-2070.285) (-2074.861) [-2074.248] (-2093.410) -- 0:02:26
482500 -- [-2077.670] (-2075.951) (-2087.437) (-2073.605) * [-2073.518] (-2076.350) (-2082.617) (-2080.920) -- 0:02:26
482600 -- (-2072.042) (-2076.601) (-2085.432) [-2077.863] * [-2072.208] (-2071.313) (-2082.663) (-2079.566) -- 0:02:26
482700 -- [-2079.664] (-2078.414) (-2080.914) (-2076.702) * (-2079.475) (-2074.163) (-2077.781) [-2078.741] -- 0:02:26
482800 -- (-2096.443) [-2082.096] (-2083.331) (-2083.446) * (-2083.675) (-2079.530) [-2071.689] (-2079.310) -- 0:02:26
482900 -- (-2079.229) [-2074.198] (-2077.645) (-2080.813) * (-2076.503) (-2076.830) [-2072.252] (-2079.040) -- 0:02:26
483000 -- [-2069.385] (-2075.057) (-2085.163) (-2078.112) * [-2073.846] (-2079.414) (-2073.410) (-2088.731) -- 0:02:26
Average standard deviation of split frequencies: 0.008251
483100 -- (-2074.672) [-2070.791] (-2082.294) (-2083.630) * (-2072.339) (-2075.864) [-2072.186] (-2084.131) -- 0:02:26
483200 -- (-2075.563) (-2080.662) [-2074.993] (-2080.456) * (-2077.042) [-2074.293] (-2074.164) (-2091.549) -- 0:02:26
483300 -- (-2075.552) (-2075.319) [-2081.575] (-2088.852) * (-2078.866) (-2073.989) [-2076.743] (-2104.204) -- 0:02:26
483400 -- (-2077.612) [-2078.891] (-2083.523) (-2091.202) * (-2081.400) (-2076.257) [-2073.989] (-2114.825) -- 0:02:26
483500 -- (-2072.945) [-2073.410] (-2077.976) (-2093.856) * [-2076.837] (-2081.493) (-2087.789) (-2080.625) -- 0:02:26
483600 -- (-2077.355) [-2076.937] (-2085.972) (-2094.069) * (-2073.336) (-2075.916) (-2086.118) [-2083.726] -- 0:02:26
483700 -- (-2084.051) [-2070.777] (-2086.195) (-2087.482) * [-2077.481] (-2079.468) (-2092.183) (-2083.486) -- 0:02:26
483800 -- [-2078.678] (-2082.055) (-2083.108) (-2078.356) * [-2079.520] (-2088.948) (-2088.696) (-2079.782) -- 0:02:26
483900 -- (-2082.369) [-2071.714] (-2084.107) (-2077.942) * (-2075.640) (-2076.472) (-2090.373) [-2074.202] -- 0:02:26
484000 -- (-2077.228) [-2074.379] (-2076.781) (-2081.922) * (-2076.443) [-2072.647] (-2081.789) (-2076.602) -- 0:02:26
Average standard deviation of split frequencies: 0.007873
484100 -- (-2081.186) (-2083.949) (-2085.683) [-2081.012] * [-2079.390] (-2071.103) (-2077.538) (-2077.476) -- 0:02:25
484200 -- [-2078.866] (-2092.864) (-2085.264) (-2077.905) * (-2082.372) (-2074.169) [-2076.816] (-2079.313) -- 0:02:25
484300 -- [-2077.213] (-2082.345) (-2093.578) (-2079.080) * (-2084.280) (-2076.526) [-2073.019] (-2075.060) -- 0:02:25
484400 -- [-2074.085] (-2076.492) (-2086.837) (-2080.839) * (-2084.103) (-2078.999) (-2081.986) [-2076.795] -- 0:02:25
484500 -- [-2073.100] (-2085.700) (-2092.727) (-2085.840) * (-2087.452) (-2080.568) [-2076.730] (-2073.312) -- 0:02:25
484600 -- [-2072.335] (-2074.931) (-2086.037) (-2082.283) * (-2088.044) (-2086.021) [-2075.797] (-2073.353) -- 0:02:25
484700 -- [-2070.361] (-2073.254) (-2088.193) (-2090.944) * (-2078.464) (-2084.235) (-2076.314) [-2072.881] -- 0:02:25
484800 -- (-2072.331) (-2075.717) (-2096.520) [-2081.354] * [-2078.438] (-2076.242) (-2086.141) (-2074.560) -- 0:02:25
484900 -- (-2069.549) (-2076.355) (-2088.545) [-2075.021] * (-2079.501) (-2080.925) [-2077.620] (-2074.054) -- 0:02:25
485000 -- [-2067.302] (-2077.131) (-2077.981) (-2075.546) * (-2075.990) (-2091.034) [-2075.134] (-2075.494) -- 0:02:25
Average standard deviation of split frequencies: 0.007745
485100 -- [-2069.423] (-2080.420) (-2074.977) (-2077.894) * (-2076.652) (-2078.986) (-2074.769) [-2073.430] -- 0:02:25
485200 -- [-2070.077] (-2082.913) (-2077.856) (-2084.231) * [-2071.964] (-2084.684) (-2074.630) (-2079.667) -- 0:02:25
485300 -- [-2074.967] (-2085.640) (-2082.927) (-2076.239) * (-2070.445) (-2079.056) [-2078.493] (-2081.762) -- 0:02:25
485400 -- (-2077.898) (-2075.493) (-2081.523) [-2073.656] * (-2071.095) (-2083.066) [-2075.453] (-2082.733) -- 0:02:25
485500 -- (-2077.436) [-2073.712] (-2085.562) (-2079.370) * [-2067.899] (-2080.426) (-2079.330) (-2076.339) -- 0:02:25
485600 -- [-2075.193] (-2077.606) (-2087.107) (-2074.540) * (-2073.981) [-2084.035] (-2074.015) (-2078.896) -- 0:02:26
485700 -- (-2081.649) (-2076.841) (-2084.638) [-2074.734] * (-2069.877) (-2083.716) (-2078.372) [-2076.313] -- 0:02:26
485800 -- (-2077.530) (-2071.007) (-2088.945) [-2074.519] * (-2074.730) (-2083.710) (-2080.678) [-2078.413] -- 0:02:26
485900 -- (-2082.925) [-2077.999] (-2078.161) (-2082.482) * (-2073.715) (-2082.722) [-2080.633] (-2076.606) -- 0:02:26
486000 -- [-2078.823] (-2075.988) (-2082.230) (-2084.354) * [-2069.465] (-2086.528) (-2087.152) (-2076.279) -- 0:02:25
Average standard deviation of split frequencies: 0.007647
486100 -- (-2080.632) (-2076.284) (-2088.358) [-2077.286] * [-2075.064] (-2087.200) (-2084.370) (-2076.188) -- 0:02:25
486200 -- [-2079.722] (-2075.212) (-2095.362) (-2082.870) * (-2073.821) (-2083.175) (-2083.769) [-2077.471] -- 0:02:25
486300 -- [-2071.273] (-2083.874) (-2082.306) (-2078.956) * [-2070.448] (-2092.569) (-2085.097) (-2076.244) -- 0:02:25
486400 -- (-2075.393) (-2082.491) (-2080.601) [-2073.840] * (-2070.545) (-2083.162) [-2090.542] (-2081.559) -- 0:02:25
486500 -- (-2076.721) (-2083.121) (-2080.555) [-2076.326] * (-2072.853) [-2080.452] (-2086.735) (-2079.547) -- 0:02:25
486600 -- (-2076.731) [-2076.386] (-2103.108) (-2077.421) * [-2069.480] (-2082.855) (-2088.626) (-2075.528) -- 0:02:25
486700 -- (-2076.451) (-2081.369) (-2089.334) [-2075.415] * [-2073.452] (-2077.118) (-2085.010) (-2082.250) -- 0:02:25
486800 -- (-2075.884) (-2072.393) (-2081.064) [-2071.054] * (-2079.758) (-2085.143) (-2086.807) [-2078.278] -- 0:02:25
486900 -- [-2071.936] (-2092.658) (-2075.269) (-2077.697) * (-2084.689) (-2085.455) [-2082.853] (-2076.323) -- 0:02:25
487000 -- (-2076.105) (-2084.671) (-2077.180) [-2075.812] * (-2081.724) (-2079.751) (-2085.601) [-2076.319] -- 0:02:25
Average standard deviation of split frequencies: 0.007685
487100 -- [-2076.554] (-2078.818) (-2078.022) (-2077.388) * (-2079.757) (-2087.192) (-2081.227) [-2076.356] -- 0:02:25
487200 -- (-2076.178) (-2084.766) [-2077.820] (-2079.353) * (-2075.528) (-2092.391) [-2081.299] (-2074.804) -- 0:02:25
487300 -- [-2071.395] (-2075.862) (-2082.788) (-2077.625) * (-2071.966) (-2088.188) (-2079.334) [-2076.451] -- 0:02:25
487400 -- (-2070.908) [-2070.696] (-2078.349) (-2082.383) * [-2072.874] (-2080.062) (-2083.528) (-2079.136) -- 0:02:25
487500 -- (-2072.611) [-2072.450] (-2077.183) (-2078.198) * [-2075.471] (-2089.583) (-2077.387) (-2080.238) -- 0:02:25
487600 -- [-2068.987] (-2072.302) (-2077.840) (-2085.783) * [-2076.670] (-2084.425) (-2081.625) (-2081.992) -- 0:02:25
487700 -- [-2074.770] (-2073.582) (-2081.710) (-2085.565) * (-2081.732) [-2083.554] (-2076.669) (-2074.021) -- 0:02:24
487800 -- [-2067.367] (-2076.376) (-2084.125) (-2087.863) * [-2076.172] (-2081.335) (-2078.905) (-2082.891) -- 0:02:24
487900 -- [-2071.273] (-2075.016) (-2089.506) (-2082.492) * (-2073.314) [-2078.924] (-2090.906) (-2076.782) -- 0:02:24
488000 -- (-2073.296) [-2074.947] (-2085.674) (-2074.639) * (-2075.362) (-2083.248) (-2087.266) [-2073.835] -- 0:02:24
Average standard deviation of split frequencies: 0.007643
488100 -- [-2074.203] (-2075.622) (-2074.394) (-2081.434) * [-2071.603] (-2076.499) (-2081.395) (-2085.847) -- 0:02:24
488200 -- [-2071.024] (-2075.703) (-2081.838) (-2076.372) * [-2071.760] (-2075.650) (-2080.023) (-2077.141) -- 0:02:24
488300 -- (-2072.882) [-2068.354] (-2082.292) (-2078.933) * (-2077.167) (-2076.477) (-2090.382) [-2076.682] -- 0:02:24
488400 -- (-2073.992) (-2073.711) [-2082.304] (-2075.870) * (-2074.941) (-2076.849) (-2085.809) [-2082.754] -- 0:02:24
488500 -- (-2072.066) [-2068.911] (-2080.273) (-2082.471) * (-2077.232) [-2075.314] (-2082.651) (-2080.227) -- 0:02:24
488600 -- [-2071.942] (-2075.182) (-2083.182) (-2077.151) * [-2073.035] (-2076.040) (-2081.231) (-2081.956) -- 0:02:24
488700 -- (-2075.226) [-2075.034] (-2077.600) (-2081.679) * [-2072.848] (-2076.783) (-2083.424) (-2076.174) -- 0:02:24
488800 -- (-2072.866) [-2073.860] (-2088.803) (-2079.183) * (-2070.244) (-2091.889) (-2080.620) [-2080.332] -- 0:02:24
488900 -- (-2073.042) (-2075.094) (-2083.420) [-2076.631] * (-2071.202) (-2092.357) [-2074.398] (-2099.153) -- 0:02:24
489000 -- (-2079.442) [-2080.298] (-2089.500) (-2075.432) * (-2071.893) [-2079.576] (-2084.335) (-2085.604) -- 0:02:24
Average standard deviation of split frequencies: 0.007571
489100 -- (-2073.219) [-2072.987] (-2085.973) (-2074.892) * [-2074.433] (-2078.626) (-2082.705) (-2082.909) -- 0:02:25
489200 -- (-2080.557) (-2073.840) (-2085.237) [-2071.447] * [-2068.373] (-2077.714) (-2076.872) (-2079.904) -- 0:02:25
489300 -- (-2074.217) (-2077.642) [-2076.783] (-2074.358) * (-2081.019) (-2077.495) (-2080.486) [-2074.561] -- 0:02:25
489400 -- (-2085.734) (-2074.131) (-2078.585) [-2075.195] * [-2074.776] (-2079.113) (-2084.796) (-2076.173) -- 0:02:25
489500 -- [-2072.242] (-2073.822) (-2081.569) (-2083.775) * [-2076.714] (-2085.031) (-2081.104) (-2082.257) -- 0:02:24
489600 -- [-2073.985] (-2077.487) (-2089.239) (-2068.965) * (-2079.504) (-2096.710) [-2074.335] (-2084.288) -- 0:02:24
489700 -- (-2081.425) (-2077.963) [-2078.894] (-2074.693) * (-2075.347) (-2094.422) [-2073.653] (-2081.327) -- 0:02:24
489800 -- (-2071.243) (-2084.703) (-2093.136) [-2071.145] * [-2074.147] (-2083.315) (-2075.529) (-2092.913) -- 0:02:24
489900 -- [-2070.491] (-2090.499) (-2087.050) (-2073.492) * [-2070.726] (-2075.273) (-2079.506) (-2079.440) -- 0:02:24
490000 -- (-2070.539) (-2076.500) (-2085.478) [-2074.074] * [-2067.980] (-2076.198) (-2081.719) (-2085.236) -- 0:02:24
Average standard deviation of split frequencies: 0.007557
490100 -- [-2069.451] (-2072.829) (-2093.024) (-2068.506) * (-2070.321) [-2073.817] (-2079.642) (-2085.016) -- 0:02:24
490200 -- (-2070.230) (-2076.167) (-2082.672) [-2071.806] * [-2073.638] (-2075.904) (-2077.287) (-2085.206) -- 0:02:24
490300 -- (-2068.047) (-2081.164) (-2081.556) [-2072.050] * (-2070.649) (-2085.616) [-2079.431] (-2087.994) -- 0:02:24
490400 -- (-2070.696) (-2088.928) (-2084.668) [-2071.943] * [-2074.423] (-2080.457) (-2080.268) (-2086.300) -- 0:02:24
490500 -- [-2078.778] (-2088.424) (-2084.561) (-2076.586) * (-2074.078) (-2081.583) (-2077.561) [-2077.618] -- 0:02:24
490600 -- [-2073.456] (-2074.842) (-2086.682) (-2084.753) * [-2074.730] (-2080.044) (-2079.887) (-2082.332) -- 0:02:24
490700 -- (-2072.898) (-2082.330) (-2094.361) [-2075.680] * (-2075.588) (-2080.714) (-2082.991) [-2082.465] -- 0:02:24
490800 -- [-2071.978] (-2080.049) (-2091.207) (-2076.551) * (-2082.224) (-2083.778) (-2083.727) [-2082.425] -- 0:02:24
490900 -- (-2075.391) (-2071.726) (-2078.814) [-2069.254] * [-2072.042] (-2088.830) (-2089.877) (-2082.618) -- 0:02:24
491000 -- (-2076.008) [-2074.282] (-2080.037) (-2074.406) * (-2079.950) (-2077.852) [-2079.013] (-2080.466) -- 0:02:24
Average standard deviation of split frequencies: 0.007650
491100 -- (-2084.361) (-2073.482) [-2081.186] (-2073.501) * [-2074.806] (-2079.973) (-2078.938) (-2087.531) -- 0:02:24
491200 -- (-2083.461) (-2078.750) (-2078.070) [-2083.638] * (-2080.052) (-2083.346) (-2082.095) [-2084.147] -- 0:02:23
491300 -- (-2074.359) [-2070.972] (-2085.425) (-2080.382) * [-2081.837] (-2084.751) (-2080.193) (-2090.081) -- 0:02:23
491400 -- (-2084.202) [-2072.097] (-2086.247) (-2096.751) * (-2075.357) (-2084.582) [-2079.935] (-2088.993) -- 0:02:23
491500 -- [-2076.381] (-2075.307) (-2085.776) (-2087.718) * (-2076.448) (-2089.918) [-2077.605] (-2084.093) -- 0:02:23
491600 -- [-2071.930] (-2074.308) (-2079.489) (-2079.827) * (-2077.104) (-2085.219) (-2081.719) [-2074.177] -- 0:02:23
491700 -- (-2077.218) [-2073.883] (-2081.802) (-2074.445) * [-2080.148] (-2086.252) (-2075.817) (-2079.895) -- 0:02:23
491800 -- (-2071.395) [-2079.217] (-2087.006) (-2069.392) * [-2077.517] (-2081.959) (-2076.828) (-2077.349) -- 0:02:23
491900 -- [-2070.004] (-2078.754) (-2081.009) (-2078.376) * (-2081.533) (-2083.086) (-2082.336) [-2077.583] -- 0:02:23
492000 -- [-2071.448] (-2081.744) (-2079.061) (-2071.310) * (-2074.510) [-2078.167] (-2082.312) (-2073.439) -- 0:02:23
Average standard deviation of split frequencies: 0.007909
492100 -- (-2069.835) [-2081.180] (-2074.869) (-2084.124) * (-2077.435) (-2089.746) (-2081.413) [-2081.920] -- 0:02:23
492200 -- (-2071.089) (-2082.377) [-2077.242] (-2081.287) * (-2076.205) (-2082.392) (-2080.660) [-2081.851] -- 0:02:23
492300 -- [-2070.459] (-2081.053) (-2080.271) (-2077.270) * (-2075.915) (-2075.447) [-2077.703] (-2083.332) -- 0:02:23
492400 -- [-2068.726] (-2076.812) (-2076.931) (-2079.842) * (-2072.527) [-2080.944] (-2085.512) (-2083.798) -- 0:02:23
492500 -- [-2072.001] (-2078.264) (-2087.138) (-2085.294) * [-2070.695] (-2078.988) (-2078.965) (-2079.193) -- 0:02:23
492600 -- [-2070.273] (-2080.749) (-2094.686) (-2083.642) * [-2069.019] (-2088.197) (-2075.784) (-2087.917) -- 0:02:24
492700 -- [-2069.736] (-2077.967) (-2092.800) (-2085.513) * [-2075.943] (-2081.523) (-2076.154) (-2088.672) -- 0:02:24
492800 -- (-2073.801) [-2072.144] (-2087.080) (-2089.870) * [-2067.974] (-2089.482) (-2080.169) (-2074.731) -- 0:02:24
492900 -- (-2069.880) [-2074.335] (-2077.967) (-2089.093) * [-2074.174] (-2081.254) (-2088.803) (-2088.059) -- 0:02:24
493000 -- [-2071.330] (-2073.619) (-2082.255) (-2081.652) * [-2074.172] (-2081.305) (-2094.701) (-2080.456) -- 0:02:23
Average standard deviation of split frequencies: 0.007892
493100 -- (-2075.954) [-2075.081] (-2079.843) (-2089.214) * [-2082.202] (-2078.927) (-2083.739) (-2078.969) -- 0:02:23
493200 -- [-2069.195] (-2077.233) (-2078.362) (-2079.359) * (-2081.109) [-2077.778] (-2092.135) (-2081.818) -- 0:02:23
493300 -- (-2076.451) [-2077.097] (-2082.235) (-2080.679) * (-2082.767) [-2086.394] (-2096.349) (-2078.454) -- 0:02:23
493400 -- (-2076.242) (-2076.436) (-2092.597) [-2074.653] * (-2082.140) (-2080.982) (-2086.607) [-2077.851] -- 0:02:23
493500 -- [-2081.746] (-2075.795) (-2082.509) (-2079.430) * (-2078.126) (-2079.085) (-2085.184) [-2079.596] -- 0:02:23
493600 -- (-2079.269) (-2080.523) [-2076.508] (-2077.876) * (-2080.915) [-2076.109] (-2091.715) (-2079.189) -- 0:02:23
493700 -- [-2078.582] (-2085.464) (-2083.300) (-2077.654) * (-2073.352) (-2077.948) (-2086.405) [-2075.291] -- 0:02:23
493800 -- (-2090.839) (-2081.993) (-2080.157) [-2079.926] * (-2072.234) [-2075.212] (-2082.936) (-2077.791) -- 0:02:23
493900 -- (-2075.347) [-2074.995] (-2083.738) (-2078.496) * (-2071.751) (-2081.280) (-2081.668) [-2069.967] -- 0:02:23
494000 -- [-2070.062] (-2074.427) (-2084.999) (-2075.877) * [-2074.019] (-2086.279) (-2087.804) (-2069.062) -- 0:02:23
Average standard deviation of split frequencies: 0.008232
494100 -- (-2076.667) (-2079.916) [-2075.561] (-2070.548) * (-2083.149) (-2078.746) [-2081.128] (-2079.731) -- 0:02:23
494200 -- (-2076.753) (-2081.887) (-2078.800) [-2066.000] * (-2076.376) (-2087.676) (-2081.039) [-2073.239] -- 0:02:23
494300 -- (-2075.487) (-2080.278) (-2077.596) [-2072.006] * (-2077.375) (-2075.257) (-2091.844) [-2077.081] -- 0:02:23
494400 -- (-2073.702) (-2081.053) (-2086.737) [-2071.623] * (-2079.298) [-2076.645] (-2082.909) (-2075.136) -- 0:02:23
494500 -- (-2078.087) (-2082.108) (-2081.295) [-2071.531] * (-2083.613) [-2074.393] (-2092.038) (-2075.692) -- 0:02:23
494600 -- (-2076.614) (-2079.578) (-2085.015) [-2069.498] * (-2079.927) (-2075.374) (-2090.904) [-2073.943] -- 0:02:23
494700 -- (-2077.951) [-2078.654] (-2078.382) (-2077.190) * (-2079.803) (-2076.937) (-2098.298) [-2073.452] -- 0:02:22
494800 -- (-2083.426) (-2078.502) (-2092.366) [-2072.907] * (-2076.332) (-2082.310) (-2091.445) [-2074.951] -- 0:02:22
494900 -- [-2082.644] (-2081.645) (-2081.439) (-2081.990) * (-2080.398) (-2083.485) (-2080.955) [-2073.039] -- 0:02:22
495000 -- (-2084.612) (-2079.120) [-2077.713] (-2076.912) * (-2080.569) (-2084.580) [-2081.657] (-2074.291) -- 0:02:22
Average standard deviation of split frequencies: 0.008160
495100 -- (-2089.614) [-2076.155] (-2083.815) (-2073.355) * [-2073.298] (-2092.692) (-2095.493) (-2079.961) -- 0:02:22
495200 -- (-2080.555) (-2079.967) [-2079.971] (-2077.161) * [-2075.221] (-2098.109) (-2084.577) (-2086.193) -- 0:02:22
495300 -- (-2076.119) (-2080.513) (-2081.657) [-2075.622] * [-2077.674] (-2086.229) (-2083.319) (-2089.913) -- 0:02:22
495400 -- (-2075.891) [-2077.904] (-2077.069) (-2076.802) * (-2078.001) (-2085.508) (-2082.226) [-2079.487] -- 0:02:22
495500 -- (-2075.965) [-2073.911] (-2078.633) (-2076.695) * [-2072.698] (-2083.427) (-2078.888) (-2079.847) -- 0:02:22
495600 -- (-2071.435) (-2080.767) (-2078.296) [-2082.757] * [-2071.274] (-2082.354) (-2087.048) (-2075.221) -- 0:02:22
495700 -- (-2075.287) [-2081.988] (-2076.112) (-2079.178) * [-2075.004] (-2085.962) (-2090.428) (-2080.108) -- 0:02:22
495800 -- (-2076.744) (-2075.866) (-2075.615) [-2072.662] * (-2075.570) (-2086.522) [-2077.801] (-2080.854) -- 0:02:22
495900 -- (-2081.948) [-2077.959] (-2074.022) (-2069.636) * (-2073.120) (-2090.991) (-2076.801) [-2073.346] -- 0:02:22
496000 -- (-2081.825) (-2074.260) (-2074.082) [-2071.555] * [-2070.567] (-2090.329) (-2079.796) (-2073.784) -- 0:02:22
Average standard deviation of split frequencies: 0.008253
496100 -- (-2076.192) (-2080.634) (-2078.160) [-2074.143] * (-2070.255) (-2090.252) [-2078.690] (-2073.121) -- 0:02:23
496200 -- (-2076.551) (-2079.406) (-2077.316) [-2070.197] * (-2081.316) [-2081.843] (-2083.524) (-2077.990) -- 0:02:23
496300 -- (-2075.684) (-2089.582) (-2082.672) [-2074.027] * (-2076.601) (-2088.999) (-2078.580) [-2079.175] -- 0:02:23
496400 -- (-2081.388) (-2088.642) (-2081.073) [-2071.763] * (-2084.365) (-2074.067) [-2083.551] (-2083.064) -- 0:02:23
496500 -- (-2081.221) (-2085.298) (-2086.574) [-2068.860] * (-2073.585) [-2073.088] (-2081.732) (-2084.801) -- 0:02:22
496600 -- (-2076.314) (-2084.370) (-2083.994) [-2073.185] * (-2080.528) (-2084.432) (-2082.689) [-2077.916] -- 0:02:22
496700 -- [-2072.045] (-2086.226) (-2086.261) (-2070.708) * (-2084.170) (-2089.189) [-2078.443] (-2073.476) -- 0:02:22
496800 -- [-2071.225] (-2091.033) (-2081.890) (-2074.689) * (-2068.627) (-2077.704) [-2075.700] (-2073.060) -- 0:02:22
496900 -- [-2079.752] (-2094.947) (-2080.048) (-2075.907) * (-2075.920) [-2074.188] (-2079.427) (-2072.563) -- 0:02:22
497000 -- (-2081.588) [-2088.231] (-2080.608) (-2073.363) * (-2081.108) [-2072.865] (-2081.095) (-2077.780) -- 0:02:22
Average standard deviation of split frequencies: 0.008533
497100 -- (-2084.412) (-2075.547) (-2083.832) [-2067.535] * (-2082.168) [-2071.093] (-2078.031) (-2077.151) -- 0:02:22
497200 -- (-2080.357) (-2075.504) (-2081.145) [-2070.416] * (-2077.615) (-2076.679) (-2094.111) [-2074.043] -- 0:02:22
497300 -- (-2079.174) (-2078.553) [-2073.321] (-2085.318) * (-2082.460) [-2074.641] (-2091.611) (-2080.605) -- 0:02:22
497400 -- (-2081.048) (-2076.743) (-2089.350) [-2076.854] * (-2078.545) (-2075.573) (-2083.620) [-2073.307] -- 0:02:22
497500 -- (-2086.402) (-2083.495) [-2082.078] (-2082.103) * [-2077.293] (-2076.806) (-2088.415) (-2081.416) -- 0:02:22
497600 -- (-2082.546) (-2086.243) (-2082.058) [-2077.282] * [-2074.652] (-2085.580) (-2075.304) (-2080.638) -- 0:02:22
497700 -- (-2081.663) (-2084.951) [-2079.841] (-2076.069) * (-2074.194) (-2089.859) (-2074.019) [-2078.560] -- 0:02:22
497800 -- (-2081.579) (-2083.477) [-2086.039] (-2081.399) * (-2074.283) (-2087.427) (-2076.289) [-2084.576] -- 0:02:22
497900 -- (-2086.966) (-2081.530) (-2090.571) [-2074.909] * [-2073.769] (-2076.971) (-2077.980) (-2080.562) -- 0:02:22
498000 -- (-2086.077) (-2075.714) (-2082.433) [-2069.742] * (-2073.752) (-2081.816) (-2080.462) [-2081.654] -- 0:02:22
Average standard deviation of split frequencies: 0.008571
498100 -- (-2083.505) (-2084.182) (-2079.245) [-2075.440] * [-2080.143] (-2088.663) (-2080.879) (-2080.510) -- 0:02:22
498200 -- (-2082.259) (-2077.513) [-2075.269] (-2076.620) * [-2079.270] (-2084.242) (-2079.270) (-2081.408) -- 0:02:22
498300 -- (-2094.954) (-2077.434) (-2075.665) [-2071.897] * [-2080.758] (-2082.005) (-2083.507) (-2082.795) -- 0:02:21
498400 -- (-2085.507) (-2083.188) [-2083.056] (-2083.725) * (-2080.669) (-2095.364) [-2081.538] (-2077.079) -- 0:02:21
498500 -- (-2076.982) [-2075.127] (-2083.768) (-2074.613) * (-2083.399) (-2080.498) (-2077.077) [-2076.787] -- 0:02:21
498600 -- (-2079.738) [-2072.182] (-2078.740) (-2071.400) * [-2074.510] (-2078.845) (-2078.196) (-2086.953) -- 0:02:21
498700 -- (-2073.226) (-2077.887) (-2080.099) [-2073.376] * (-2079.433) [-2075.362] (-2076.850) (-2078.028) -- 0:02:21
498800 -- (-2076.202) [-2079.417] (-2080.135) (-2071.164) * (-2080.709) [-2072.862] (-2076.971) (-2083.569) -- 0:02:21
498900 -- [-2079.141] (-2076.798) (-2077.281) (-2075.562) * (-2076.858) [-2077.471] (-2086.691) (-2077.033) -- 0:02:21
499000 -- [-2073.431] (-2081.915) (-2078.015) (-2081.503) * (-2073.608) (-2090.141) (-2095.431) [-2080.378] -- 0:02:21
Average standard deviation of split frequencies: 0.008553
499100 -- (-2071.053) (-2075.685) (-2081.709) [-2076.706] * [-2077.753] (-2082.440) (-2087.697) (-2078.947) -- 0:02:21
499200 -- [-2070.861] (-2083.646) (-2082.956) (-2076.638) * (-2077.672) [-2075.506] (-2084.122) (-2081.730) -- 0:02:21
499300 -- (-2070.912) (-2075.292) [-2085.985] (-2079.789) * (-2083.025) (-2077.643) (-2096.558) [-2078.285] -- 0:02:21
499400 -- (-2070.640) [-2074.750] (-2084.873) (-2076.554) * (-2084.100) [-2075.647] (-2090.708) (-2085.512) -- 0:02:21
499500 -- [-2076.454] (-2077.739) (-2080.856) (-2084.335) * (-2078.708) [-2074.825] (-2091.559) (-2090.262) -- 0:02:21
499600 -- (-2079.661) [-2077.573] (-2083.767) (-2091.717) * (-2078.593) [-2074.785] (-2083.056) (-2091.295) -- 0:02:22
499700 -- [-2077.644] (-2077.823) (-2077.363) (-2092.445) * (-2082.378) (-2077.186) [-2074.391] (-2087.085) -- 0:02:22
499800 -- [-2074.745] (-2073.820) (-2080.711) (-2087.451) * (-2079.495) [-2078.469] (-2079.021) (-2088.287) -- 0:02:22
499900 -- (-2081.655) [-2074.253] (-2076.574) (-2098.667) * (-2086.853) (-2077.064) (-2080.572) [-2081.725] -- 0:02:22
500000 -- (-2081.305) (-2080.993) [-2078.133] (-2084.776) * (-2094.139) (-2076.615) (-2080.100) [-2076.107] -- 0:02:22
Average standard deviation of split frequencies: 0.008402
500100 -- (-2079.843) [-2074.372] (-2086.669) (-2076.890) * (-2094.319) [-2077.264] (-2085.995) (-2075.141) -- 0:02:21
500200 -- (-2081.252) [-2076.636] (-2088.729) (-2078.476) * (-2091.659) (-2076.351) (-2084.021) [-2074.593] -- 0:02:21
500300 -- (-2081.231) (-2075.261) [-2076.366] (-2085.833) * (-2091.988) (-2077.529) (-2081.170) [-2075.158] -- 0:02:21
500400 -- (-2078.373) [-2070.444] (-2082.942) (-2084.897) * (-2095.382) (-2081.108) [-2074.555] (-2078.284) -- 0:02:21
500500 -- [-2078.618] (-2072.540) (-2085.091) (-2080.268) * (-2099.589) [-2074.989] (-2083.259) (-2079.115) -- 0:02:21
500600 -- (-2087.241) (-2080.871) [-2081.078] (-2083.827) * (-2090.875) [-2075.335] (-2077.257) (-2081.647) -- 0:02:21
500700 -- (-2079.284) [-2075.552] (-2079.710) (-2088.435) * (-2090.985) (-2085.732) [-2070.479] (-2083.954) -- 0:02:21
500800 -- (-2087.583) [-2068.742] (-2084.118) (-2084.147) * (-2092.664) (-2081.184) [-2074.050] (-2080.105) -- 0:02:21
500900 -- (-2078.272) [-2076.035] (-2085.712) (-2089.849) * (-2090.575) (-2079.602) [-2079.581] (-2082.230) -- 0:02:21
501000 -- (-2079.350) [-2077.296] (-2086.987) (-2085.184) * (-2097.701) (-2084.938) (-2087.257) [-2076.985] -- 0:02:21
Average standard deviation of split frequencies: 0.008384
501100 -- (-2080.786) [-2075.454] (-2078.622) (-2085.263) * (-2091.425) [-2081.086] (-2083.422) (-2080.018) -- 0:02:21
501200 -- [-2079.294] (-2074.018) (-2091.293) (-2080.171) * (-2084.772) (-2075.188) [-2075.095] (-2079.744) -- 0:02:21
501300 -- (-2079.904) (-2074.908) [-2087.888] (-2077.897) * (-2087.960) [-2074.796] (-2078.161) (-2088.698) -- 0:02:21
501400 -- [-2070.523] (-2077.420) (-2080.502) (-2083.388) * (-2083.917) (-2085.792) [-2087.576] (-2085.374) -- 0:02:21
501500 -- (-2072.913) (-2071.788) (-2082.816) [-2072.610] * (-2086.558) (-2078.568) [-2082.010] (-2085.101) -- 0:02:21
501600 -- [-2071.613] (-2077.460) (-2081.845) (-2075.721) * (-2085.462) (-2082.581) [-2078.197] (-2081.685) -- 0:02:21
501700 -- [-2068.638] (-2076.616) (-2090.077) (-2077.672) * (-2083.915) (-2082.224) [-2079.261] (-2083.510) -- 0:02:21
501800 -- [-2069.348] (-2077.938) (-2093.926) (-2077.268) * (-2085.924) (-2081.108) [-2078.749] (-2090.561) -- 0:02:20
501900 -- [-2071.347] (-2083.707) (-2081.962) (-2071.186) * (-2084.832) (-2073.324) [-2074.869] (-2088.792) -- 0:02:20
502000 -- (-2075.180) [-2069.327] (-2087.236) (-2076.515) * (-2081.451) [-2073.615] (-2076.338) (-2088.694) -- 0:02:20
Average standard deviation of split frequencies: 0.008422
502100 -- (-2072.612) [-2071.397] (-2081.824) (-2078.003) * [-2078.371] (-2083.293) (-2072.256) (-2085.842) -- 0:02:20
502200 -- [-2071.187] (-2073.512) (-2080.437) (-2071.533) * (-2080.091) (-2082.860) [-2077.135] (-2083.839) -- 0:02:20
502300 -- (-2076.934) [-2073.353] (-2085.053) (-2074.776) * (-2082.057) [-2084.699] (-2077.825) (-2084.027) -- 0:02:20
502400 -- (-2071.803) (-2087.828) (-2074.267) [-2070.009] * (-2084.319) (-2079.480) [-2078.019] (-2088.075) -- 0:02:20
502500 -- (-2072.231) [-2078.227] (-2079.066) (-2075.251) * (-2085.159) [-2076.027] (-2076.045) (-2083.028) -- 0:02:20
502600 -- [-2072.668] (-2070.801) (-2079.504) (-2072.297) * [-2079.312] (-2077.402) (-2082.688) (-2086.567) -- 0:02:20
502700 -- [-2070.238] (-2070.407) (-2084.221) (-2078.276) * (-2076.892) (-2079.858) (-2080.477) [-2078.731] -- 0:02:20
502800 -- [-2072.693] (-2074.304) (-2079.791) (-2087.872) * (-2078.203) [-2078.014] (-2080.183) (-2079.919) -- 0:02:20
502900 -- [-2073.386] (-2090.071) (-2072.972) (-2086.897) * (-2073.763) (-2082.073) (-2083.754) [-2076.332] -- 0:02:20
503000 -- (-2077.051) (-2081.375) (-2079.523) [-2080.030] * (-2077.558) (-2078.277) (-2084.664) [-2077.815] -- 0:02:21
Average standard deviation of split frequencies: 0.008806
503100 -- [-2071.882] (-2083.828) (-2099.403) (-2076.572) * [-2072.208] (-2079.363) (-2094.317) (-2081.714) -- 0:02:21
503200 -- [-2071.426] (-2075.039) (-2090.606) (-2080.122) * [-2073.219] (-2078.717) (-2087.356) (-2081.186) -- 0:02:21
503300 -- [-2071.947] (-2085.812) (-2082.407) (-2076.583) * [-2076.373] (-2079.882) (-2093.129) (-2082.146) -- 0:02:21
503400 -- (-2072.329) [-2080.349] (-2083.192) (-2083.524) * [-2073.323] (-2083.607) (-2092.772) (-2076.400) -- 0:02:21
503500 -- (-2068.920) [-2075.984] (-2075.556) (-2077.385) * (-2076.726) (-2081.735) (-2095.501) [-2078.718] -- 0:02:21
503600 -- [-2070.829] (-2072.285) (-2075.384) (-2079.439) * (-2083.980) (-2086.314) (-2096.805) [-2079.161] -- 0:02:20
503700 -- [-2071.009] (-2077.040) (-2079.642) (-2078.693) * [-2077.341] (-2084.949) (-2082.090) (-2075.494) -- 0:02:20
503800 -- [-2068.241] (-2073.156) (-2088.960) (-2075.068) * (-2083.069) (-2085.571) (-2085.587) [-2080.023] -- 0:02:20
503900 -- [-2076.654] (-2075.194) (-2081.583) (-2077.578) * (-2077.320) (-2086.193) [-2079.006] (-2080.914) -- 0:02:20
504000 -- (-2072.541) (-2082.607) (-2075.705) [-2074.267] * (-2074.575) (-2085.044) (-2075.114) [-2078.092] -- 0:02:20
Average standard deviation of split frequencies: 0.008897
504100 -- (-2072.001) [-2075.142] (-2081.604) (-2072.026) * (-2075.984) (-2094.530) (-2080.625) [-2071.455] -- 0:02:20
504200 -- (-2071.287) (-2073.758) (-2082.333) [-2068.956] * [-2079.627] (-2092.100) (-2080.062) (-2080.886) -- 0:02:20
504300 -- (-2073.251) [-2077.021] (-2084.058) (-2079.717) * (-2079.560) (-2090.291) (-2086.877) [-2075.941] -- 0:02:20
504400 -- (-2073.211) (-2076.757) (-2083.529) [-2077.200] * [-2080.104] (-2084.007) (-2097.449) (-2073.424) -- 0:02:20
504500 -- [-2073.327] (-2081.799) (-2080.064) (-2074.859) * (-2081.727) (-2088.237) (-2097.020) [-2074.528] -- 0:02:20
504600 -- (-2072.802) (-2080.627) (-2085.847) [-2072.649] * (-2086.683) [-2077.938] (-2081.916) (-2077.435) -- 0:02:20
504700 -- (-2075.966) (-2075.098) (-2080.084) [-2073.371] * (-2081.101) (-2083.254) (-2082.014) [-2080.145] -- 0:02:20
504800 -- (-2075.984) [-2077.928] (-2076.695) (-2076.326) * (-2087.927) (-2091.719) (-2086.396) [-2075.676] -- 0:02:20
504900 -- (-2074.507) [-2076.571] (-2078.563) (-2074.960) * (-2085.532) [-2085.963] (-2090.943) (-2080.900) -- 0:02:20
505000 -- [-2072.913] (-2079.811) (-2086.437) (-2073.956) * (-2087.104) (-2076.999) (-2098.339) [-2075.859] -- 0:02:20
Average standard deviation of split frequencies: 0.008851
505100 -- [-2073.293] (-2073.924) (-2077.929) (-2065.714) * (-2076.070) [-2075.670] (-2087.612) (-2074.683) -- 0:02:20
505200 -- (-2073.402) [-2079.474] (-2080.848) (-2070.131) * [-2074.686] (-2081.706) (-2088.612) (-2073.299) -- 0:02:20
505300 -- [-2074.121] (-2085.926) (-2077.747) (-2082.022) * [-2068.188] (-2074.993) (-2086.633) (-2077.184) -- 0:02:20
505400 -- (-2072.646) (-2076.619) (-2079.600) [-2073.730] * [-2074.188] (-2073.665) (-2088.430) (-2079.078) -- 0:02:19
505500 -- (-2075.544) (-2085.452) (-2082.704) [-2070.382] * [-2071.986] (-2078.241) (-2076.342) (-2073.863) -- 0:02:19
505600 -- (-2074.844) (-2079.204) (-2082.767) [-2068.205] * [-2069.946] (-2080.379) (-2080.003) (-2086.762) -- 0:02:19
505700 -- (-2073.901) (-2086.625) [-2076.441] (-2070.270) * (-2072.381) [-2075.022] (-2078.237) (-2077.374) -- 0:02:19
505800 -- (-2078.937) (-2090.287) [-2075.341] (-2073.461) * [-2071.808] (-2074.554) (-2080.574) (-2082.808) -- 0:02:19
505900 -- (-2070.803) (-2083.907) (-2073.194) [-2069.454] * (-2074.404) (-2076.590) [-2076.581] (-2080.173) -- 0:02:19
506000 -- (-2078.661) (-2081.283) (-2082.112) [-2069.210] * [-2076.061] (-2097.494) (-2079.505) (-2077.028) -- 0:02:19
Average standard deviation of split frequencies: 0.008808
506100 -- (-2077.447) (-2080.367) (-2074.533) [-2068.956] * (-2079.142) (-2089.744) [-2077.441] (-2082.414) -- 0:02:19
506200 -- (-2076.351) (-2082.251) (-2084.700) [-2070.740] * [-2083.992] (-2086.839) (-2078.028) (-2091.038) -- 0:02:19
506300 -- [-2072.736] (-2079.911) (-2083.101) (-2082.311) * (-2079.698) [-2075.669] (-2078.397) (-2087.918) -- 0:02:19
506400 -- [-2072.086] (-2091.917) (-2084.063) (-2074.128) * (-2080.757) (-2080.204) [-2073.174] (-2080.525) -- 0:02:19
506500 -- (-2070.549) (-2079.107) (-2090.947) [-2077.398] * (-2076.599) (-2083.226) [-2073.480] (-2077.612) -- 0:02:20
506600 -- [-2070.768] (-2083.006) (-2078.659) (-2074.118) * (-2077.610) (-2082.145) [-2075.700] (-2083.220) -- 0:02:20
506700 -- [-2069.375] (-2079.019) (-2075.155) (-2074.482) * [-2077.561] (-2084.158) (-2078.819) (-2082.929) -- 0:02:20
506800 -- [-2070.904] (-2084.404) (-2076.287) (-2078.458) * (-2080.678) (-2081.012) [-2076.910] (-2082.779) -- 0:02:20
506900 -- (-2070.341) [-2074.309] (-2084.489) (-2079.487) * [-2078.099] (-2076.371) (-2077.467) (-2083.910) -- 0:02:20
507000 -- [-2072.532] (-2076.228) (-2089.377) (-2079.563) * (-2074.251) (-2088.271) [-2073.366] (-2090.620) -- 0:02:20
Average standard deviation of split frequencies: 0.008869
507100 -- [-2073.745] (-2080.810) (-2081.366) (-2081.924) * (-2079.770) (-2099.218) [-2077.988] (-2086.153) -- 0:02:19
507200 -- (-2079.100) (-2087.613) (-2087.344) [-2069.868] * (-2083.940) (-2085.356) [-2074.963] (-2089.841) -- 0:02:19
507300 -- (-2084.762) (-2083.471) (-2090.325) [-2070.531] * [-2081.946] (-2079.309) (-2073.150) (-2088.965) -- 0:02:19
507400 -- (-2074.614) (-2079.768) [-2072.929] (-2078.610) * (-2080.489) (-2082.881) [-2076.235] (-2086.271) -- 0:02:19
507500 -- (-2077.974) (-2077.519) [-2072.330] (-2078.412) * (-2088.104) (-2084.212) [-2076.733] (-2081.177) -- 0:02:19
507600 -- (-2073.322) [-2074.129] (-2081.464) (-2083.247) * [-2078.650] (-2095.048) (-2075.092) (-2079.943) -- 0:02:19
507700 -- (-2077.253) [-2078.596] (-2082.381) (-2077.090) * (-2085.017) (-2093.877) [-2069.769] (-2083.273) -- 0:02:19
507800 -- (-2074.687) (-2080.170) (-2085.191) [-2071.119] * (-2080.660) (-2083.709) [-2070.339] (-2091.921) -- 0:02:19
507900 -- (-2075.853) (-2079.941) (-2080.846) [-2068.512] * (-2081.160) [-2081.117] (-2074.310) (-2087.625) -- 0:02:19
508000 -- [-2075.609] (-2079.032) (-2078.390) (-2071.303) * (-2084.565) [-2076.565] (-2080.468) (-2093.537) -- 0:02:19
Average standard deviation of split frequencies: 0.008509
508100 -- (-2073.161) (-2072.614) (-2081.348) [-2075.770] * (-2081.441) [-2078.372] (-2075.097) (-2092.409) -- 0:02:19
508200 -- (-2072.702) (-2078.701) (-2079.468) [-2073.453] * (-2083.272) (-2075.500) [-2071.506] (-2084.799) -- 0:02:19
508300 -- (-2073.853) (-2074.040) [-2080.660] (-2071.785) * (-2086.281) [-2076.298] (-2073.766) (-2084.404) -- 0:02:19
508400 -- (-2073.876) [-2077.303] (-2081.313) (-2070.926) * (-2086.205) [-2072.970] (-2091.522) (-2103.084) -- 0:02:19
508500 -- [-2074.303] (-2075.751) (-2077.530) (-2075.171) * (-2084.072) [-2075.826] (-2074.331) (-2096.810) -- 0:02:19
508600 -- (-2073.269) (-2081.810) (-2082.441) [-2078.040] * (-2080.694) (-2080.821) [-2073.883] (-2089.154) -- 0:02:19
508700 -- (-2076.145) (-2078.231) [-2073.453] (-2075.669) * (-2084.565) (-2083.234) [-2070.750] (-2095.167) -- 0:02:19
508800 -- (-2079.786) (-2075.907) [-2074.298] (-2081.035) * (-2085.720) (-2079.306) [-2073.506] (-2106.813) -- 0:02:19
508900 -- (-2072.049) [-2076.903] (-2084.096) (-2085.894) * (-2080.257) (-2080.283) [-2073.018] (-2092.898) -- 0:02:18
509000 -- (-2076.787) [-2070.405] (-2085.739) (-2084.893) * [-2080.484] (-2079.196) (-2075.905) (-2099.340) -- 0:02:18
Average standard deviation of split frequencies: 0.008491
509100 -- (-2074.672) [-2072.526] (-2073.601) (-2082.208) * (-2086.942) (-2077.361) [-2074.420] (-2083.155) -- 0:02:18
509200 -- (-2073.950) [-2076.528] (-2078.840) (-2080.608) * (-2075.326) [-2077.917] (-2077.963) (-2084.946) -- 0:02:18
509300 -- (-2067.857) [-2073.774] (-2077.188) (-2079.361) * (-2083.159) (-2082.270) [-2076.905] (-2089.447) -- 0:02:18
509400 -- (-2076.068) (-2075.174) (-2078.078) [-2081.757] * [-2078.808] (-2081.150) (-2086.929) (-2085.892) -- 0:02:18
509500 -- [-2075.732] (-2078.976) (-2080.044) (-2075.923) * [-2076.243] (-2086.204) (-2085.853) (-2081.591) -- 0:02:18
509600 -- [-2072.259] (-2078.478) (-2078.802) (-2075.033) * [-2077.753] (-2080.283) (-2086.436) (-2084.099) -- 0:02:18
509700 -- [-2074.608] (-2072.463) (-2083.238) (-2078.600) * (-2075.048) [-2074.424] (-2092.068) (-2084.242) -- 0:02:18
509800 -- [-2072.330] (-2074.342) (-2076.158) (-2079.524) * [-2073.416] (-2081.461) (-2093.581) (-2087.961) -- 0:02:18
509900 -- (-2085.614) [-2069.552] (-2082.872) (-2079.147) * [-2081.310] (-2077.274) (-2092.018) (-2085.350) -- 0:02:18
510000 -- (-2075.036) [-2067.481] (-2085.773) (-2082.362) * (-2082.837) [-2080.055] (-2083.726) (-2086.545) -- 0:02:19
Average standard deviation of split frequencies: 0.008264
510100 -- (-2068.617) [-2070.195] (-2082.956) (-2084.438) * (-2087.323) [-2082.170] (-2090.572) (-2082.238) -- 0:02:19
510200 -- [-2070.839] (-2074.778) (-2078.697) (-2079.897) * (-2079.780) (-2084.868) (-2086.624) [-2079.585] -- 0:02:19
510300 -- [-2073.400] (-2076.503) (-2080.846) (-2083.268) * (-2079.140) (-2083.458) [-2076.241] (-2085.672) -- 0:02:19
510400 -- [-2071.788] (-2077.340) (-2083.292) (-2080.050) * (-2083.322) (-2079.284) (-2074.529) [-2076.057] -- 0:02:19
510500 -- [-2071.909] (-2077.069) (-2085.488) (-2081.426) * (-2084.090) (-2080.429) (-2074.858) [-2074.329] -- 0:02:19
510600 -- [-2069.582] (-2072.984) (-2083.172) (-2082.165) * (-2102.681) [-2079.315] (-2073.525) (-2073.404) -- 0:02:18
510700 -- (-2072.641) (-2074.353) (-2087.918) [-2076.498] * (-2079.215) (-2076.641) (-2085.065) [-2073.386] -- 0:02:18
510800 -- [-2069.348] (-2070.036) (-2091.346) (-2079.709) * (-2076.826) [-2071.884] (-2075.193) (-2076.610) -- 0:02:18
510900 -- (-2069.544) (-2070.791) (-2074.634) [-2076.170] * (-2084.513) (-2075.064) (-2075.106) [-2076.742] -- 0:02:18
511000 -- (-2074.105) (-2070.350) (-2079.913) [-2077.539] * (-2079.189) [-2079.727] (-2074.723) (-2083.147) -- 0:02:18
Average standard deviation of split frequencies: 0.008247
511100 -- (-2079.118) (-2078.424) [-2077.538] (-2080.123) * (-2088.704) (-2072.892) [-2077.759] (-2076.290) -- 0:02:18
511200 -- (-2069.092) [-2081.422] (-2076.290) (-2080.722) * (-2082.935) [-2069.825] (-2069.959) (-2078.546) -- 0:02:18
511300 -- [-2072.716] (-2086.081) (-2081.731) (-2082.922) * [-2077.270] (-2082.305) (-2084.216) (-2074.657) -- 0:02:18
511400 -- (-2070.266) [-2072.467] (-2077.881) (-2083.951) * [-2078.488] (-2077.545) (-2077.793) (-2087.746) -- 0:02:18
511500 -- (-2071.047) (-2080.946) [-2073.693] (-2078.033) * (-2078.527) (-2084.302) [-2070.973] (-2086.149) -- 0:02:18
511600 -- (-2082.518) [-2075.826] (-2075.646) (-2080.933) * (-2079.006) (-2081.602) [-2069.332] (-2089.367) -- 0:02:18
511700 -- (-2074.347) [-2073.491] (-2079.494) (-2079.263) * (-2084.912) (-2079.456) [-2074.106] (-2088.150) -- 0:02:18
511800 -- (-2073.563) [-2069.640] (-2098.021) (-2077.976) * (-2079.355) [-2081.111] (-2077.313) (-2086.801) -- 0:02:18
511900 -- (-2076.666) [-2070.529] (-2078.413) (-2080.240) * [-2078.232] (-2083.979) (-2075.232) (-2084.346) -- 0:02:18
512000 -- (-2081.881) [-2067.438] (-2093.518) (-2079.733) * (-2077.418) (-2082.873) [-2073.933] (-2083.180) -- 0:02:18
Average standard deviation of split frequencies: 0.008442
512100 -- (-2085.570) [-2070.131] (-2071.712) (-2091.913) * (-2078.812) (-2078.877) [-2069.924] (-2079.551) -- 0:02:18
512200 -- (-2077.903) [-2075.137] (-2078.907) (-2093.522) * (-2085.730) [-2080.326] (-2074.894) (-2080.960) -- 0:02:18
512300 -- (-2077.209) (-2080.477) (-2075.547) [-2083.316] * (-2088.960) (-2079.310) (-2073.637) [-2084.494] -- 0:02:18
512400 -- (-2075.655) (-2081.332) [-2073.007] (-2079.495) * (-2087.421) (-2082.564) [-2067.538] (-2081.659) -- 0:02:17
512500 -- (-2075.232) (-2087.776) [-2076.994] (-2087.131) * (-2076.125) (-2077.686) [-2076.824] (-2084.689) -- 0:02:17
512600 -- (-2076.168) (-2079.612) [-2076.597] (-2086.822) * [-2085.468] (-2075.690) (-2075.166) (-2085.552) -- 0:02:17
512700 -- (-2080.150) (-2079.172) (-2076.863) [-2081.267] * (-2090.199) (-2076.605) [-2073.546] (-2083.211) -- 0:02:17
512800 -- [-2072.791] (-2076.605) (-2074.121) (-2077.151) * (-2086.717) (-2083.079) [-2074.669] (-2082.411) -- 0:02:17
512900 -- [-2073.393] (-2080.795) (-2077.918) (-2080.523) * (-2078.363) (-2086.782) (-2076.770) [-2076.650] -- 0:02:17
513000 -- [-2079.005] (-2086.082) (-2087.884) (-2074.807) * (-2083.086) (-2088.353) [-2076.038] (-2080.238) -- 0:02:17
Average standard deviation of split frequencies: 0.008320
513100 -- [-2079.172] (-2080.806) (-2071.510) (-2080.027) * (-2083.929) (-2078.152) [-2068.388] (-2090.005) -- 0:02:17
513200 -- (-2081.458) (-2087.073) (-2076.717) [-2082.124] * (-2086.978) (-2076.143) [-2070.502] (-2076.035) -- 0:02:17
513300 -- [-2071.486] (-2087.555) (-2077.440) (-2078.420) * (-2079.125) [-2072.581] (-2079.256) (-2076.522) -- 0:02:17
513400 -- (-2083.951) (-2083.067) [-2073.682] (-2075.639) * (-2084.889) (-2090.808) [-2075.261] (-2083.162) -- 0:02:17
513500 -- (-2081.889) [-2074.194] (-2071.667) (-2079.780) * (-2082.121) (-2088.535) [-2072.663] (-2084.683) -- 0:02:18
513600 -- (-2078.071) (-2077.272) (-2074.229) [-2076.476] * (-2078.713) (-2078.243) [-2074.151] (-2085.250) -- 0:02:18
513700 -- (-2079.024) (-2073.730) [-2073.263] (-2082.622) * (-2087.248) (-2081.677) [-2070.376] (-2082.169) -- 0:02:18
513800 -- (-2084.131) (-2072.890) [-2071.448] (-2082.378) * (-2082.901) (-2079.939) [-2068.710] (-2077.044) -- 0:02:18
513900 -- (-2076.909) (-2079.736) (-2078.288) [-2071.834] * (-2078.301) (-2082.404) [-2074.882] (-2084.231) -- 0:02:18
514000 -- (-2077.072) (-2088.237) (-2080.525) [-2076.091] * (-2082.225) (-2082.527) [-2073.605] (-2096.523) -- 0:02:18
Average standard deviation of split frequencies: 0.008226
514100 -- (-2084.337) [-2077.978] (-2075.443) (-2079.958) * (-2086.230) (-2085.189) [-2075.189] (-2094.194) -- 0:02:17
514200 -- [-2074.060] (-2079.022) (-2071.567) (-2081.731) * (-2084.395) (-2085.997) (-2074.455) [-2080.675] -- 0:02:17
514300 -- (-2076.108) (-2079.443) [-2070.162] (-2083.785) * (-2082.780) [-2076.797] (-2073.001) (-2076.325) -- 0:02:17
514400 -- (-2076.358) (-2081.329) [-2067.421] (-2080.112) * (-2079.642) [-2079.219] (-2077.845) (-2080.057) -- 0:02:17
514500 -- (-2077.618) (-2087.006) (-2073.293) [-2077.703] * (-2086.827) (-2080.369) [-2066.570] (-2080.768) -- 0:02:17
514600 -- [-2071.427] (-2092.838) (-2074.041) (-2076.699) * (-2087.772) (-2085.213) (-2072.872) [-2076.824] -- 0:02:17
514700 -- (-2071.149) (-2087.248) [-2079.080] (-2078.438) * (-2088.909) (-2081.323) (-2077.910) [-2075.952] -- 0:02:17
514800 -- (-2070.436) [-2070.965] (-2076.280) (-2076.861) * (-2083.465) (-2085.911) (-2074.238) [-2075.318] -- 0:02:17
514900 -- (-2071.634) [-2075.727] (-2080.602) (-2083.000) * (-2078.925) (-2079.809) (-2077.977) [-2081.731] -- 0:02:17
515000 -- (-2074.555) [-2068.610] (-2075.066) (-2077.164) * (-2078.577) (-2076.686) (-2077.907) [-2073.681] -- 0:02:17
Average standard deviation of split frequencies: 0.008078
515100 -- (-2078.852) [-2069.165] (-2074.056) (-2081.587) * (-2079.775) (-2076.536) (-2079.445) [-2077.999] -- 0:02:17
515200 -- (-2078.848) [-2069.237] (-2079.148) (-2080.681) * (-2075.896) (-2077.334) [-2073.184] (-2084.894) -- 0:02:17
515300 -- (-2075.725) (-2071.704) (-2080.105) [-2075.300] * (-2080.390) (-2075.890) [-2071.118] (-2079.798) -- 0:02:17
515400 -- [-2066.637] (-2074.364) (-2069.825) (-2078.544) * (-2079.373) (-2084.935) (-2078.580) [-2078.788] -- 0:02:17
515500 -- [-2069.662] (-2083.727) (-2085.617) (-2083.541) * [-2076.196] (-2080.796) (-2076.922) (-2082.858) -- 0:02:17
515600 -- [-2070.569] (-2073.723) (-2076.919) (-2081.844) * (-2081.938) (-2086.124) [-2073.606] (-2079.738) -- 0:02:17
515700 -- (-2073.660) (-2077.279) [-2074.756] (-2086.530) * [-2083.359] (-2078.303) (-2071.172) (-2076.806) -- 0:02:17
515800 -- (-2086.008) (-2075.757) [-2075.805] (-2078.761) * (-2093.112) (-2086.877) [-2072.413] (-2080.283) -- 0:02:17
515900 -- [-2072.398] (-2076.115) (-2073.078) (-2083.508) * (-2085.682) (-2082.132) [-2071.994] (-2088.635) -- 0:02:17
516000 -- [-2072.818] (-2078.445) (-2079.267) (-2079.875) * (-2085.908) [-2084.677] (-2076.826) (-2087.478) -- 0:02:16
Average standard deviation of split frequencies: 0.007829
516100 -- [-2070.927] (-2077.359) (-2074.954) (-2077.519) * (-2089.859) (-2095.230) [-2072.431] (-2078.919) -- 0:02:16
516200 -- [-2072.652] (-2068.389) (-2081.288) (-2083.461) * (-2089.005) (-2085.648) [-2076.912] (-2081.503) -- 0:02:16
516300 -- [-2075.339] (-2077.584) (-2074.040) (-2084.111) * (-2083.676) (-2084.427) [-2073.468] (-2078.650) -- 0:02:16
516400 -- [-2074.555] (-2078.473) (-2074.476) (-2084.607) * (-2087.484) (-2082.485) [-2068.748] (-2087.333) -- 0:02:16
516500 -- [-2079.166] (-2083.667) (-2081.056) (-2085.179) * (-2082.019) (-2081.978) [-2071.257] (-2077.390) -- 0:02:16
516600 -- [-2072.950] (-2082.266) (-2078.628) (-2094.162) * (-2083.081) (-2089.806) (-2076.783) [-2075.112] -- 0:02:16
516700 -- [-2074.130] (-2081.003) (-2074.361) (-2084.041) * (-2084.349) (-2084.121) (-2075.906) [-2075.575] -- 0:02:16
516800 -- [-2076.502] (-2074.758) (-2078.239) (-2083.109) * (-2089.703) (-2094.664) [-2077.243] (-2080.946) -- 0:02:16
516900 -- (-2078.517) (-2088.959) [-2074.781] (-2075.602) * (-2083.320) (-2086.000) [-2073.404] (-2080.299) -- 0:02:16
517000 -- (-2078.915) [-2071.833] (-2073.785) (-2078.275) * (-2080.997) [-2082.592] (-2077.720) (-2076.586) -- 0:02:17
Average standard deviation of split frequencies: 0.007786
517100 -- (-2088.260) (-2070.256) [-2074.421] (-2077.074) * (-2088.196) [-2080.565] (-2079.171) (-2078.968) -- 0:02:17
517200 -- (-2077.685) [-2071.912] (-2075.089) (-2080.262) * (-2094.534) (-2076.473) (-2081.314) [-2077.735] -- 0:02:17
517300 -- (-2085.135) [-2073.965] (-2073.221) (-2081.784) * (-2092.085) (-2078.939) (-2092.573) [-2078.571] -- 0:02:17
517400 -- (-2080.801) (-2075.815) [-2072.196] (-2084.074) * (-2092.825) [-2072.269] (-2087.601) (-2080.159) -- 0:02:17
517500 -- [-2075.938] (-2076.605) (-2072.531) (-2083.040) * (-2086.745) [-2072.065] (-2088.297) (-2076.098) -- 0:02:17
517600 -- (-2072.536) [-2079.306] (-2074.199) (-2078.556) * (-2085.073) [-2076.793] (-2099.865) (-2076.654) -- 0:02:17
517700 -- (-2079.633) (-2083.617) [-2070.505] (-2080.857) * (-2093.615) (-2074.748) [-2075.822] (-2082.905) -- 0:02:16
517800 -- [-2078.405] (-2076.894) (-2077.279) (-2083.900) * (-2087.319) (-2074.574) [-2075.742] (-2079.883) -- 0:02:16
517900 -- (-2081.780) [-2075.735] (-2077.232) (-2090.487) * (-2087.973) (-2074.444) [-2072.462] (-2083.847) -- 0:02:16
518000 -- (-2085.929) [-2070.703] (-2073.313) (-2081.981) * (-2093.211) [-2078.529] (-2079.217) (-2085.823) -- 0:02:16
Average standard deviation of split frequencies: 0.007694
518100 -- (-2076.436) [-2072.993] (-2077.354) (-2089.533) * (-2090.339) (-2079.151) [-2073.968] (-2082.414) -- 0:02:16
518200 -- (-2077.510) (-2071.737) [-2072.423] (-2082.816) * (-2085.123) (-2077.708) [-2068.454] (-2083.236) -- 0:02:16
518300 -- (-2079.030) [-2072.147] (-2077.531) (-2077.443) * (-2079.357) (-2080.289) [-2072.891] (-2079.420) -- 0:02:16
518400 -- (-2081.426) (-2070.993) (-2083.404) [-2074.465] * (-2076.171) (-2083.523) [-2078.569] (-2077.960) -- 0:02:16
518500 -- (-2077.712) [-2069.530] (-2089.934) (-2077.881) * (-2078.413) [-2081.942] (-2074.197) (-2077.708) -- 0:02:16
518600 -- [-2079.911] (-2068.619) (-2075.704) (-2084.253) * (-2078.924) [-2081.416] (-2076.215) (-2077.662) -- 0:02:16
518700 -- (-2083.925) (-2069.626) (-2079.533) [-2075.308] * (-2077.368) (-2087.024) [-2072.852] (-2076.493) -- 0:02:16
518800 -- (-2079.162) [-2073.963] (-2081.904) (-2084.833) * (-2073.657) (-2081.883) [-2072.679] (-2081.277) -- 0:02:16
518900 -- (-2076.660) [-2071.888] (-2083.478) (-2078.602) * (-2077.343) (-2085.527) [-2070.611] (-2085.980) -- 0:02:16
519000 -- (-2078.036) [-2073.687] (-2082.849) (-2088.805) * [-2075.887] (-2084.728) (-2081.518) (-2081.969) -- 0:02:16
Average standard deviation of split frequencies: 0.007575
519100 -- (-2080.330) [-2073.403] (-2086.477) (-2085.304) * (-2079.103) (-2082.959) [-2068.449] (-2083.679) -- 0:02:16
519200 -- (-2081.225) [-2072.268] (-2085.263) (-2089.518) * (-2075.516) (-2086.904) (-2071.139) [-2079.099] -- 0:02:16
519300 -- (-2071.828) [-2070.170] (-2077.964) (-2081.610) * (-2078.233) (-2090.787) [-2072.068] (-2074.892) -- 0:02:16
519400 -- [-2076.013] (-2074.894) (-2083.395) (-2089.673) * (-2086.030) (-2088.234) [-2067.219] (-2072.989) -- 0:02:16
519500 -- (-2082.857) [-2073.072] (-2075.405) (-2085.623) * (-2085.833) (-2085.137) [-2073.504] (-2076.241) -- 0:02:15
519600 -- (-2083.597) (-2081.132) [-2072.836] (-2081.250) * [-2079.442] (-2090.843) (-2076.974) (-2078.187) -- 0:02:15
519700 -- (-2074.202) (-2074.162) [-2068.252] (-2083.816) * (-2080.822) (-2085.464) [-2071.376] (-2082.450) -- 0:02:15
519800 -- (-2078.929) (-2074.899) [-2072.940] (-2085.082) * (-2082.885) (-2087.870) [-2075.827] (-2082.194) -- 0:02:15
519900 -- [-2072.734] (-2079.322) (-2080.600) (-2099.111) * (-2081.721) (-2082.100) [-2077.505] (-2081.674) -- 0:02:15
520000 -- (-2080.391) [-2077.764] (-2080.667) (-2085.437) * [-2080.040] (-2086.285) (-2076.757) (-2078.129) -- 0:02:15
Average standard deviation of split frequencies: 0.007380
520100 -- (-2075.497) [-2078.337] (-2080.516) (-2087.042) * (-2094.083) [-2085.351] (-2074.664) (-2079.272) -- 0:02:15
520200 -- (-2085.563) (-2077.265) [-2074.011] (-2092.802) * (-2091.852) (-2076.310) [-2074.069] (-2075.222) -- 0:02:15
520300 -- (-2093.237) (-2077.342) [-2077.138] (-2086.538) * (-2088.732) (-2076.052) (-2075.680) [-2079.202] -- 0:02:15
520400 -- (-2080.408) (-2079.458) [-2073.892] (-2089.607) * (-2078.189) [-2082.401] (-2075.206) (-2085.213) -- 0:02:15
520500 -- (-2079.345) (-2079.903) [-2080.203] (-2093.171) * (-2090.871) (-2086.488) [-2075.335] (-2076.366) -- 0:02:16
520600 -- (-2090.503) [-2074.635] (-2074.827) (-2094.395) * (-2094.487) (-2078.900) (-2073.946) [-2075.461] -- 0:02:16
520700 -- (-2088.328) (-2073.645) [-2080.977] (-2094.378) * (-2089.682) (-2082.771) (-2081.518) [-2075.594] -- 0:02:16
520800 -- (-2080.637) [-2068.467] (-2074.334) (-2085.468) * (-2081.330) [-2077.083] (-2077.427) (-2076.295) -- 0:02:16
520900 -- (-2083.966) [-2069.088] (-2075.251) (-2089.536) * (-2082.782) (-2082.217) (-2085.573) [-2075.316] -- 0:02:16
521000 -- (-2079.923) [-2071.706] (-2079.121) (-2084.865) * (-2087.006) (-2081.069) (-2081.884) [-2075.233] -- 0:02:16
Average standard deviation of split frequencies: 0.007753
521100 -- (-2082.365) [-2083.048] (-2078.006) (-2094.134) * (-2077.606) (-2078.802) (-2076.941) [-2071.943] -- 0:02:16
521200 -- (-2078.251) (-2081.554) [-2075.778] (-2094.158) * (-2083.001) (-2078.947) [-2073.264] (-2077.399) -- 0:02:15
521300 -- (-2082.964) (-2070.783) [-2070.441] (-2102.425) * (-2083.554) [-2076.780] (-2078.043) (-2078.823) -- 0:02:15
521400 -- (-2084.711) (-2071.418) [-2071.311] (-2095.782) * (-2076.720) [-2076.788] (-2081.240) (-2083.164) -- 0:02:15
521500 -- (-2100.035) [-2070.112] (-2070.070) (-2102.729) * (-2079.679) (-2079.929) [-2072.835] (-2081.148) -- 0:02:15
521600 -- (-2099.903) [-2072.349] (-2074.183) (-2108.593) * (-2079.879) [-2077.231] (-2074.960) (-2086.281) -- 0:02:15
521700 -- (-2098.452) [-2070.045] (-2070.805) (-2103.260) * [-2076.566] (-2081.632) (-2083.005) (-2080.241) -- 0:02:15
521800 -- (-2097.087) (-2075.401) [-2068.716] (-2098.495) * (-2077.952) (-2092.327) (-2088.734) [-2080.791] -- 0:02:15
521900 -- (-2092.211) (-2081.594) [-2069.232] (-2095.649) * [-2080.297] (-2080.530) (-2090.278) (-2080.548) -- 0:02:15
522000 -- (-2080.781) [-2075.576] (-2070.293) (-2088.264) * (-2090.791) [-2072.966] (-2076.233) (-2081.212) -- 0:02:15
Average standard deviation of split frequencies: 0.007842
522100 -- (-2073.310) [-2069.147] (-2072.645) (-2083.747) * [-2072.291] (-2078.798) (-2072.350) (-2082.404) -- 0:02:15
522200 -- (-2073.037) [-2067.989] (-2076.723) (-2096.818) * (-2074.974) (-2078.793) [-2075.762] (-2080.867) -- 0:02:15
522300 -- (-2073.389) (-2073.980) [-2073.182] (-2096.518) * [-2077.343] (-2077.316) (-2081.758) (-2084.891) -- 0:02:15
522400 -- [-2078.150] (-2077.584) (-2069.713) (-2095.456) * (-2091.929) (-2074.369) (-2073.209) [-2082.356] -- 0:02:15
522500 -- (-2074.827) (-2073.135) [-2077.115] (-2085.437) * (-2083.290) [-2075.522] (-2072.542) (-2088.665) -- 0:02:15
522600 -- (-2079.777) [-2068.169] (-2068.049) (-2090.607) * (-2091.105) (-2075.257) [-2075.628] (-2078.175) -- 0:02:15
522700 -- (-2079.799) [-2070.990] (-2081.244) (-2091.673) * (-2078.649) [-2074.561] (-2082.844) (-2078.039) -- 0:02:15
522800 -- (-2077.819) [-2071.288] (-2076.706) (-2086.383) * [-2073.890] (-2075.602) (-2075.020) (-2086.753) -- 0:02:15
522900 -- (-2086.466) [-2078.660] (-2075.993) (-2080.331) * (-2076.216) (-2075.356) [-2070.676] (-2079.975) -- 0:02:15
523000 -- (-2078.730) (-2075.256) [-2080.169] (-2094.062) * [-2078.289] (-2079.676) (-2070.750) (-2086.277) -- 0:02:14
Average standard deviation of split frequencies: 0.007646
523100 -- (-2082.510) (-2078.490) [-2068.830] (-2080.461) * [-2074.114] (-2080.275) (-2078.101) (-2083.302) -- 0:02:14
523200 -- (-2085.091) (-2080.741) [-2066.407] (-2083.898) * (-2077.572) [-2074.867] (-2082.953) (-2081.417) -- 0:02:14
523300 -- (-2086.050) (-2082.893) [-2075.881] (-2094.595) * [-2073.758] (-2079.949) (-2073.374) (-2080.197) -- 0:02:14
523400 -- (-2080.632) (-2082.554) (-2074.933) [-2083.878] * (-2073.532) [-2078.546] (-2081.980) (-2088.674) -- 0:02:14
523500 -- (-2077.716) (-2086.661) [-2078.364] (-2089.340) * [-2075.700] (-2082.776) (-2075.745) (-2085.812) -- 0:02:14
523600 -- (-2081.082) (-2078.658) [-2074.637] (-2084.029) * (-2081.673) (-2081.224) [-2075.057] (-2085.574) -- 0:02:14
523700 -- (-2087.767) (-2078.443) [-2072.614] (-2091.062) * (-2081.635) (-2082.655) [-2070.828] (-2086.267) -- 0:02:14
523800 -- (-2092.094) (-2070.761) [-2070.551] (-2090.181) * (-2082.103) (-2082.818) [-2070.335] (-2088.504) -- 0:02:14
523900 -- (-2081.230) (-2072.490) [-2070.567] (-2085.682) * (-2072.673) (-2088.826) [-2074.127] (-2091.732) -- 0:02:15
524000 -- (-2090.948) (-2079.651) [-2071.785] (-2087.203) * (-2075.079) [-2075.889] (-2073.804) (-2082.522) -- 0:02:15
Average standard deviation of split frequencies: 0.007683
524100 -- (-2088.990) (-2079.392) [-2075.579] (-2087.374) * (-2077.067) (-2083.348) (-2075.655) [-2077.644] -- 0:02:15
524200 -- (-2084.972) (-2074.579) [-2072.092] (-2084.064) * (-2086.641) (-2085.421) (-2077.429) [-2075.684] -- 0:02:15
524300 -- (-2085.483) (-2076.809) [-2077.825] (-2083.482) * (-2085.368) (-2084.634) [-2073.444] (-2075.938) -- 0:02:15
524400 -- (-2090.242) (-2072.053) [-2079.536] (-2083.766) * (-2086.070) [-2084.515] (-2074.444) (-2080.817) -- 0:02:15
524500 -- (-2085.263) (-2071.989) [-2073.302] (-2083.612) * (-2083.828) (-2080.505) [-2070.353] (-2079.696) -- 0:02:15
524600 -- (-2092.730) [-2077.049] (-2072.884) (-2083.420) * (-2087.066) (-2077.756) [-2072.996] (-2074.276) -- 0:02:15
524700 -- (-2090.261) (-2074.838) [-2069.859] (-2087.494) * (-2078.146) [-2072.870] (-2076.743) (-2075.772) -- 0:02:14
524800 -- (-2087.722) [-2071.338] (-2073.284) (-2083.027) * (-2081.502) (-2079.007) [-2071.482] (-2080.509) -- 0:02:14
524900 -- (-2080.968) [-2070.254] (-2073.019) (-2086.505) * (-2083.040) [-2075.094] (-2075.805) (-2084.872) -- 0:02:14
525000 -- (-2083.078) (-2072.491) [-2071.518] (-2086.732) * (-2089.534) [-2074.444] (-2072.762) (-2074.059) -- 0:02:14
Average standard deviation of split frequencies: 0.007411
525100 -- (-2078.835) [-2076.067] (-2072.234) (-2087.291) * (-2079.625) (-2075.557) [-2070.847] (-2083.436) -- 0:02:14
525200 -- (-2081.561) [-2078.222] (-2075.724) (-2095.208) * [-2076.836] (-2076.106) (-2070.832) (-2077.753) -- 0:02:14
525300 -- (-2079.424) [-2070.921] (-2082.687) (-2088.834) * (-2078.600) (-2078.816) (-2077.153) [-2074.234] -- 0:02:14
525400 -- (-2077.171) [-2074.339] (-2082.951) (-2088.838) * (-2083.282) [-2075.976] (-2077.014) (-2076.304) -- 0:02:14
525500 -- (-2081.244) [-2071.492] (-2075.641) (-2081.494) * (-2089.616) (-2080.617) (-2079.020) [-2077.923] -- 0:02:14
525600 -- (-2085.247) [-2070.996] (-2071.135) (-2084.483) * (-2084.768) (-2080.298) [-2072.540] (-2077.042) -- 0:02:14
525700 -- (-2082.321) [-2070.452] (-2071.771) (-2083.472) * (-2088.071) [-2074.631] (-2084.347) (-2083.570) -- 0:02:14
525800 -- (-2078.263) (-2072.977) [-2071.253] (-2083.377) * (-2082.107) [-2073.503] (-2079.660) (-2076.125) -- 0:02:14
525900 -- (-2082.487) (-2081.415) (-2074.196) [-2075.291] * (-2095.780) (-2076.184) [-2079.974] (-2073.101) -- 0:02:14
526000 -- (-2078.835) (-2086.627) [-2081.512] (-2076.529) * (-2085.457) (-2080.817) (-2079.385) [-2078.874] -- 0:02:14
Average standard deviation of split frequencies: 0.007603
526100 -- (-2075.590) [-2077.553] (-2080.457) (-2084.634) * (-2093.846) [-2073.904] (-2084.983) (-2073.123) -- 0:02:14
526200 -- (-2085.592) [-2073.522] (-2074.789) (-2083.741) * (-2087.064) (-2077.832) [-2079.573] (-2078.589) -- 0:02:14
526300 -- [-2078.527] (-2078.363) (-2074.082) (-2084.652) * (-2083.516) [-2071.135] (-2080.002) (-2074.154) -- 0:02:14
526400 -- (-2085.239) [-2073.417] (-2087.544) (-2083.049) * (-2085.145) (-2073.576) [-2079.673] (-2077.977) -- 0:02:14
526500 -- (-2078.715) (-2080.538) [-2076.811] (-2084.836) * (-2083.194) (-2080.433) [-2078.490] (-2077.618) -- 0:02:14
526600 -- [-2081.252] (-2082.337) (-2081.110) (-2090.486) * (-2083.246) [-2082.084] (-2080.428) (-2076.428) -- 0:02:13
526700 -- (-2081.281) (-2077.975) [-2075.549] (-2088.992) * (-2086.077) [-2076.435] (-2076.777) (-2075.446) -- 0:02:13
526800 -- (-2077.471) (-2072.708) [-2071.497] (-2083.948) * (-2083.372) (-2077.887) [-2075.297] (-2071.323) -- 0:02:13
526900 -- (-2076.577) [-2073.076] (-2079.048) (-2089.614) * (-2088.822) [-2073.695] (-2081.910) (-2075.025) -- 0:02:13
527000 -- (-2079.196) [-2070.702] (-2078.398) (-2085.847) * (-2089.914) (-2083.060) [-2079.122] (-2084.550) -- 0:02:13
Average standard deviation of split frequencies: 0.007664
527100 -- (-2085.213) [-2070.867] (-2078.466) (-2088.405) * (-2083.950) (-2082.032) (-2088.024) [-2075.085] -- 0:02:13
527200 -- (-2086.064) [-2072.175] (-2074.980) (-2089.720) * (-2077.554) (-2075.705) (-2088.456) [-2076.854] -- 0:02:13
527300 -- (-2091.748) [-2072.191] (-2069.218) (-2093.056) * (-2077.622) [-2079.072] (-2083.875) (-2073.393) -- 0:02:13
527400 -- (-2084.816) (-2075.597) [-2074.027] (-2084.909) * (-2081.666) (-2079.760) (-2088.678) [-2079.360] -- 0:02:14
527500 -- (-2080.704) (-2075.707) [-2071.682] (-2087.745) * (-2079.868) [-2075.835] (-2082.374) (-2081.077) -- 0:02:14
527600 -- (-2080.040) (-2077.805) [-2069.420] (-2081.054) * (-2082.580) [-2069.741] (-2080.730) (-2078.732) -- 0:02:14
527700 -- (-2079.894) (-2077.742) [-2077.300] (-2081.941) * (-2084.174) (-2075.895) [-2079.439] (-2080.495) -- 0:02:14
527800 -- (-2080.579) [-2072.751] (-2071.100) (-2081.306) * (-2082.857) [-2079.951] (-2076.992) (-2081.242) -- 0:02:14
527900 -- (-2091.624) [-2071.600] (-2067.445) (-2087.293) * [-2081.719] (-2084.576) (-2079.214) (-2077.915) -- 0:02:14
528000 -- (-2085.944) [-2072.918] (-2069.397) (-2084.545) * (-2083.588) [-2070.649] (-2078.632) (-2085.281) -- 0:02:14
Average standard deviation of split frequencies: 0.007906
528100 -- (-2081.165) (-2076.127) [-2074.118] (-2086.427) * (-2083.641) [-2076.385] (-2081.229) (-2082.692) -- 0:02:14
528200 -- (-2079.662) (-2086.034) [-2076.893] (-2083.919) * (-2083.626) (-2082.495) (-2078.679) [-2079.505] -- 0:02:13
528300 -- [-2075.498] (-2075.947) (-2079.208) (-2077.383) * (-2080.868) [-2077.841] (-2076.407) (-2077.716) -- 0:02:13
528400 -- (-2078.592) [-2071.382] (-2081.582) (-2082.490) * (-2083.403) [-2073.284] (-2077.186) (-2079.648) -- 0:02:13
528500 -- (-2082.486) [-2074.737] (-2074.087) (-2091.494) * [-2078.092] (-2076.556) (-2079.444) (-2085.096) -- 0:02:13
528600 -- [-2077.026] (-2069.969) (-2075.922) (-2096.850) * (-2077.613) (-2078.229) (-2077.771) [-2077.207] -- 0:02:13
528700 -- (-2090.601) [-2072.246] (-2069.943) (-2084.160) * (-2090.076) [-2077.861] (-2080.833) (-2075.959) -- 0:02:13
528800 -- (-2081.507) [-2070.115] (-2080.302) (-2085.155) * (-2083.096) (-2080.758) (-2071.207) [-2078.955] -- 0:02:13
528900 -- (-2082.802) [-2071.288] (-2080.270) (-2083.849) * (-2087.702) (-2082.451) [-2067.014] (-2076.024) -- 0:02:13
529000 -- (-2088.066) [-2071.261] (-2075.124) (-2084.137) * (-2079.113) (-2078.720) [-2070.137] (-2076.016) -- 0:02:13
Average standard deviation of split frequencies: 0.008043
529100 -- (-2085.298) (-2079.261) [-2073.186] (-2084.767) * (-2074.573) (-2082.389) [-2073.327] (-2075.830) -- 0:02:13
529200 -- (-2092.514) (-2073.122) [-2073.972] (-2088.640) * (-2081.187) (-2087.909) [-2070.197] (-2077.320) -- 0:02:13
529300 -- (-2083.418) (-2074.786) (-2081.340) [-2081.558] * (-2085.089) (-2089.068) [-2068.296] (-2079.215) -- 0:02:13
529400 -- (-2086.667) [-2070.287] (-2082.533) (-2089.855) * (-2075.486) (-2089.801) [-2075.695] (-2084.497) -- 0:02:13
529500 -- (-2088.068) [-2071.642] (-2079.094) (-2087.469) * [-2077.224] (-2087.479) (-2076.655) (-2077.929) -- 0:02:13
529600 -- (-2083.763) [-2073.699] (-2086.663) (-2078.297) * (-2081.430) (-2091.232) [-2071.453] (-2079.646) -- 0:02:13
529700 -- (-2088.592) (-2076.876) (-2085.161) [-2082.843] * (-2083.810) (-2096.616) [-2076.120] (-2077.350) -- 0:02:13
529800 -- (-2082.701) [-2074.753] (-2087.263) (-2081.086) * (-2081.590) (-2087.269) [-2070.868] (-2078.223) -- 0:02:13
529900 -- (-2083.320) (-2073.694) [-2080.705] (-2083.063) * (-2079.691) (-2085.699) [-2074.123] (-2080.985) -- 0:02:13
530000 -- (-2083.724) [-2076.239] (-2083.120) (-2090.135) * [-2077.264] (-2086.519) (-2076.764) (-2084.309) -- 0:02:13
Average standard deviation of split frequencies: 0.007698
530100 -- [-2084.584] (-2077.168) (-2084.894) (-2087.486) * (-2078.836) (-2089.921) [-2073.253] (-2081.305) -- 0:02:12
530200 -- [-2078.232] (-2082.144) (-2086.831) (-2082.871) * [-2077.118] (-2084.039) (-2086.901) (-2082.711) -- 0:02:12
530300 -- (-2080.652) (-2073.765) [-2077.017] (-2082.511) * [-2077.463] (-2086.741) (-2081.982) (-2087.908) -- 0:02:12
530400 -- (-2082.538) (-2074.503) [-2078.424] (-2076.244) * [-2079.787] (-2078.858) (-2094.197) (-2081.410) -- 0:02:12
530500 -- (-2082.413) (-2079.879) [-2070.664] (-2087.221) * (-2085.870) (-2080.395) (-2086.946) [-2080.826] -- 0:02:12
530600 -- (-2078.347) (-2075.247) (-2078.228) [-2078.747] * [-2073.470] (-2081.420) (-2078.475) (-2074.550) -- 0:02:12
530700 -- (-2081.836) (-2073.185) [-2075.415] (-2076.187) * (-2088.600) [-2077.167] (-2077.953) (-2080.887) -- 0:02:12
530800 -- (-2078.610) (-2074.593) [-2071.471] (-2076.162) * (-2081.400) (-2085.608) (-2077.505) [-2072.211] -- 0:02:12
530900 -- [-2083.994] (-2077.251) (-2076.080) (-2082.893) * (-2095.334) (-2085.482) [-2075.199] (-2075.676) -- 0:02:13
531000 -- (-2083.418) [-2068.625] (-2078.439) (-2077.951) * (-2091.563) (-2085.737) [-2072.415] (-2082.814) -- 0:02:13
Average standard deviation of split frequencies: 0.007607
531100 -- (-2086.976) (-2077.673) [-2072.719] (-2077.128) * (-2099.861) (-2082.365) (-2077.414) [-2083.300] -- 0:02:13
531200 -- (-2087.531) [-2076.596] (-2081.702) (-2083.397) * (-2088.415) (-2084.793) [-2073.682] (-2078.626) -- 0:02:13
531300 -- (-2081.784) [-2072.863] (-2071.433) (-2091.224) * (-2079.626) (-2087.994) [-2074.122] (-2080.179) -- 0:02:13
531400 -- (-2083.819) [-2069.499] (-2081.723) (-2088.688) * (-2076.420) (-2078.079) [-2068.977] (-2086.629) -- 0:02:13
531500 -- (-2086.049) [-2070.596] (-2071.037) (-2090.432) * [-2081.906] (-2083.022) (-2069.628) (-2083.175) -- 0:02:13
531600 -- (-2086.500) [-2071.187] (-2083.247) (-2082.907) * (-2089.258) (-2079.401) (-2074.924) [-2080.602] -- 0:02:13
531700 -- (-2089.432) [-2071.374] (-2089.893) (-2077.696) * (-2084.868) (-2091.485) [-2076.528] (-2079.666) -- 0:02:12
531800 -- (-2085.354) [-2068.260] (-2087.565) (-2080.988) * (-2091.090) (-2083.530) [-2072.666] (-2091.843) -- 0:02:12
531900 -- (-2087.784) (-2075.147) [-2078.280] (-2086.773) * [-2075.812] (-2085.160) (-2072.023) (-2095.280) -- 0:02:12
532000 -- (-2079.565) [-2073.941] (-2099.041) (-2089.783) * [-2077.859] (-2088.777) (-2073.288) (-2086.357) -- 0:02:12
Average standard deviation of split frequencies: 0.007568
532100 -- (-2075.342) (-2074.013) (-2083.888) [-2076.514] * (-2077.769) (-2083.503) [-2069.641] (-2081.634) -- 0:02:12
532200 -- (-2075.965) (-2080.120) (-2082.668) [-2074.387] * (-2080.787) (-2081.122) [-2071.398] (-2076.915) -- 0:02:12
532300 -- (-2076.748) [-2073.310] (-2075.413) (-2082.076) * (-2084.670) (-2080.491) [-2069.993] (-2077.618) -- 0:02:12
532400 -- (-2077.165) [-2071.299] (-2080.782) (-2081.552) * (-2088.510) [-2072.319] (-2070.848) (-2080.141) -- 0:02:12
532500 -- (-2074.604) [-2067.137] (-2078.706) (-2081.716) * (-2099.583) [-2080.399] (-2079.600) (-2078.883) -- 0:02:12
532600 -- [-2076.791] (-2074.567) (-2073.457) (-2087.489) * (-2082.686) [-2078.860] (-2083.158) (-2074.639) -- 0:02:12
532700 -- (-2078.946) (-2078.249) [-2076.003] (-2090.802) * (-2087.485) (-2079.970) (-2082.954) [-2076.262] -- 0:02:12
532800 -- (-2076.325) (-2072.673) [-2075.820] (-2086.092) * (-2085.491) (-2079.528) [-2072.720] (-2080.266) -- 0:02:12
532900 -- (-2083.441) (-2075.342) [-2075.136] (-2090.433) * (-2083.559) [-2079.721] (-2075.971) (-2082.574) -- 0:02:12
533000 -- (-2081.674) [-2072.177] (-2075.241) (-2083.762) * (-2087.655) (-2079.656) [-2071.254] (-2082.316) -- 0:02:12
Average standard deviation of split frequencies: 0.007300
533100 -- (-2091.086) [-2072.475] (-2090.531) (-2080.784) * (-2092.677) (-2083.574) (-2078.661) [-2082.010] -- 0:02:12
533200 -- (-2077.740) [-2072.448] (-2076.568) (-2087.604) * (-2091.250) [-2078.486] (-2080.949) (-2076.339) -- 0:02:12
533300 -- (-2076.185) (-2076.257) [-2079.133] (-2085.567) * (-2078.555) (-2081.341) [-2074.607] (-2079.869) -- 0:02:12
533400 -- (-2080.532) (-2072.827) [-2072.098] (-2087.091) * (-2081.486) (-2078.132) [-2075.696] (-2078.077) -- 0:02:12
533500 -- (-2077.223) (-2073.462) [-2071.013] (-2085.337) * [-2079.725] (-2082.899) (-2078.720) (-2082.969) -- 0:02:12
533600 -- [-2075.838] (-2072.920) (-2078.789) (-2073.400) * (-2086.746) (-2088.920) [-2071.730] (-2078.216) -- 0:02:11
533700 -- (-2082.628) [-2071.698] (-2076.987) (-2075.615) * (-2084.362) (-2086.204) [-2073.023] (-2081.312) -- 0:02:11
533800 -- (-2084.889) (-2077.558) (-2073.018) [-2083.218] * (-2084.245) (-2086.326) [-2072.859] (-2079.236) -- 0:02:11
533900 -- (-2081.443) [-2076.087] (-2072.361) (-2081.845) * (-2083.555) (-2090.908) (-2071.816) [-2077.962] -- 0:02:11
534000 -- (-2079.948) (-2075.741) [-2075.841] (-2077.367) * (-2087.064) (-2086.456) (-2079.879) [-2076.469] -- 0:02:11
Average standard deviation of split frequencies: 0.007187
534100 -- (-2075.219) (-2078.230) (-2075.272) [-2079.959] * [-2075.746] (-2089.767) (-2079.671) (-2078.338) -- 0:02:11
534200 -- [-2072.208] (-2087.781) (-2080.511) (-2075.250) * [-2077.697] (-2088.186) (-2079.394) (-2078.238) -- 0:02:11
534300 -- [-2076.520] (-2087.674) (-2078.558) (-2092.188) * (-2076.714) (-2082.678) (-2087.811) [-2074.029] -- 0:02:12
534400 -- [-2077.791] (-2078.071) (-2091.055) (-2083.728) * (-2082.610) [-2079.840] (-2082.777) (-2071.581) -- 0:02:12
534500 -- (-2081.502) (-2079.139) [-2077.450] (-2078.533) * (-2082.697) (-2080.079) [-2083.903] (-2081.215) -- 0:02:12
534600 -- (-2083.877) (-2078.209) [-2077.560] (-2085.231) * (-2079.641) (-2082.094) (-2090.905) [-2076.821] -- 0:02:12
534700 -- (-2088.449) (-2081.879) [-2077.836] (-2080.490) * (-2075.626) [-2078.424] (-2079.955) (-2084.006) -- 0:02:12
534800 -- [-2076.074] (-2089.448) (-2072.359) (-2076.815) * (-2079.433) [-2074.089] (-2087.605) (-2078.537) -- 0:02:12
534900 -- (-2074.866) (-2077.268) [-2077.084] (-2076.566) * [-2079.639] (-2076.253) (-2083.043) (-2083.205) -- 0:02:12
535000 -- (-2077.959) [-2078.404] (-2080.097) (-2078.315) * [-2079.326] (-2077.573) (-2078.781) (-2096.991) -- 0:02:12
Average standard deviation of split frequencies: 0.007424
535100 -- (-2087.251) (-2075.439) (-2079.482) [-2074.205] * (-2080.779) (-2080.851) [-2074.345] (-2094.722) -- 0:02:12
535200 -- (-2080.395) [-2071.195] (-2079.160) (-2083.603) * [-2078.725] (-2075.437) (-2081.714) (-2084.969) -- 0:02:12
535300 -- (-2080.023) [-2074.947] (-2075.765) (-2089.074) * [-2073.989] (-2075.315) (-2080.435) (-2079.201) -- 0:02:11
535400 -- (-2080.663) (-2078.247) [-2070.710] (-2093.135) * [-2071.753] (-2078.912) (-2076.979) (-2076.761) -- 0:02:11
535500 -- (-2078.786) (-2072.221) [-2068.814] (-2082.013) * [-2074.364] (-2086.476) (-2083.495) (-2080.984) -- 0:02:11
535600 -- (-2082.131) (-2083.868) [-2075.446] (-2092.174) * [-2078.414] (-2093.490) (-2079.068) (-2083.336) -- 0:02:11
535700 -- (-2075.259) [-2073.083] (-2073.776) (-2085.765) * (-2076.395) (-2079.002) (-2080.677) [-2076.654] -- 0:02:11
535800 -- (-2084.361) [-2073.870] (-2073.601) (-2083.699) * [-2075.275] (-2081.486) (-2078.235) (-2078.783) -- 0:02:11
535900 -- (-2080.640) (-2072.254) [-2068.865] (-2087.103) * (-2078.716) [-2082.097] (-2079.141) (-2079.715) -- 0:02:11
536000 -- (-2078.290) [-2076.349] (-2076.091) (-2085.129) * (-2078.966) (-2083.758) [-2072.995] (-2089.039) -- 0:02:11
Average standard deviation of split frequencies: 0.007612
536100 -- (-2077.448) (-2086.483) [-2071.099] (-2090.461) * (-2087.351) (-2084.131) (-2073.810) [-2079.938] -- 0:02:11
536200 -- [-2073.950] (-2080.907) (-2074.659) (-2080.346) * (-2079.603) (-2080.109) [-2070.906] (-2076.812) -- 0:02:11
536300 -- [-2074.570] (-2075.268) (-2071.714) (-2080.991) * (-2077.654) [-2079.119] (-2076.620) (-2088.295) -- 0:02:11
536400 -- [-2076.792] (-2070.506) (-2075.783) (-2080.946) * (-2074.980) [-2078.842] (-2079.367) (-2080.357) -- 0:02:11
536500 -- (-2081.799) (-2073.681) [-2074.843] (-2081.175) * [-2076.928] (-2083.266) (-2086.725) (-2076.913) -- 0:02:11
536600 -- (-2077.224) (-2078.773) [-2071.048] (-2089.080) * (-2077.235) (-2080.933) (-2081.781) [-2081.467] -- 0:02:11
536700 -- [-2073.762] (-2078.350) (-2068.995) (-2080.748) * (-2081.702) (-2082.918) (-2080.562) [-2071.758] -- 0:02:11
536800 -- (-2085.416) (-2077.162) [-2069.560] (-2081.050) * (-2085.846) (-2082.486) [-2077.415] (-2082.099) -- 0:02:11
536900 -- (-2075.901) [-2071.744] (-2081.263) (-2082.127) * (-2077.856) (-2080.167) (-2077.653) [-2071.069] -- 0:02:11
537000 -- [-2073.647] (-2072.660) (-2078.238) (-2085.375) * [-2080.470] (-2083.172) (-2083.321) (-2075.302) -- 0:02:11
Average standard deviation of split frequencies: 0.007597
537100 -- [-2076.649] (-2071.545) (-2077.638) (-2088.069) * (-2080.530) (-2074.861) [-2077.049] (-2075.919) -- 0:02:11
537200 -- (-2076.131) [-2068.267] (-2082.143) (-2091.718) * [-2083.675] (-2079.864) (-2083.153) (-2073.170) -- 0:02:10
537300 -- (-2079.963) [-2067.345] (-2077.311) (-2085.156) * (-2076.193) [-2080.869] (-2079.422) (-2071.489) -- 0:02:10
537400 -- (-2080.349) [-2069.492] (-2077.303) (-2084.519) * (-2086.124) [-2077.737] (-2084.659) (-2082.581) -- 0:02:10
537500 -- (-2080.365) [-2071.401] (-2076.700) (-2088.266) * [-2079.971] (-2086.706) (-2077.560) (-2076.706) -- 0:02:10
537600 -- (-2082.978) [-2074.366] (-2080.018) (-2081.420) * [-2079.879] (-2085.729) (-2084.782) (-2077.645) -- 0:02:10
537700 -- (-2077.159) (-2076.731) [-2077.488] (-2077.202) * [-2073.531] (-2087.566) (-2077.977) (-2087.918) -- 0:02:10
537800 -- (-2078.022) [-2067.574] (-2075.883) (-2085.241) * [-2075.246] (-2086.147) (-2084.227) (-2081.140) -- 0:02:11
537900 -- (-2078.163) [-2070.859] (-2085.838) (-2088.526) * (-2092.354) (-2078.526) (-2084.485) [-2072.563] -- 0:02:11
538000 -- (-2082.636) (-2083.246) [-2082.023] (-2089.084) * (-2087.376) (-2077.631) (-2084.019) [-2073.977] -- 0:02:11
Average standard deviation of split frequencies: 0.007759
538100 -- [-2075.086] (-2074.779) (-2083.317) (-2085.944) * (-2079.782) (-2078.392) (-2082.852) [-2083.146] -- 0:02:11
538200 -- (-2077.866) [-2071.033] (-2081.695) (-2081.383) * [-2077.607] (-2084.815) (-2084.073) (-2081.025) -- 0:02:11
538300 -- (-2086.420) [-2070.201] (-2076.784) (-2076.504) * (-2078.602) [-2080.545] (-2082.086) (-2079.575) -- 0:02:11
538400 -- (-2085.708) [-2071.934] (-2076.346) (-2078.194) * [-2089.013] (-2080.283) (-2078.897) (-2074.347) -- 0:02:11
538500 -- (-2085.906) [-2068.371] (-2072.935) (-2090.613) * (-2088.406) [-2080.267] (-2083.689) (-2075.719) -- 0:02:11
538600 -- (-2076.779) (-2070.388) [-2072.744] (-2091.241) * (-2083.979) (-2083.713) (-2086.945) [-2074.399] -- 0:02:11
538700 -- (-2079.118) [-2072.428] (-2076.807) (-2084.367) * (-2083.110) (-2075.515) (-2075.000) [-2070.149] -- 0:02:11
538800 -- [-2077.931] (-2083.151) (-2079.723) (-2082.538) * (-2076.254) [-2084.106] (-2075.662) (-2075.089) -- 0:02:10
538900 -- (-2074.095) (-2076.810) [-2080.261] (-2085.495) * [-2075.781] (-2079.505) (-2080.537) (-2076.817) -- 0:02:10
539000 -- [-2076.700] (-2079.015) (-2079.599) (-2087.167) * (-2078.498) (-2089.993) (-2082.208) [-2076.934] -- 0:02:10
Average standard deviation of split frequencies: 0.007843
539100 -- (-2081.971) [-2070.688] (-2093.182) (-2089.208) * (-2085.609) (-2079.979) (-2080.623) [-2088.648] -- 0:02:10
539200 -- (-2085.091) [-2075.195] (-2077.374) (-2082.680) * [-2078.289] (-2077.469) (-2088.850) (-2075.604) -- 0:02:10
539300 -- (-2088.036) [-2073.091] (-2077.555) (-2072.294) * (-2077.223) (-2080.666) [-2083.606] (-2080.430) -- 0:02:10
539400 -- (-2084.057) [-2070.373] (-2079.652) (-2073.443) * (-2080.022) (-2080.678) [-2080.907] (-2075.881) -- 0:02:10
539500 -- [-2080.699] (-2074.783) (-2073.971) (-2075.436) * (-2080.568) (-2084.603) (-2081.832) [-2072.958] -- 0:02:10
539600 -- (-2079.027) (-2077.522) (-2081.639) [-2074.786] * (-2086.833) (-2086.404) (-2074.664) [-2071.978] -- 0:02:10
539700 -- (-2078.642) [-2069.371] (-2082.618) (-2085.486) * [-2081.573] (-2084.432) (-2081.190) (-2074.049) -- 0:02:10
539800 -- [-2075.511] (-2071.113) (-2086.741) (-2080.882) * (-2079.811) (-2083.423) [-2073.056] (-2068.804) -- 0:02:10
539900 -- (-2074.770) [-2072.062] (-2084.369) (-2089.540) * (-2079.939) (-2082.066) (-2081.948) [-2071.890] -- 0:02:10
540000 -- (-2076.442) [-2071.194] (-2082.451) (-2091.248) * (-2080.401) (-2081.742) [-2076.799] (-2073.309) -- 0:02:10
Average standard deviation of split frequencies: 0.007680
540100 -- [-2076.084] (-2083.323) (-2079.821) (-2087.467) * [-2075.265] (-2094.055) (-2079.990) (-2074.739) -- 0:02:10
540200 -- (-2081.435) [-2079.429] (-2087.564) (-2083.705) * (-2082.658) (-2090.822) (-2078.503) [-2077.291] -- 0:02:10
540300 -- (-2086.283) [-2077.652] (-2084.084) (-2076.181) * [-2072.881] (-2092.802) (-2078.344) (-2086.806) -- 0:02:10
540400 -- [-2079.114] (-2074.638) (-2077.246) (-2081.979) * [-2074.288] (-2092.741) (-2076.952) (-2087.400) -- 0:02:10
540500 -- [-2081.479] (-2078.436) (-2078.080) (-2079.423) * [-2073.275] (-2082.881) (-2086.244) (-2083.964) -- 0:02:10
540600 -- (-2074.326) (-2075.935) [-2080.146] (-2085.721) * [-2075.273] (-2082.101) (-2089.639) (-2083.500) -- 0:02:10
540700 -- (-2073.867) (-2075.030) [-2074.880] (-2086.955) * (-2077.743) (-2079.520) (-2077.084) [-2075.415] -- 0:02:09
540800 -- (-2085.155) [-2073.909] (-2074.706) (-2096.673) * (-2079.706) (-2086.794) (-2079.006) [-2073.438] -- 0:02:09
540900 -- (-2082.107) [-2076.349] (-2071.306) (-2085.094) * [-2077.622] (-2077.798) (-2075.853) (-2073.568) -- 0:02:09
541000 -- (-2084.413) (-2076.215) [-2071.682] (-2082.447) * (-2079.678) [-2073.729] (-2079.309) (-2074.754) -- 0:02:09
Average standard deviation of split frequencies: 0.007665
541100 -- (-2078.266) (-2076.743) [-2073.299] (-2085.300) * [-2077.107] (-2076.357) (-2088.163) (-2076.433) -- 0:02:09
541200 -- (-2080.844) (-2085.207) [-2069.787] (-2080.555) * [-2074.278] (-2082.089) (-2086.854) (-2073.921) -- 0:02:09
541300 -- (-2089.002) (-2084.043) [-2077.942] (-2091.669) * [-2071.497] (-2079.055) (-2086.061) (-2082.640) -- 0:02:10
541400 -- (-2076.893) (-2088.222) [-2071.024] (-2091.273) * [-2074.281] (-2087.106) (-2094.507) (-2077.520) -- 0:02:10
541500 -- (-2084.685) (-2075.487) (-2074.709) [-2081.473] * (-2082.709) (-2080.869) (-2088.632) [-2082.203] -- 0:02:10
541600 -- (-2082.686) (-2077.659) [-2077.072] (-2087.203) * (-2096.937) (-2078.158) [-2080.372] (-2077.288) -- 0:02:10
541700 -- (-2081.092) [-2075.245] (-2077.193) (-2087.984) * (-2093.216) (-2079.972) [-2077.493] (-2082.670) -- 0:02:10
541800 -- [-2076.840] (-2075.891) (-2077.742) (-2081.510) * (-2082.208) (-2085.295) [-2076.269] (-2083.030) -- 0:02:10
541900 -- (-2079.599) [-2076.675] (-2073.949) (-2084.417) * (-2082.115) (-2092.021) [-2080.549] (-2093.640) -- 0:02:10
542000 -- (-2082.210) (-2081.540) [-2075.892] (-2075.824) * (-2085.647) (-2087.908) [-2078.229] (-2086.434) -- 0:02:10
Average standard deviation of split frequencies: 0.007776
542100 -- (-2076.668) (-2073.444) [-2074.077] (-2079.460) * [-2084.559] (-2086.171) (-2079.329) (-2085.073) -- 0:02:10
542200 -- (-2078.428) (-2075.684) [-2076.056] (-2086.544) * (-2085.767) (-2082.625) [-2078.570] (-2080.691) -- 0:02:10
542300 -- (-2082.006) [-2070.325] (-2069.725) (-2076.758) * (-2078.031) (-2082.039) [-2077.393] (-2079.787) -- 0:02:09
542400 -- (-2089.245) (-2070.111) [-2072.023] (-2078.494) * (-2076.829) (-2089.339) (-2086.630) [-2075.072] -- 0:02:09
542500 -- (-2088.856) [-2070.515] (-2070.427) (-2095.146) * (-2080.788) (-2081.730) (-2083.630) [-2080.252] -- 0:02:09
542600 -- (-2078.732) [-2071.920] (-2076.057) (-2091.880) * (-2084.276) (-2079.555) (-2076.976) [-2071.921] -- 0:02:09
542700 -- [-2075.391] (-2077.638) (-2078.710) (-2080.440) * (-2084.518) (-2082.755) [-2073.664] (-2087.137) -- 0:02:09
542800 -- [-2075.407] (-2077.900) (-2077.361) (-2085.090) * [-2080.411] (-2081.554) (-2074.121) (-2080.443) -- 0:02:09
542900 -- (-2081.314) [-2074.426] (-2074.350) (-2077.168) * (-2096.625) (-2078.299) (-2075.187) [-2080.375] -- 0:02:09
543000 -- (-2076.387) (-2074.274) [-2073.556] (-2074.949) * (-2085.345) (-2077.249) (-2073.209) [-2076.663] -- 0:02:09
Average standard deviation of split frequencies: 0.007786
543100 -- (-2075.790) (-2077.786) (-2074.450) [-2077.717] * [-2073.907] (-2077.520) (-2078.769) (-2076.003) -- 0:02:09
543200 -- (-2078.913) (-2075.279) [-2069.376] (-2083.905) * (-2076.403) [-2071.458] (-2082.834) (-2073.906) -- 0:02:09
543300 -- (-2078.499) (-2075.453) [-2075.310] (-2078.589) * [-2076.636] (-2076.659) (-2076.131) (-2077.044) -- 0:02:09
543400 -- (-2077.086) (-2080.160) [-2072.328] (-2076.848) * (-2080.954) (-2079.605) (-2080.288) [-2075.702] -- 0:02:09
543500 -- (-2077.967) (-2073.545) (-2075.956) [-2078.096] * [-2075.938] (-2084.174) (-2079.045) (-2079.140) -- 0:02:09
543600 -- (-2078.008) (-2074.528) [-2075.147] (-2080.637) * (-2086.561) (-2080.014) (-2078.924) [-2075.525] -- 0:02:09
543700 -- (-2088.976) [-2072.743] (-2076.483) (-2086.598) * (-2087.028) (-2081.038) [-2080.236] (-2083.567) -- 0:02:09
543800 -- (-2085.508) (-2084.164) [-2071.355] (-2089.994) * (-2077.300) [-2073.747] (-2077.110) (-2082.160) -- 0:02:09
543900 -- (-2088.125) (-2075.883) (-2071.373) [-2078.310] * [-2075.600] (-2085.008) (-2084.279) (-2080.312) -- 0:02:09
544000 -- (-2081.801) [-2074.521] (-2072.996) (-2087.446) * [-2075.512] (-2078.833) (-2086.033) (-2085.045) -- 0:02:09
Average standard deviation of split frequencies: 0.007451
544100 -- (-2084.589) (-2079.617) [-2070.018] (-2078.603) * (-2080.952) [-2075.968] (-2078.432) (-2083.411) -- 0:02:09
544200 -- (-2081.630) (-2078.803) [-2076.999] (-2076.774) * (-2079.872) (-2081.735) [-2076.507] (-2083.499) -- 0:02:08
544300 -- (-2082.829) (-2079.738) [-2070.698] (-2083.138) * (-2084.842) [-2076.211] (-2078.569) (-2073.687) -- 0:02:08
544400 -- (-2090.930) (-2081.569) [-2078.253] (-2090.639) * (-2086.525) [-2081.386] (-2076.799) (-2076.267) -- 0:02:08
544500 -- (-2090.853) [-2074.648] (-2075.196) (-2078.444) * (-2087.473) (-2083.686) (-2077.751) [-2076.902] -- 0:02:08
544600 -- (-2089.722) [-2070.413] (-2080.015) (-2075.817) * (-2082.281) (-2084.278) [-2075.671] (-2079.904) -- 0:02:08
544700 -- (-2086.305) [-2080.823] (-2074.755) (-2082.458) * (-2083.454) [-2083.887] (-2076.424) (-2079.258) -- 0:02:08
544800 -- (-2091.358) [-2071.706] (-2081.484) (-2080.085) * (-2076.473) (-2078.743) (-2074.053) [-2075.447] -- 0:02:09
544900 -- (-2095.532) [-2069.486] (-2074.503) (-2080.509) * [-2077.508] (-2083.668) (-2074.631) (-2084.232) -- 0:02:09
545000 -- (-2087.670) (-2071.021) [-2078.795] (-2076.146) * (-2081.608) (-2091.186) [-2072.797] (-2087.368) -- 0:02:09
Average standard deviation of split frequencies: 0.007485
545100 -- (-2083.296) [-2073.529] (-2069.899) (-2079.126) * (-2084.801) (-2085.262) [-2072.344] (-2094.087) -- 0:02:09
545200 -- (-2084.322) (-2078.062) [-2068.910] (-2074.794) * (-2080.977) (-2084.942) (-2074.183) [-2080.259] -- 0:02:09
545300 -- (-2084.350) (-2075.766) [-2073.455] (-2085.781) * [-2077.222] (-2080.734) (-2078.013) (-2083.588) -- 0:02:09
545400 -- (-2082.147) (-2075.656) [-2070.603] (-2088.330) * [-2075.846] (-2079.460) (-2083.831) (-2081.028) -- 0:02:09
545500 -- (-2083.560) (-2073.779) [-2069.149] (-2079.501) * (-2085.232) [-2076.289] (-2082.007) (-2078.230) -- 0:02:09
545600 -- (-2085.361) [-2073.766] (-2070.718) (-2078.708) * (-2076.943) (-2077.745) (-2082.206) [-2078.309] -- 0:02:09
545700 -- (-2081.271) (-2077.347) [-2069.985] (-2090.737) * (-2080.929) [-2076.880] (-2078.401) (-2075.180) -- 0:02:09
545800 -- (-2081.434) [-2071.593] (-2069.419) (-2082.353) * (-2087.243) [-2076.899] (-2083.454) (-2085.189) -- 0:02:08
545900 -- (-2087.537) [-2075.774] (-2070.383) (-2091.979) * (-2088.576) (-2077.110) (-2083.456) [-2079.232] -- 0:02:08
546000 -- (-2081.496) (-2076.855) [-2069.863] (-2101.858) * (-2083.040) (-2076.814) (-2083.628) [-2075.519] -- 0:02:08
Average standard deviation of split frequencies: 0.007275
546100 -- (-2085.699) (-2080.106) [-2068.604] (-2088.257) * (-2082.422) (-2085.927) (-2076.273) [-2077.235] -- 0:02:08
546200 -- (-2088.194) [-2073.561] (-2070.527) (-2083.571) * (-2086.460) (-2078.511) (-2079.227) [-2075.481] -- 0:02:08
546300 -- (-2082.632) (-2076.044) [-2068.911] (-2079.229) * (-2080.475) [-2079.413] (-2075.878) (-2078.803) -- 0:02:08
546400 -- (-2081.836) (-2082.920) [-2068.560] (-2085.814) * [-2080.215] (-2084.812) (-2085.663) (-2078.472) -- 0:02:08
546500 -- (-2085.763) [-2077.228] (-2080.643) (-2084.567) * (-2078.567) (-2084.380) [-2079.123] (-2077.755) -- 0:02:08
546600 -- (-2080.725) [-2073.629] (-2086.570) (-2093.066) * (-2076.170) (-2088.901) (-2079.457) [-2080.945] -- 0:02:08
546700 -- [-2085.219] (-2079.212) (-2074.612) (-2093.557) * [-2075.944] (-2081.702) (-2078.958) (-2080.581) -- 0:02:08
546800 -- [-2080.803] (-2075.524) (-2073.893) (-2097.546) * (-2078.992) (-2091.049) (-2074.087) [-2077.404] -- 0:02:08
546900 -- (-2082.607) (-2077.983) [-2071.184] (-2096.925) * (-2078.725) (-2082.602) [-2074.958] (-2076.337) -- 0:02:08
547000 -- (-2078.622) (-2078.401) [-2070.543] (-2087.295) * [-2082.455] (-2088.886) (-2079.547) (-2075.846) -- 0:02:08
Average standard deviation of split frequencies: 0.007212
547100 -- (-2079.566) (-2073.512) [-2071.147] (-2083.071) * (-2086.205) (-2084.785) (-2075.373) [-2083.474] -- 0:02:08
547200 -- [-2074.979] (-2076.706) (-2072.239) (-2080.572) * [-2073.983] (-2096.026) (-2077.405) (-2085.226) -- 0:02:08
547300 -- (-2074.971) (-2074.287) (-2077.503) [-2073.540] * (-2080.184) (-2091.664) (-2084.127) [-2074.798] -- 0:02:08
547400 -- (-2075.478) (-2085.467) [-2076.554] (-2073.755) * (-2078.847) (-2081.243) (-2079.527) [-2080.973] -- 0:02:08
547500 -- [-2073.705] (-2081.337) (-2084.479) (-2076.818) * [-2081.377] (-2083.217) (-2085.534) (-2076.467) -- 0:02:08
547600 -- (-2073.398) (-2084.199) (-2078.547) [-2078.480] * [-2077.645] (-2082.169) (-2084.109) (-2077.462) -- 0:02:08
547700 -- [-2073.469] (-2074.567) (-2082.553) (-2079.232) * (-2091.590) [-2077.369] (-2092.513) (-2079.174) -- 0:02:08
547800 -- (-2080.787) [-2074.627] (-2085.531) (-2084.636) * (-2078.420) (-2083.890) (-2079.656) [-2080.711] -- 0:02:07
547900 -- (-2077.074) [-2069.210] (-2088.799) (-2087.163) * (-2076.495) (-2089.209) [-2077.222] (-2088.694) -- 0:02:07
548000 -- (-2075.744) [-2071.659] (-2083.238) (-2078.269) * (-2079.705) (-2083.270) [-2075.940] (-2083.313) -- 0:02:07
Average standard deviation of split frequencies: 0.007224
548100 -- (-2089.390) [-2073.842] (-2087.162) (-2078.637) * (-2072.975) (-2083.829) (-2081.450) [-2076.191] -- 0:02:07
548200 -- (-2080.599) (-2072.718) (-2087.976) [-2077.106] * [-2071.859] (-2097.816) (-2073.442) (-2081.518) -- 0:02:08
548300 -- (-2083.805) (-2082.658) (-2080.850) [-2079.065] * [-2075.099] (-2086.767) (-2073.157) (-2081.736) -- 0:02:08
548400 -- [-2075.842] (-2082.278) (-2077.667) (-2075.005) * [-2076.671] (-2084.774) (-2070.330) (-2080.602) -- 0:02:08
548500 -- (-2082.736) [-2077.662] (-2073.371) (-2079.862) * (-2076.317) (-2083.513) [-2070.210] (-2083.484) -- 0:02:08
548600 -- [-2077.559] (-2076.138) (-2079.422) (-2081.010) * (-2082.699) (-2089.839) [-2070.844] (-2074.137) -- 0:02:08
548700 -- [-2078.417] (-2081.805) (-2079.289) (-2084.156) * [-2075.661] (-2084.246) (-2078.318) (-2084.955) -- 0:02:08
548800 -- (-2087.908) [-2082.446] (-2085.071) (-2071.343) * (-2084.438) [-2081.898] (-2070.673) (-2100.351) -- 0:02:08
548900 -- (-2082.625) (-2086.864) (-2081.328) [-2072.276] * (-2082.992) (-2079.343) [-2074.634] (-2085.598) -- 0:02:08
549000 -- (-2087.667) (-2075.219) (-2080.502) [-2073.708] * (-2084.322) (-2078.927) [-2072.501] (-2082.924) -- 0:02:08
Average standard deviation of split frequencies: 0.007210
549100 -- (-2084.400) [-2076.409] (-2076.444) (-2074.931) * (-2081.993) (-2083.286) [-2075.532] (-2089.125) -- 0:02:08
549200 -- [-2081.275] (-2077.500) (-2084.988) (-2074.641) * (-2074.983) [-2082.318] (-2077.519) (-2078.299) -- 0:02:08
549300 -- (-2083.737) (-2077.536) [-2077.896] (-2078.133) * [-2077.820] (-2091.142) (-2071.082) (-2083.097) -- 0:02:07
549400 -- (-2080.825) (-2082.042) [-2075.284] (-2077.376) * (-2078.139) (-2088.894) [-2070.891] (-2090.197) -- 0:02:07
549500 -- (-2076.423) [-2079.274] (-2089.500) (-2075.464) * (-2071.928) (-2082.707) [-2078.075] (-2088.901) -- 0:02:07
549600 -- (-2078.401) (-2081.312) (-2088.263) [-2074.574] * (-2076.665) (-2083.443) [-2071.247] (-2091.794) -- 0:02:07
549700 -- [-2077.399] (-2080.532) (-2083.591) (-2080.276) * (-2080.400) (-2082.256) [-2076.904] (-2087.852) -- 0:02:07
549800 -- [-2078.123] (-2085.022) (-2087.656) (-2086.287) * [-2084.367] (-2078.731) (-2071.969) (-2084.249) -- 0:02:07
549900 -- (-2085.304) (-2080.468) (-2082.424) [-2082.399] * (-2080.512) [-2079.375] (-2072.520) (-2093.543) -- 0:02:07
550000 -- (-2077.965) (-2080.463) [-2077.584] (-2087.961) * (-2088.341) (-2077.638) [-2071.905] (-2088.555) -- 0:02:07
Average standard deviation of split frequencies: 0.006929
550100 -- (-2078.682) [-2076.154] (-2086.775) (-2079.887) * (-2089.723) (-2079.291) [-2074.649] (-2089.049) -- 0:02:07
550200 -- (-2083.324) [-2072.544] (-2081.739) (-2082.348) * (-2080.599) (-2081.374) [-2069.452] (-2086.735) -- 0:02:07
550300 -- (-2075.869) (-2090.907) [-2080.915] (-2096.505) * (-2081.308) (-2081.084) [-2071.364] (-2095.560) -- 0:02:07
550400 -- [-2076.583] (-2084.822) (-2084.775) (-2094.818) * (-2079.353) (-2075.281) [-2078.469] (-2100.010) -- 0:02:07
550500 -- [-2076.211] (-2075.139) (-2076.403) (-2091.688) * (-2075.247) [-2075.158] (-2079.588) (-2102.684) -- 0:02:07
550600 -- [-2082.413] (-2082.485) (-2078.275) (-2087.333) * (-2076.905) (-2073.628) [-2074.369] (-2097.487) -- 0:02:07
550700 -- [-2081.012] (-2086.782) (-2085.712) (-2077.046) * (-2081.122) (-2082.775) [-2071.530] (-2085.080) -- 0:02:07
550800 -- (-2079.625) [-2074.892] (-2082.056) (-2077.832) * [-2077.783] (-2084.864) (-2071.587) (-2087.277) -- 0:02:07
550900 -- (-2080.068) [-2071.154] (-2077.343) (-2076.360) * (-2089.118) (-2082.569) (-2073.839) [-2078.675] -- 0:02:07
551000 -- (-2074.949) [-2069.184] (-2083.360) (-2076.945) * (-2084.452) (-2088.593) (-2074.518) [-2075.384] -- 0:02:07
Average standard deviation of split frequencies: 0.006988
551100 -- [-2075.293] (-2067.565) (-2097.699) (-2078.474) * (-2081.767) (-2074.185) (-2076.298) [-2076.398] -- 0:02:07
551200 -- [-2073.027] (-2074.046) (-2093.063) (-2082.307) * (-2081.099) (-2081.345) [-2074.484] (-2077.479) -- 0:02:07
551300 -- (-2075.938) [-2073.598] (-2083.645) (-2078.559) * [-2075.071] (-2083.467) (-2078.067) (-2079.521) -- 0:02:06
551400 -- (-2073.822) (-2089.351) (-2084.502) [-2074.404] * [-2078.105] (-2083.658) (-2075.662) (-2080.426) -- 0:02:06
551500 -- (-2072.642) (-2088.171) (-2087.359) [-2075.945] * [-2076.352] (-2085.282) (-2081.351) (-2085.359) -- 0:02:06
551600 -- [-2072.628] (-2082.380) (-2087.249) (-2074.286) * [-2075.528] (-2089.275) (-2082.736) (-2087.495) -- 0:02:06
551700 -- (-2077.503) (-2077.446) (-2088.824) [-2072.163] * [-2079.026] (-2092.070) (-2074.440) (-2084.833) -- 0:02:07
551800 -- (-2090.141) [-2076.051] (-2081.028) (-2077.510) * [-2076.460] (-2088.025) (-2072.288) (-2083.153) -- 0:02:07
551900 -- (-2074.106) [-2071.783] (-2084.455) (-2076.731) * (-2084.865) (-2086.216) [-2071.853] (-2081.780) -- 0:02:07
552000 -- (-2072.990) (-2070.901) [-2079.415] (-2076.512) * (-2083.206) (-2082.487) (-2073.279) [-2078.920] -- 0:02:07
Average standard deviation of split frequencies: 0.006684
552100 -- (-2071.680) [-2077.258] (-2092.553) (-2073.746) * (-2087.072) (-2100.169) [-2079.014] (-2080.701) -- 0:02:07
552200 -- (-2080.560) [-2075.368] (-2085.611) (-2073.551) * (-2078.645) (-2095.552) [-2074.372] (-2087.327) -- 0:02:07
552300 -- (-2071.793) [-2074.257] (-2080.810) (-2078.428) * [-2076.252] (-2093.798) (-2072.596) (-2084.298) -- 0:02:07
552400 -- [-2069.595] (-2074.690) (-2090.870) (-2076.481) * (-2078.198) (-2093.413) [-2073.364] (-2083.491) -- 0:02:07
552500 -- (-2073.550) (-2083.545) (-2080.043) [-2070.877] * [-2078.919] (-2093.962) (-2078.816) (-2080.319) -- 0:02:07
552600 -- (-2073.415) (-2081.597) (-2082.579) [-2071.785] * [-2079.513] (-2088.049) (-2080.478) (-2082.048) -- 0:02:07
552700 -- (-2084.162) (-2075.694) [-2078.484] (-2084.460) * (-2083.428) (-2079.443) [-2077.933] (-2088.894) -- 0:02:07
552800 -- (-2079.545) (-2077.510) [-2080.482] (-2090.365) * (-2087.456) (-2081.456) (-2079.256) [-2084.156] -- 0:02:07
552900 -- [-2075.452] (-2084.873) (-2080.762) (-2076.754) * (-2093.162) (-2083.088) (-2077.605) [-2076.467] -- 0:02:06
553000 -- [-2075.384] (-2081.414) (-2081.605) (-2079.047) * (-2083.794) (-2081.552) (-2079.597) [-2074.728] -- 0:02:06
Average standard deviation of split frequencies: 0.006452
553100 -- (-2079.078) (-2075.172) [-2076.721] (-2090.337) * (-2075.180) (-2087.430) (-2077.442) [-2075.564] -- 0:02:06
553200 -- (-2087.515) (-2073.943) [-2076.426] (-2083.540) * [-2074.840] (-2095.424) (-2077.552) (-2078.209) -- 0:02:06
553300 -- (-2082.589) (-2081.692) (-2077.445) [-2069.030] * [-2075.588] (-2085.302) (-2086.929) (-2082.616) -- 0:02:06
553400 -- (-2086.757) (-2073.146) (-2078.294) [-2069.421] * (-2076.766) (-2078.435) [-2080.064] (-2076.842) -- 0:02:06
553500 -- (-2089.197) (-2079.147) (-2088.112) [-2071.015] * (-2078.301) (-2080.507) [-2075.967] (-2079.026) -- 0:02:06
553600 -- (-2080.106) [-2078.617] (-2083.666) (-2071.697) * (-2080.600) (-2080.092) (-2079.046) [-2073.683] -- 0:02:06
553700 -- (-2081.753) (-2078.061) (-2082.740) [-2077.958] * (-2087.148) (-2080.964) (-2086.426) [-2075.668] -- 0:02:06
553800 -- (-2079.476) (-2077.378) (-2075.064) [-2073.175] * (-2090.435) [-2072.643] (-2087.651) (-2080.209) -- 0:02:06
553900 -- [-2075.223] (-2077.866) (-2073.362) (-2085.954) * (-2082.562) [-2076.189] (-2096.738) (-2078.899) -- 0:02:06
554000 -- (-2076.565) [-2072.443] (-2077.122) (-2079.164) * (-2091.698) (-2084.511) (-2079.079) [-2076.572] -- 0:02:06
Average standard deviation of split frequencies: 0.006465
554100 -- [-2077.355] (-2073.886) (-2074.816) (-2080.748) * (-2083.572) [-2076.305] (-2074.291) (-2077.963) -- 0:02:06
554200 -- (-2083.785) [-2073.458] (-2081.474) (-2069.901) * (-2082.792) (-2087.940) [-2072.590] (-2077.053) -- 0:02:06
554300 -- (-2078.725) (-2074.089) (-2085.455) [-2065.710] * (-2079.538) (-2091.627) [-2077.241] (-2076.839) -- 0:02:06
554400 -- (-2075.908) (-2070.596) (-2085.971) [-2068.593] * (-2089.515) (-2080.797) (-2074.147) [-2076.895] -- 0:02:06
554500 -- [-2071.588] (-2080.243) (-2084.674) (-2073.932) * (-2085.925) (-2076.843) (-2077.082) [-2078.021] -- 0:02:06
554600 -- (-2073.950) (-2077.394) (-2077.789) [-2070.438] * (-2082.618) (-2075.965) (-2074.805) [-2077.496] -- 0:02:06
554700 -- (-2079.305) [-2071.722] (-2076.860) (-2076.890) * (-2088.421) (-2079.858) [-2068.710] (-2076.061) -- 0:02:06
554800 -- (-2077.978) (-2074.287) [-2078.041] (-2078.163) * (-2079.158) (-2093.782) [-2071.335] (-2077.547) -- 0:02:05
554900 -- [-2073.692] (-2077.696) (-2076.147) (-2082.628) * (-2088.467) (-2081.830) [-2071.452] (-2081.266) -- 0:02:05
555000 -- (-2074.506) [-2072.416] (-2077.021) (-2079.294) * (-2088.948) (-2084.807) [-2070.597] (-2078.932) -- 0:02:05
Average standard deviation of split frequencies: 0.006404
555100 -- (-2083.616) (-2090.402) (-2078.311) [-2079.109] * (-2095.260) (-2080.446) [-2069.304] (-2077.665) -- 0:02:05
555200 -- [-2075.846] (-2084.981) (-2085.334) (-2081.680) * (-2084.741) (-2079.939) [-2080.012] (-2083.006) -- 0:02:06
555300 -- [-2073.437] (-2075.416) (-2082.713) (-2078.348) * [-2080.722] (-2079.264) (-2075.494) (-2081.004) -- 0:02:06
555400 -- (-2085.328) (-2087.314) [-2080.880] (-2081.110) * (-2075.690) (-2077.564) [-2073.020] (-2079.024) -- 0:02:06
555500 -- (-2085.072) (-2071.979) (-2079.440) [-2074.403] * (-2080.124) [-2077.685] (-2080.852) (-2095.627) -- 0:02:06
555600 -- (-2078.449) [-2074.794] (-2086.273) (-2077.506) * (-2080.866) (-2083.656) [-2074.348] (-2082.801) -- 0:02:06
555700 -- (-2085.515) [-2074.325] (-2077.882) (-2076.963) * (-2088.068) [-2075.268] (-2078.577) (-2082.891) -- 0:02:06
555800 -- (-2087.937) [-2073.939] (-2079.326) (-2073.156) * (-2087.568) (-2082.986) (-2076.618) [-2078.740] -- 0:02:06
555900 -- (-2083.577) [-2069.300] (-2077.298) (-2083.482) * [-2080.286] (-2076.847) (-2076.540) (-2079.991) -- 0:02:06
556000 -- (-2075.183) [-2070.098] (-2073.760) (-2074.852) * (-2078.527) (-2080.310) [-2075.972] (-2082.648) -- 0:02:06
Average standard deviation of split frequencies: 0.006176
556100 -- [-2073.118] (-2079.198) (-2075.747) (-2069.543) * [-2076.658] (-2078.694) (-2093.460) (-2080.299) -- 0:02:06
556200 -- (-2076.256) (-2077.950) (-2078.819) [-2068.970] * [-2079.419] (-2077.410) (-2084.128) (-2079.254) -- 0:02:06
556300 -- (-2077.940) (-2079.742) (-2075.745) [-2076.859] * (-2077.393) (-2081.794) [-2084.130] (-2090.150) -- 0:02:06
556400 -- (-2072.762) [-2076.067] (-2088.251) (-2082.361) * (-2086.383) [-2080.784] (-2091.171) (-2079.836) -- 0:02:05
556500 -- (-2082.371) (-2075.465) (-2085.676) [-2071.884] * (-2083.746) [-2076.787] (-2077.939) (-2077.421) -- 0:02:05
556600 -- [-2075.264] (-2081.491) (-2084.635) (-2071.876) * (-2086.007) (-2080.944) (-2077.883) [-2072.973] -- 0:02:05
556700 -- (-2076.756) (-2081.465) (-2084.169) [-2071.045] * (-2078.786) [-2073.623] (-2080.259) (-2083.969) -- 0:02:05
556800 -- (-2079.868) (-2083.530) [-2080.181] (-2078.755) * (-2091.465) [-2073.133] (-2073.978) (-2081.875) -- 0:02:05
556900 -- [-2074.171] (-2080.113) (-2083.746) (-2094.523) * (-2079.383) [-2071.307] (-2075.557) (-2080.975) -- 0:02:05
557000 -- [-2072.574] (-2086.341) (-2079.827) (-2085.580) * (-2077.473) [-2073.273] (-2076.515) (-2084.063) -- 0:02:05
Average standard deviation of split frequencies: 0.006261
557100 -- (-2075.403) [-2079.941] (-2074.112) (-2080.082) * (-2077.775) [-2073.963] (-2080.873) (-2090.646) -- 0:02:05
557200 -- (-2069.939) [-2075.811] (-2080.298) (-2078.215) * (-2080.456) (-2087.147) [-2080.045] (-2100.736) -- 0:02:05
557300 -- [-2068.535] (-2089.996) (-2077.173) (-2087.049) * (-2079.116) [-2076.343] (-2077.096) (-2093.353) -- 0:02:05
557400 -- (-2071.733) (-2080.508) (-2089.707) [-2075.798] * (-2081.425) [-2072.990] (-2082.866) (-2086.739) -- 0:02:05
557500 -- [-2072.824] (-2084.541) (-2090.227) (-2071.261) * [-2078.192] (-2087.865) (-2081.499) (-2080.523) -- 0:02:05
557600 -- (-2074.421) (-2083.635) (-2081.820) [-2072.184] * [-2075.926] (-2085.491) (-2082.801) (-2075.812) -- 0:02:05
557700 -- (-2080.260) (-2084.000) (-2082.294) [-2073.243] * (-2075.622) (-2084.097) [-2075.527] (-2084.771) -- 0:02:05
557800 -- (-2073.728) (-2089.026) (-2094.083) [-2076.197] * [-2073.299] (-2094.833) (-2074.649) (-2080.907) -- 0:02:05
557900 -- (-2081.377) (-2084.521) [-2077.869] (-2074.839) * [-2074.621] (-2091.720) (-2076.319) (-2082.422) -- 0:02:05
558000 -- (-2076.853) (-2087.374) (-2081.110) [-2073.551] * (-2080.051) (-2083.407) [-2074.649] (-2086.140) -- 0:02:05
Average standard deviation of split frequencies: 0.006250
558100 -- (-2092.586) (-2078.347) (-2081.366) [-2076.379] * (-2076.649) (-2076.858) [-2076.970] (-2072.713) -- 0:02:05
558200 -- [-2080.022] (-2089.627) (-2087.318) (-2075.443) * (-2075.987) [-2073.889] (-2079.032) (-2076.823) -- 0:02:05
558300 -- (-2072.823) (-2084.506) (-2084.558) [-2079.128] * (-2083.513) (-2071.142) (-2079.071) [-2074.467] -- 0:02:05
558400 -- [-2069.892] (-2081.654) (-2084.966) (-2071.971) * (-2079.291) [-2072.429] (-2084.744) (-2074.236) -- 0:02:04
558500 -- [-2069.756] (-2084.756) (-2085.632) (-2075.872) * (-2082.420) [-2069.293] (-2075.980) (-2078.996) -- 0:02:04
558600 -- [-2069.496] (-2081.108) (-2083.757) (-2073.667) * (-2084.489) [-2066.945] (-2084.490) (-2083.002) -- 0:02:05
558700 -- (-2075.098) (-2078.560) (-2084.277) [-2072.343] * (-2084.872) [-2067.669] (-2078.188) (-2087.841) -- 0:02:05
558800 -- (-2083.958) (-2070.925) (-2086.087) [-2073.058] * (-2075.102) [-2073.981] (-2083.604) (-2073.887) -- 0:02:05
558900 -- (-2083.094) [-2072.326] (-2077.620) (-2080.429) * (-2076.479) (-2069.934) (-2077.699) [-2073.389] -- 0:02:05
559000 -- (-2081.933) (-2073.833) [-2080.274] (-2081.022) * (-2084.090) [-2070.033] (-2087.745) (-2074.695) -- 0:02:05
Average standard deviation of split frequencies: 0.006262
559100 -- [-2076.866] (-2072.961) (-2079.978) (-2078.128) * (-2089.138) (-2075.727) [-2081.827] (-2072.611) -- 0:02:05
559200 -- [-2075.187] (-2081.946) (-2088.541) (-2079.018) * (-2094.451) (-2070.200) (-2083.792) [-2078.865] -- 0:02:05
559300 -- [-2076.067] (-2073.771) (-2079.090) (-2075.158) * (-2089.909) [-2073.564] (-2090.821) (-2075.811) -- 0:02:05
559400 -- (-2073.617) (-2078.691) [-2076.965] (-2083.333) * (-2082.421) [-2075.576] (-2084.525) (-2078.335) -- 0:02:05
559500 -- (-2072.984) [-2082.692] (-2077.829) (-2078.854) * (-2084.449) (-2071.483) (-2088.327) [-2080.938] -- 0:02:05
559600 -- (-2075.600) [-2075.184] (-2079.022) (-2086.780) * (-2094.160) (-2079.732) [-2072.156] (-2083.539) -- 0:02:05
559700 -- (-2073.154) [-2070.563] (-2078.447) (-2081.458) * (-2091.670) [-2077.508] (-2073.492) (-2088.541) -- 0:02:05
559800 -- (-2075.972) [-2073.176] (-2086.144) (-2082.936) * (-2086.059) [-2076.243] (-2073.461) (-2075.679) -- 0:02:05
559900 -- [-2072.777] (-2078.008) (-2080.786) (-2076.044) * (-2088.818) (-2085.669) (-2074.287) [-2077.108] -- 0:02:04
560000 -- [-2074.195] (-2075.642) (-2082.694) (-2080.511) * (-2088.638) [-2068.807] (-2076.604) (-2082.351) -- 0:02:04
Average standard deviation of split frequencies: 0.006348
560100 -- [-2072.931] (-2075.153) (-2078.033) (-2075.929) * (-2085.543) (-2069.552) (-2084.443) [-2076.695] -- 0:02:04
560200 -- (-2080.556) (-2072.284) (-2080.539) [-2076.478] * (-2081.572) [-2070.104] (-2069.122) (-2084.463) -- 0:02:04
560300 -- (-2070.050) (-2079.004) (-2082.061) [-2074.826] * (-2078.038) (-2072.962) [-2071.523] (-2081.530) -- 0:02:04
560400 -- (-2074.981) [-2075.008] (-2075.757) (-2084.566) * (-2076.953) (-2070.758) [-2067.674] (-2086.746) -- 0:02:04
560500 -- (-2077.350) (-2071.551) [-2079.691] (-2087.619) * [-2074.060] (-2083.869) (-2074.991) (-2085.073) -- 0:02:04
560600 -- [-2072.880] (-2071.593) (-2084.108) (-2085.026) * (-2078.318) (-2082.284) [-2078.503] (-2084.735) -- 0:02:04
560700 -- (-2079.323) [-2076.822] (-2073.978) (-2077.745) * (-2078.106) (-2075.165) [-2070.761] (-2083.493) -- 0:02:04
560800 -- (-2073.864) (-2078.455) [-2073.362] (-2077.181) * (-2078.154) (-2073.652) [-2067.038] (-2090.675) -- 0:02:04
560900 -- [-2079.855] (-2087.863) (-2077.129) (-2078.597) * (-2077.998) [-2072.448] (-2072.126) (-2094.183) -- 0:02:04
561000 -- [-2071.256] (-2084.065) (-2079.565) (-2077.500) * (-2082.178) (-2075.530) [-2072.618] (-2085.622) -- 0:02:04
Average standard deviation of split frequencies: 0.006432
561100 -- [-2071.548] (-2077.990) (-2078.375) (-2079.979) * (-2091.868) (-2078.901) [-2071.096] (-2086.056) -- 0:02:04
561200 -- [-2072.095] (-2072.111) (-2085.661) (-2081.064) * (-2083.681) (-2089.516) (-2069.874) [-2081.740] -- 0:02:04
561300 -- (-2076.950) (-2066.156) (-2084.107) [-2069.860] * (-2087.650) (-2081.879) [-2070.680] (-2082.689) -- 0:02:04
561400 -- [-2074.123] (-2071.155) (-2080.793) (-2075.690) * (-2088.226) [-2077.562] (-2071.564) (-2079.325) -- 0:02:04
561500 -- [-2073.806] (-2072.536) (-2085.464) (-2079.382) * (-2094.981) (-2079.755) [-2070.340] (-2075.092) -- 0:02:04
561600 -- (-2073.017) [-2076.137] (-2089.713) (-2072.196) * (-2083.432) (-2081.548) [-2080.568] (-2078.097) -- 0:02:04
561700 -- (-2073.853) [-2071.634] (-2094.447) (-2076.935) * (-2083.303) (-2077.132) [-2074.142] (-2094.526) -- 0:02:04
561800 -- (-2078.705) [-2075.831] (-2088.439) (-2077.034) * (-2095.363) [-2078.408] (-2073.517) (-2077.239) -- 0:02:04
561900 -- (-2072.782) (-2071.643) (-2082.350) [-2074.099] * (-2082.343) (-2083.629) [-2069.786] (-2079.317) -- 0:02:03
562000 -- [-2073.336] (-2073.351) (-2085.556) (-2073.840) * (-2082.597) [-2077.739] (-2073.356) (-2084.184) -- 0:02:03
Average standard deviation of split frequencies: 0.006517
562100 -- [-2071.983] (-2085.238) (-2080.779) (-2073.267) * (-2081.977) [-2071.781] (-2077.591) (-2082.341) -- 0:02:04
562200 -- [-2073.515] (-2076.496) (-2094.889) (-2076.010) * (-2087.203) [-2072.582] (-2073.918) (-2077.077) -- 0:02:04
562300 -- (-2072.273) (-2078.656) (-2085.030) [-2071.294] * (-2082.032) (-2075.370) [-2073.046] (-2079.432) -- 0:02:04
562400 -- (-2076.634) (-2079.849) (-2088.908) [-2069.861] * (-2088.002) (-2080.222) (-2075.610) [-2074.133] -- 0:02:04
562500 -- (-2074.308) [-2073.403] (-2076.051) (-2082.782) * (-2085.775) (-2081.326) [-2072.559] (-2081.252) -- 0:02:04
562600 -- (-2078.093) [-2072.074] (-2081.943) (-2073.747) * (-2089.794) [-2074.321] (-2071.363) (-2077.275) -- 0:02:04
562700 -- (-2076.036) [-2072.470] (-2078.268) (-2078.163) * (-2083.473) [-2071.300] (-2065.519) (-2083.662) -- 0:02:04
562800 -- [-2077.628] (-2072.908) (-2080.129) (-2071.434) * (-2081.791) [-2072.298] (-2080.201) (-2077.283) -- 0:02:04
562900 -- (-2079.826) (-2074.732) (-2085.266) [-2073.050] * (-2081.057) [-2070.722] (-2082.966) (-2087.204) -- 0:02:04
563000 -- (-2076.193) (-2081.871) [-2079.056] (-2074.076) * (-2080.367) [-2073.800] (-2079.675) (-2082.555) -- 0:02:04
Average standard deviation of split frequencies: 0.006385
563100 -- (-2088.557) [-2078.979] (-2084.324) (-2085.062) * (-2083.517) (-2070.930) [-2075.836] (-2081.776) -- 0:02:04
563200 -- [-2078.657] (-2072.326) (-2080.827) (-2070.993) * (-2084.102) (-2078.176) [-2072.213] (-2076.003) -- 0:02:04
563300 -- (-2084.094) (-2083.144) (-2077.371) [-2075.506] * (-2090.344) [-2071.142] (-2075.468) (-2078.703) -- 0:02:04
563400 -- (-2080.429) (-2082.229) (-2077.673) [-2075.166] * (-2083.240) (-2076.658) [-2072.971] (-2078.781) -- 0:02:03
563500 -- [-2076.515] (-2073.234) (-2077.470) (-2082.183) * (-2081.333) (-2073.077) [-2068.971] (-2077.070) -- 0:02:03
563600 -- (-2073.968) (-2074.656) [-2079.146] (-2085.393) * (-2085.830) [-2072.958] (-2068.747) (-2082.519) -- 0:02:03
563700 -- (-2072.260) [-2077.332] (-2074.663) (-2079.165) * (-2084.808) [-2072.034] (-2075.404) (-2077.887) -- 0:02:03
563800 -- (-2075.082) (-2072.610) (-2082.031) [-2078.896] * (-2090.000) [-2076.699] (-2076.890) (-2086.799) -- 0:02:03
563900 -- [-2078.443] (-2074.641) (-2080.883) (-2077.041) * [-2086.744] (-2082.388) (-2071.928) (-2080.943) -- 0:02:03
564000 -- (-2079.820) [-2070.273] (-2087.719) (-2078.940) * (-2082.923) [-2075.591] (-2068.903) (-2079.920) -- 0:02:03
Average standard deviation of split frequencies: 0.006470
564100 -- (-2085.687) (-2070.732) (-2095.192) [-2072.882] * (-2080.557) [-2073.969] (-2072.005) (-2087.218) -- 0:02:03
564200 -- (-2081.047) [-2066.295] (-2091.183) (-2073.501) * (-2085.338) (-2073.949) [-2072.171] (-2088.417) -- 0:02:03
564300 -- [-2072.992] (-2071.458) (-2095.182) (-2077.638) * (-2093.077) (-2074.320) [-2078.030] (-2075.080) -- 0:02:03
564400 -- (-2074.899) (-2074.264) (-2092.108) [-2075.039] * (-2099.557) [-2077.898] (-2077.832) (-2091.871) -- 0:02:03
564500 -- (-2082.587) (-2071.751) [-2082.608] (-2084.817) * (-2093.168) (-2068.187) [-2071.912] (-2091.406) -- 0:02:03
564600 -- (-2074.401) [-2070.050] (-2084.044) (-2080.979) * (-2081.566) [-2069.514] (-2073.825) (-2081.246) -- 0:02:03
564700 -- (-2078.403) [-2071.723] (-2092.073) (-2080.421) * (-2079.857) [-2073.290] (-2077.385) (-2082.125) -- 0:02:03
564800 -- (-2073.621) [-2072.159] (-2076.231) (-2086.614) * (-2084.263) [-2073.728] (-2073.631) (-2083.756) -- 0:02:03
564900 -- (-2085.117) [-2075.181] (-2074.075) (-2087.502) * (-2080.994) [-2073.859] (-2072.355) (-2082.310) -- 0:02:03
565000 -- (-2081.480) [-2074.905] (-2075.362) (-2078.236) * (-2074.873) [-2074.400] (-2070.352) (-2089.780) -- 0:02:03
Average standard deviation of split frequencies: 0.006243
565100 -- (-2078.111) (-2072.736) [-2074.546] (-2078.318) * (-2079.496) (-2075.794) [-2077.567] (-2076.204) -- 0:02:03
565200 -- (-2079.846) (-2069.527) (-2073.105) [-2071.609] * (-2088.560) [-2070.353] (-2075.777) (-2078.273) -- 0:02:03
565300 -- (-2073.600) [-2073.372] (-2093.611) (-2075.150) * (-2076.383) (-2075.607) [-2072.214] (-2088.033) -- 0:02:03
565400 -- (-2082.964) [-2073.688] (-2076.327) (-2077.499) * (-2089.195) (-2072.590) [-2068.868] (-2088.468) -- 0:02:02
565500 -- (-2087.002) (-2082.992) (-2073.647) [-2072.022] * (-2086.119) (-2070.586) [-2074.761] (-2082.862) -- 0:02:02
565600 -- (-2084.866) (-2076.075) (-2075.307) [-2074.324] * (-2091.937) (-2089.865) [-2076.728] (-2084.651) -- 0:02:03
565700 -- (-2088.628) (-2083.357) (-2082.497) [-2073.043] * (-2078.841) [-2074.952] (-2069.684) (-2083.203) -- 0:02:03
565800 -- (-2090.172) (-2077.567) (-2081.645) [-2074.164] * [-2077.433] (-2076.517) (-2074.150) (-2081.870) -- 0:02:03
565900 -- (-2092.115) (-2078.431) (-2076.833) [-2073.921] * (-2084.115) (-2076.223) [-2072.347] (-2094.744) -- 0:02:03
566000 -- [-2077.865] (-2084.159) (-2080.653) (-2072.357) * (-2080.495) (-2074.336) [-2079.114] (-2086.800) -- 0:02:03
Average standard deviation of split frequencies: 0.006305
566100 -- (-2079.459) (-2077.828) (-2081.551) [-2072.453] * (-2074.498) (-2077.463) [-2082.282] (-2090.206) -- 0:02:03
566200 -- (-2078.917) [-2069.093] (-2077.794) (-2075.098) * (-2072.255) (-2082.216) [-2071.310] (-2079.359) -- 0:02:03
566300 -- (-2075.649) (-2067.951) [-2082.975] (-2079.442) * (-2068.379) [-2071.924] (-2071.288) (-2080.263) -- 0:02:03
566400 -- (-2077.107) [-2067.685] (-2086.621) (-2075.061) * [-2069.913] (-2075.545) (-2071.012) (-2082.122) -- 0:02:03
566500 -- (-2078.257) [-2067.898] (-2088.935) (-2073.203) * (-2072.581) [-2071.119] (-2077.986) (-2083.202) -- 0:02:03
566600 -- [-2072.418] (-2070.561) (-2085.366) (-2073.196) * (-2070.152) [-2075.338] (-2075.347) (-2088.841) -- 0:02:03
566700 -- (-2073.384) [-2069.297] (-2090.549) (-2074.865) * (-2071.663) (-2082.855) [-2072.448] (-2097.163) -- 0:02:03
566800 -- (-2073.467) [-2071.655] (-2086.297) (-2077.501) * (-2074.485) [-2067.933] (-2074.768) (-2082.615) -- 0:02:03
566900 -- [-2072.779] (-2076.845) (-2098.496) (-2077.333) * [-2072.770] (-2072.846) (-2077.820) (-2081.130) -- 0:02:03
567000 -- (-2083.889) [-2072.469] (-2085.318) (-2076.943) * [-2071.113] (-2073.710) (-2073.482) (-2080.881) -- 0:02:02
Average standard deviation of split frequencies: 0.006411
567100 -- (-2085.167) (-2078.957) (-2084.804) [-2082.147] * [-2077.363] (-2074.020) (-2073.181) (-2078.293) -- 0:02:02
567200 -- [-2074.398] (-2077.155) (-2093.388) (-2075.972) * (-2070.872) [-2070.402] (-2078.932) (-2084.261) -- 0:02:02
567300 -- (-2075.116) [-2081.257] (-2080.448) (-2084.074) * [-2071.854] (-2075.060) (-2075.913) (-2082.942) -- 0:02:02
567400 -- (-2075.315) [-2074.479] (-2087.412) (-2079.103) * (-2071.010) (-2076.935) [-2067.016] (-2083.598) -- 0:02:02
567500 -- [-2072.392] (-2072.247) (-2090.945) (-2083.500) * (-2090.397) [-2069.421] (-2071.092) (-2079.975) -- 0:02:02
567600 -- (-2078.691) [-2076.038] (-2085.550) (-2079.861) * (-2076.172) [-2070.515] (-2076.287) (-2087.041) -- 0:02:02
567700 -- (-2073.912) (-2078.669) (-2093.468) [-2075.342] * (-2079.442) (-2075.407) [-2077.085] (-2088.272) -- 0:02:02
567800 -- (-2084.786) (-2083.289) (-2088.270) [-2073.512] * (-2076.650) [-2075.253] (-2077.090) (-2095.710) -- 0:02:02
567900 -- [-2069.891] (-2081.796) (-2073.774) (-2086.389) * (-2082.927) [-2074.116] (-2081.858) (-2092.378) -- 0:02:02
568000 -- (-2076.882) [-2069.045] (-2082.945) (-2082.120) * (-2081.214) (-2074.568) [-2073.801] (-2096.229) -- 0:02:02
Average standard deviation of split frequencies: 0.006472
568100 -- (-2077.542) (-2075.881) (-2076.925) [-2073.841] * [-2073.763] (-2075.227) (-2073.792) (-2073.292) -- 0:02:02
568200 -- (-2072.119) (-2070.413) (-2082.213) [-2073.603] * (-2074.083) [-2071.267] (-2073.938) (-2078.222) -- 0:02:02
568300 -- (-2072.693) [-2070.563] (-2075.442) (-2081.102) * [-2072.438] (-2074.737) (-2078.774) (-2084.933) -- 0:02:02
568400 -- (-2073.540) [-2078.995] (-2080.546) (-2076.033) * [-2070.659] (-2073.861) (-2080.673) (-2078.094) -- 0:02:02
568500 -- (-2072.298) (-2076.985) (-2080.574) [-2069.725] * [-2066.393] (-2075.725) (-2076.084) (-2078.802) -- 0:02:02
568600 -- (-2074.033) (-2074.276) (-2079.045) [-2071.535] * [-2071.779] (-2077.734) (-2075.145) (-2077.371) -- 0:02:02
568700 -- (-2071.489) [-2078.808] (-2076.072) (-2078.795) * (-2071.697) [-2083.642] (-2082.552) (-2079.484) -- 0:02:02
568800 -- (-2073.756) [-2073.047] (-2077.955) (-2072.170) * [-2075.994] (-2079.300) (-2075.913) (-2082.798) -- 0:02:02
568900 -- (-2073.512) [-2073.581] (-2079.484) (-2077.949) * (-2077.180) (-2078.684) [-2074.641] (-2095.486) -- 0:02:02
569000 -- [-2073.646] (-2074.592) (-2081.320) (-2092.089) * (-2071.203) (-2082.410) [-2070.693] (-2091.254) -- 0:02:01
Average standard deviation of split frequencies: 0.006318
569100 -- [-2076.054] (-2074.471) (-2081.824) (-2081.841) * (-2072.317) (-2085.324) [-2066.627] (-2088.513) -- 0:02:02
569200 -- (-2074.859) [-2074.863] (-2076.823) (-2092.708) * [-2073.303] (-2081.221) (-2070.105) (-2085.257) -- 0:02:02
569300 -- [-2071.765] (-2075.061) (-2078.039) (-2072.979) * [-2070.630] (-2077.236) (-2074.896) (-2077.076) -- 0:02:02
569400 -- (-2070.325) [-2073.966] (-2079.354) (-2078.220) * [-2078.343] (-2083.655) (-2068.867) (-2084.080) -- 0:02:02
569500 -- (-2079.546) (-2074.113) [-2081.185] (-2078.850) * (-2068.288) (-2086.779) [-2066.383] (-2079.982) -- 0:02:02
569600 -- (-2082.268) [-2072.125] (-2077.495) (-2070.608) * (-2074.140) (-2081.169) [-2073.114] (-2096.519) -- 0:02:02
569700 -- (-2085.389) (-2073.057) (-2080.281) [-2070.410] * (-2080.463) (-2077.272) [-2073.122] (-2086.819) -- 0:02:02
569800 -- (-2081.109) (-2073.102) [-2076.748] (-2078.638) * (-2074.978) (-2075.509) [-2070.956] (-2081.290) -- 0:02:02
569900 -- (-2085.750) (-2081.213) (-2087.090) [-2076.135] * (-2078.844) (-2077.510) (-2082.859) [-2078.214] -- 0:02:02
570000 -- (-2081.675) (-2081.108) (-2088.053) [-2075.072] * (-2082.191) (-2077.116) (-2076.473) [-2078.899] -- 0:02:02
Average standard deviation of split frequencies: 0.006331
570100 -- (-2075.625) [-2075.837] (-2081.633) (-2081.815) * (-2085.166) (-2074.285) [-2072.198] (-2075.628) -- 0:02:02
570200 -- (-2079.812) (-2076.244) (-2076.766) [-2075.295] * (-2089.850) [-2073.451] (-2073.211) (-2077.245) -- 0:02:02
570300 -- (-2082.023) [-2074.867] (-2077.700) (-2074.095) * (-2080.397) [-2075.183] (-2073.034) (-2086.064) -- 0:02:02
570400 -- (-2077.920) [-2073.501] (-2073.073) (-2075.099) * (-2093.071) [-2072.386] (-2078.337) (-2085.846) -- 0:02:02
570500 -- (-2081.771) (-2075.931) [-2086.302] (-2075.431) * (-2081.833) [-2075.633] (-2074.142) (-2088.241) -- 0:02:01
570600 -- (-2091.776) (-2075.193) (-2082.452) [-2071.201] * [-2072.529] (-2085.022) (-2073.937) (-2090.294) -- 0:02:01
570700 -- (-2084.362) (-2095.429) (-2085.639) [-2071.630] * (-2079.581) (-2078.450) [-2073.892] (-2093.489) -- 0:02:01
570800 -- (-2081.662) (-2082.479) (-2087.372) [-2067.205] * (-2083.045) (-2082.025) [-2073.831] (-2087.940) -- 0:02:01
570900 -- (-2085.938) (-2074.958) (-2093.124) [-2072.195] * (-2080.733) [-2074.531] (-2075.107) (-2079.896) -- 0:02:01
571000 -- (-2076.166) [-2073.641] (-2082.752) (-2072.026) * (-2073.236) (-2074.213) [-2078.017] (-2079.276) -- 0:02:01
Average standard deviation of split frequencies: 0.006343
571100 -- (-2077.471) (-2076.145) (-2085.062) [-2073.852] * [-2074.265] (-2071.234) (-2088.473) (-2083.248) -- 0:02:01
571200 -- [-2071.733] (-2072.121) (-2083.660) (-2078.382) * (-2077.278) [-2071.063] (-2087.899) (-2090.182) -- 0:02:01
571300 -- (-2077.326) (-2079.012) (-2089.166) [-2073.873] * (-2076.486) (-2071.299) (-2082.617) [-2084.137] -- 0:02:01
571400 -- [-2072.190] (-2071.689) (-2085.200) (-2072.872) * [-2075.156] (-2077.281) (-2076.177) (-2092.484) -- 0:02:01
571500 -- (-2073.072) (-2070.265) (-2090.299) [-2074.880] * (-2077.448) [-2071.939] (-2084.183) (-2087.977) -- 0:02:01
571600 -- (-2077.972) [-2072.933] (-2086.619) (-2079.099) * (-2073.900) [-2077.543] (-2084.349) (-2088.465) -- 0:02:01
571700 -- (-2070.566) [-2068.077] (-2082.911) (-2082.447) * (-2081.589) (-2071.786) [-2081.109] (-2079.425) -- 0:02:01
571800 -- (-2070.184) [-2067.776] (-2083.267) (-2073.961) * [-2072.200] (-2071.500) (-2084.572) (-2080.975) -- 0:02:01
571900 -- (-2070.775) [-2069.711] (-2082.647) (-2070.525) * [-2072.241] (-2074.065) (-2088.802) (-2078.525) -- 0:02:01
572000 -- (-2072.611) [-2067.358] (-2078.234) (-2069.308) * (-2073.438) [-2075.681] (-2080.000) (-2081.845) -- 0:02:01
Average standard deviation of split frequencies: 0.006333
572100 -- (-2078.715) [-2074.630] (-2083.452) (-2078.253) * [-2072.907] (-2075.472) (-2082.665) (-2082.927) -- 0:02:01
572200 -- [-2076.676] (-2070.021) (-2078.733) (-2077.691) * (-2074.789) [-2069.747] (-2080.811) (-2078.941) -- 0:02:01
572300 -- (-2070.571) (-2076.212) (-2074.834) [-2070.188] * (-2076.987) [-2068.740] (-2082.778) (-2085.761) -- 0:02:01
572400 -- (-2074.307) (-2072.395) (-2084.056) [-2069.856] * (-2076.354) (-2071.930) [-2073.780] (-2085.553) -- 0:02:01
572500 -- [-2069.255] (-2077.330) (-2077.145) (-2074.666) * (-2073.621) (-2079.310) [-2070.741] (-2094.574) -- 0:02:01
572600 -- (-2069.739) (-2074.135) (-2077.578) [-2068.999] * (-2076.391) (-2074.051) [-2070.734] (-2076.898) -- 0:02:01
572700 -- (-2081.453) (-2075.064) (-2078.965) [-2072.970] * (-2076.223) (-2073.615) [-2069.390] (-2077.649) -- 0:02:01
572800 -- (-2073.883) [-2074.522] (-2079.731) (-2076.695) * (-2074.511) (-2078.026) [-2069.546] (-2083.863) -- 0:02:01
572900 -- (-2077.320) (-2079.354) [-2082.915] (-2077.475) * (-2074.043) (-2077.336) (-2081.837) [-2072.562] -- 0:02:01
573000 -- [-2080.062] (-2075.471) (-2080.600) (-2077.012) * (-2077.368) (-2076.236) (-2082.970) [-2075.053] -- 0:02:01
Average standard deviation of split frequencies: 0.006133
573100 -- (-2076.835) [-2072.335] (-2081.190) (-2076.136) * (-2076.149) (-2075.556) (-2080.269) [-2081.120] -- 0:02:01
573200 -- (-2082.944) (-2075.466) (-2077.817) [-2078.961] * (-2078.833) (-2072.395) [-2069.645] (-2082.124) -- 0:02:01
573300 -- (-2087.515) [-2072.083] (-2080.552) (-2071.011) * (-2080.916) (-2072.636) [-2067.602] (-2073.625) -- 0:02:01
573400 -- (-2077.290) (-2076.599) (-2081.619) [-2069.537] * (-2094.330) (-2072.798) [-2069.214] (-2085.513) -- 0:02:01
573500 -- (-2079.008) [-2068.489] (-2076.826) (-2083.260) * (-2083.105) (-2076.668) (-2079.330) [-2079.069] -- 0:02:01
573600 -- (-2082.097) (-2076.400) (-2078.748) [-2071.962] * (-2087.324) [-2080.793] (-2078.491) (-2083.269) -- 0:02:01
573700 -- (-2079.184) (-2074.112) (-2074.166) [-2067.678] * (-2077.524) [-2076.088] (-2080.236) (-2086.887) -- 0:02:01
573800 -- (-2068.207) [-2070.699] (-2083.611) (-2082.644) * (-2093.411) [-2073.494] (-2079.058) (-2086.621) -- 0:02:01
573900 -- (-2072.782) [-2068.682] (-2080.799) (-2076.706) * (-2079.138) (-2073.039) [-2079.608] (-2080.763) -- 0:02:01
574000 -- [-2069.959] (-2073.146) (-2080.509) (-2070.338) * (-2075.920) [-2074.007] (-2081.173) (-2080.507) -- 0:02:00
Average standard deviation of split frequencies: 0.006311
574100 -- [-2067.018] (-2076.406) (-2075.785) (-2070.445) * (-2076.466) (-2079.669) [-2080.763] (-2079.770) -- 0:02:00
574200 -- (-2071.069) [-2072.391] (-2078.740) (-2079.579) * [-2071.670] (-2084.246) (-2085.637) (-2093.847) -- 0:02:00
574300 -- (-2072.164) [-2069.739] (-2079.036) (-2078.519) * [-2075.352] (-2074.041) (-2080.466) (-2097.040) -- 0:02:00
574400 -- [-2074.397] (-2084.471) (-2077.027) (-2081.730) * (-2077.283) [-2073.821] (-2089.423) (-2086.818) -- 0:02:00
574500 -- (-2072.933) (-2078.400) (-2088.418) [-2075.453] * (-2081.094) [-2067.812] (-2086.845) (-2090.649) -- 0:02:00
574600 -- [-2068.516] (-2084.125) (-2078.037) (-2080.427) * (-2089.936) (-2071.691) (-2080.117) [-2077.919] -- 0:02:00
574700 -- [-2074.263] (-2079.191) (-2077.972) (-2079.019) * (-2087.296) [-2068.833] (-2075.402) (-2080.873) -- 0:02:00
574800 -- (-2073.175) [-2072.549] (-2073.493) (-2077.939) * (-2086.230) [-2072.791] (-2078.620) (-2095.042) -- 0:02:00
574900 -- (-2068.795) [-2070.843] (-2074.594) (-2087.926) * (-2089.720) (-2072.550) [-2072.576] (-2082.889) -- 0:02:00
575000 -- (-2071.176) (-2073.526) [-2081.653] (-2081.796) * (-2079.189) (-2073.205) (-2075.134) [-2076.410] -- 0:02:00
Average standard deviation of split frequencies: 0.006439
575100 -- (-2077.718) [-2070.388] (-2093.871) (-2076.776) * [-2075.897] (-2072.037) (-2085.774) (-2076.549) -- 0:02:00
575200 -- (-2075.854) [-2071.876] (-2088.031) (-2073.747) * (-2074.703) [-2070.706] (-2083.456) (-2080.500) -- 0:02:00
575300 -- [-2069.391] (-2075.750) (-2081.765) (-2073.438) * [-2073.473] (-2071.623) (-2079.439) (-2079.148) -- 0:02:00
575400 -- [-2069.389] (-2076.910) (-2086.651) (-2075.509) * [-2071.888] (-2073.490) (-2076.096) (-2079.897) -- 0:02:00
575500 -- [-2077.280] (-2078.573) (-2081.782) (-2069.091) * [-2071.904] (-2078.810) (-2077.374) (-2078.339) -- 0:02:00
575600 -- (-2077.992) (-2079.543) (-2081.567) [-2071.853] * (-2082.512) [-2074.023] (-2080.591) (-2075.094) -- 0:02:00
575700 -- (-2067.917) [-2074.499] (-2076.634) (-2080.149) * (-2079.620) (-2083.917) [-2070.997] (-2079.571) -- 0:02:00
575800 -- [-2070.519] (-2077.126) (-2087.097) (-2080.285) * (-2079.739) (-2079.033) [-2070.049] (-2076.162) -- 0:02:00
575900 -- (-2071.801) [-2072.334] (-2084.469) (-2073.307) * (-2075.135) (-2075.360) [-2072.788] (-2080.459) -- 0:02:00
576000 -- [-2070.944] (-2083.053) (-2081.622) (-2076.793) * (-2084.628) [-2077.399] (-2071.471) (-2082.352) -- 0:02:00
Average standard deviation of split frequencies: 0.006803
576100 -- [-2073.143] (-2082.999) (-2079.268) (-2071.051) * [-2075.822] (-2074.879) (-2072.605) (-2078.510) -- 0:02:00
576200 -- [-2078.043] (-2087.082) (-2080.578) (-2073.288) * (-2075.567) (-2077.195) [-2068.096] (-2076.595) -- 0:02:00
576300 -- (-2075.815) (-2081.757) (-2082.060) [-2071.523] * (-2078.166) (-2082.188) [-2071.905] (-2076.587) -- 0:02:00
576400 -- [-2068.648] (-2080.170) (-2079.887) (-2070.656) * (-2074.281) (-2078.089) [-2075.362] (-2082.470) -- 0:02:00
576500 -- [-2075.432] (-2083.106) (-2076.780) (-2077.264) * (-2073.183) (-2072.984) [-2069.792] (-2083.874) -- 0:02:00
576600 -- [-2071.326] (-2077.947) (-2085.359) (-2079.912) * (-2069.983) (-2082.059) [-2071.210] (-2081.681) -- 0:02:00
576700 -- (-2077.409) [-2072.942] (-2079.460) (-2075.168) * (-2071.171) (-2081.939) (-2073.062) [-2077.910] -- 0:02:00
576800 -- (-2085.003) [-2072.236] (-2081.596) (-2076.036) * [-2071.414] (-2081.936) (-2077.475) (-2084.096) -- 0:02:00
576900 -- (-2074.167) (-2078.741) (-2082.035) [-2074.747] * [-2075.336] (-2083.919) (-2081.649) (-2078.175) -- 0:02:00
577000 -- (-2069.322) (-2081.171) (-2080.920) [-2074.657] * (-2078.888) [-2081.369] (-2082.971) (-2077.790) -- 0:02:00
Average standard deviation of split frequencies: 0.006814
577100 -- [-2069.000] (-2087.286) (-2079.154) (-2084.791) * (-2073.051) (-2080.209) (-2081.285) [-2078.495] -- 0:02:00
577200 -- (-2076.851) (-2080.167) [-2076.007] (-2088.532) * [-2072.237] (-2074.983) (-2077.225) (-2079.157) -- 0:02:00
577300 -- [-2071.366] (-2079.999) (-2077.164) (-2080.944) * [-2078.252] (-2074.194) (-2074.739) (-2081.203) -- 0:02:00
577400 -- (-2074.738) (-2082.660) [-2076.458] (-2083.807) * (-2073.977) (-2078.015) [-2072.207] (-2083.903) -- 0:02:00
577500 -- [-2074.214] (-2075.595) (-2074.684) (-2075.815) * [-2072.349] (-2072.100) (-2069.817) (-2082.075) -- 0:01:59
577600 -- (-2081.214) (-2086.695) (-2075.939) [-2074.405] * (-2068.211) (-2077.446) (-2079.137) [-2075.545] -- 0:01:59
577700 -- (-2081.987) [-2076.749] (-2084.632) (-2075.936) * [-2069.760] (-2071.101) (-2088.196) (-2081.397) -- 0:01:59
577800 -- (-2080.873) (-2073.153) (-2086.706) [-2071.570] * [-2068.857] (-2075.379) (-2081.842) (-2079.048) -- 0:01:59
577900 -- [-2073.759] (-2077.281) (-2076.149) (-2071.059) * [-2068.758] (-2073.048) (-2079.486) (-2082.030) -- 0:01:59
578000 -- [-2073.816] (-2078.576) (-2080.670) (-2072.115) * (-2068.113) (-2071.240) (-2081.217) [-2073.577] -- 0:01:59
Average standard deviation of split frequencies: 0.006989
578100 -- [-2072.244] (-2085.624) (-2082.409) (-2073.097) * (-2072.972) (-2075.860) [-2080.982] (-2082.416) -- 0:01:59
578200 -- [-2070.024] (-2085.136) (-2083.103) (-2070.582) * [-2070.205] (-2073.146) (-2078.777) (-2090.356) -- 0:01:59
578300 -- (-2073.518) [-2077.222] (-2075.087) (-2073.015) * [-2066.340] (-2079.906) (-2077.342) (-2079.551) -- 0:01:59
578400 -- [-2073.710] (-2075.689) (-2071.649) (-2079.737) * (-2075.377) (-2081.381) [-2073.321] (-2089.325) -- 0:01:59
578500 -- (-2067.448) [-2082.177] (-2074.205) (-2069.805) * [-2076.442] (-2074.530) (-2073.195) (-2081.885) -- 0:01:59
578600 -- [-2071.877] (-2079.074) (-2076.619) (-2078.734) * (-2086.031) [-2070.316] (-2071.754) (-2092.335) -- 0:01:59
578700 -- (-2078.584) [-2075.973] (-2077.732) (-2082.625) * (-2080.598) (-2069.928) [-2073.865] (-2084.358) -- 0:01:59
578800 -- (-2082.251) (-2082.130) [-2072.161] (-2075.825) * (-2081.371) [-2072.288] (-2076.635) (-2093.741) -- 0:01:59
578900 -- (-2080.524) [-2075.088] (-2089.518) (-2074.120) * [-2080.028] (-2067.633) (-2078.531) (-2089.556) -- 0:01:59
579000 -- (-2083.438) [-2077.237] (-2085.668) (-2070.167) * [-2074.088] (-2079.146) (-2082.100) (-2097.142) -- 0:01:59
Average standard deviation of split frequencies: 0.007116
579100 -- (-2098.511) [-2069.896] (-2079.022) (-2070.810) * (-2074.512) [-2075.015] (-2077.752) (-2091.767) -- 0:01:59
579200 -- (-2088.812) (-2075.670) (-2076.491) [-2075.603] * [-2075.431] (-2079.546) (-2077.354) (-2096.952) -- 0:01:59
579300 -- (-2075.867) (-2073.936) (-2073.975) [-2075.411] * [-2074.428] (-2077.815) (-2076.091) (-2081.689) -- 0:01:59
579400 -- (-2074.248) (-2071.857) (-2079.021) [-2069.937] * [-2072.588] (-2071.687) (-2075.427) (-2078.650) -- 0:01:59
579500 -- [-2072.087] (-2073.358) (-2079.156) (-2071.143) * [-2074.672] (-2075.765) (-2070.663) (-2081.454) -- 0:01:59
579600 -- [-2070.738] (-2084.482) (-2080.152) (-2075.357) * (-2073.438) (-2074.327) (-2075.004) [-2071.937] -- 0:01:59
579700 -- (-2075.577) (-2078.968) [-2080.544] (-2072.870) * (-2078.276) (-2077.007) [-2075.694] (-2074.420) -- 0:01:59
579800 -- [-2070.467] (-2086.374) (-2083.252) (-2075.363) * (-2078.858) [-2072.848] (-2074.938) (-2070.004) -- 0:01:59
579900 -- (-2076.016) (-2091.113) (-2101.215) [-2070.602] * (-2090.713) [-2077.099] (-2075.670) (-2075.676) -- 0:01:59
580000 -- (-2080.882) (-2091.978) (-2098.322) [-2073.416] * (-2090.030) (-2069.705) [-2073.725] (-2085.226) -- 0:01:59
Average standard deviation of split frequencies: 0.006965
580100 -- (-2074.987) (-2078.282) (-2087.426) [-2070.982] * (-2084.825) [-2071.835] (-2076.583) (-2077.325) -- 0:01:59
580200 -- (-2075.913) (-2084.160) (-2083.640) [-2074.859] * [-2077.530] (-2071.253) (-2075.055) (-2076.511) -- 0:01:59
580300 -- (-2069.642) (-2082.051) (-2082.130) [-2073.295] * (-2072.389) (-2074.538) [-2069.746] (-2076.299) -- 0:01:59
580400 -- [-2071.803] (-2079.667) (-2089.822) (-2072.458) * (-2074.453) (-2078.191) (-2081.484) [-2069.558] -- 0:01:59
580500 -- [-2068.780] (-2080.347) (-2082.932) (-2073.589) * [-2070.722] (-2086.406) (-2075.123) (-2071.041) -- 0:01:59
580600 -- [-2072.069] (-2081.518) (-2083.850) (-2085.135) * (-2070.903) (-2079.047) (-2075.431) [-2071.155] -- 0:01:59
580700 -- (-2071.223) [-2081.457] (-2090.717) (-2081.133) * (-2068.541) (-2083.908) (-2074.261) [-2071.232] -- 0:01:59
580800 -- (-2072.971) (-2085.057) (-2085.608) [-2074.199] * [-2070.282] (-2088.263) (-2083.451) (-2075.991) -- 0:01:59
580900 -- [-2077.633] (-2077.334) (-2084.556) (-2073.422) * [-2067.298] (-2088.420) (-2081.079) (-2078.756) -- 0:01:59
581000 -- [-2080.266] (-2082.023) (-2087.924) (-2073.681) * (-2071.514) (-2090.428) (-2080.675) [-2067.980] -- 0:01:58
Average standard deviation of split frequencies: 0.006999
581100 -- (-2077.576) (-2077.338) (-2088.903) [-2071.819] * (-2076.807) (-2085.393) (-2074.465) [-2074.066] -- 0:01:58
581200 -- [-2069.728] (-2077.983) (-2080.230) (-2074.111) * [-2070.233] (-2087.873) (-2080.965) (-2079.969) -- 0:01:58
581300 -- [-2069.582] (-2081.495) (-2078.825) (-2072.927) * (-2076.556) (-2089.499) (-2073.363) [-2075.201] -- 0:01:58
581400 -- (-2073.552) (-2077.060) (-2082.193) [-2073.367] * [-2073.866] (-2093.545) (-2075.691) (-2079.556) -- 0:01:58
581500 -- (-2075.778) [-2075.322] (-2085.975) (-2069.255) * [-2071.438] (-2094.894) (-2075.455) (-2075.285) -- 0:01:58
581600 -- (-2077.840) (-2071.106) (-2082.912) [-2070.393] * (-2072.134) (-2089.919) [-2073.664] (-2083.318) -- 0:01:58
581700 -- (-2077.417) (-2069.975) (-2078.917) [-2072.358] * [-2073.832] (-2086.409) (-2075.378) (-2078.288) -- 0:01:58
581800 -- (-2070.591) [-2070.234] (-2082.244) (-2077.557) * (-2078.035) (-2087.550) (-2073.077) [-2072.583] -- 0:01:58
581900 -- (-2077.987) [-2075.198] (-2082.019) (-2073.542) * (-2077.364) (-2083.201) [-2074.415] (-2080.770) -- 0:01:58
582000 -- [-2076.955] (-2069.975) (-2075.812) (-2073.705) * (-2071.996) (-2078.380) [-2069.834] (-2083.922) -- 0:01:58
Average standard deviation of split frequencies: 0.007080
582100 -- (-2077.346) (-2071.771) (-2078.125) [-2069.320] * (-2072.080) (-2082.883) [-2071.461] (-2080.859) -- 0:01:58
582200 -- (-2075.210) (-2071.129) [-2076.222] (-2075.901) * (-2073.418) (-2081.000) [-2071.355] (-2080.087) -- 0:01:58
582300 -- (-2080.103) (-2073.159) [-2072.995] (-2070.759) * (-2079.009) [-2081.432] (-2073.537) (-2080.602) -- 0:01:58
582400 -- (-2078.431) (-2074.884) (-2075.261) [-2079.322] * [-2071.883] (-2077.154) (-2073.960) (-2089.608) -- 0:01:58
582500 -- (-2079.656) (-2073.678) (-2072.098) [-2071.349] * [-2073.999] (-2078.883) (-2074.841) (-2093.548) -- 0:01:58
582600 -- (-2078.663) [-2072.373] (-2073.057) (-2067.350) * (-2069.038) [-2075.537] (-2076.975) (-2081.023) -- 0:01:58
582700 -- (-2076.263) (-2076.512) (-2078.835) [-2070.322] * [-2070.507] (-2083.258) (-2074.814) (-2091.486) -- 0:01:58
582800 -- (-2073.708) [-2072.180] (-2073.714) (-2069.468) * [-2070.196] (-2079.320) (-2090.468) (-2087.264) -- 0:01:58
582900 -- (-2073.879) [-2072.162] (-2076.044) (-2076.969) * [-2069.590] (-2084.107) (-2076.687) (-2080.900) -- 0:01:58
583000 -- [-2073.400] (-2069.703) (-2089.533) (-2077.900) * (-2081.755) (-2077.130) [-2071.032] (-2081.158) -- 0:01:58
Average standard deviation of split frequencies: 0.007321
583100 -- (-2072.859) [-2071.677] (-2081.050) (-2079.348) * (-2079.728) (-2076.099) (-2080.645) [-2075.679] -- 0:01:58
583200 -- [-2075.322] (-2075.665) (-2080.683) (-2077.941) * (-2078.977) (-2086.498) [-2074.753] (-2080.327) -- 0:01:58
583300 -- (-2071.239) (-2082.437) [-2075.450] (-2079.416) * (-2088.922) (-2095.650) (-2071.983) [-2075.129] -- 0:01:58
583400 -- [-2072.864] (-2076.556) (-2073.458) (-2079.173) * (-2074.520) (-2086.162) (-2071.854) [-2076.584] -- 0:01:58
583500 -- [-2075.436] (-2075.659) (-2071.325) (-2083.073) * [-2079.536] (-2080.328) (-2079.019) (-2077.255) -- 0:01:58
583600 -- (-2078.944) (-2083.418) [-2072.926] (-2090.856) * (-2081.680) (-2079.117) [-2069.862] (-2082.717) -- 0:01:58
583700 -- [-2072.418] (-2081.760) (-2072.203) (-2083.445) * (-2074.250) (-2086.043) [-2070.047] (-2082.219) -- 0:01:58
583800 -- (-2073.896) (-2078.634) [-2072.554] (-2085.529) * [-2074.316] (-2081.719) (-2072.200) (-2084.900) -- 0:01:58
583900 -- (-2071.924) (-2084.063) [-2074.891] (-2083.305) * (-2070.407) (-2078.869) [-2070.321] (-2089.545) -- 0:01:58
584000 -- [-2073.767] (-2076.824) (-2072.183) (-2083.446) * [-2073.042] (-2085.584) (-2073.354) (-2086.983) -- 0:01:58
Average standard deviation of split frequencies: 0.007125
584100 -- (-2069.761) [-2080.169] (-2071.262) (-2081.158) * (-2075.142) (-2082.892) [-2071.442] (-2092.786) -- 0:01:58
584200 -- (-2073.956) [-2076.548] (-2072.827) (-2082.989) * (-2071.187) (-2081.457) [-2071.529] (-2080.894) -- 0:01:58
584300 -- (-2070.630) (-2078.604) [-2084.642] (-2079.389) * [-2069.102] (-2087.029) (-2080.271) (-2088.030) -- 0:01:58
584400 -- (-2076.211) (-2074.477) (-2085.340) [-2079.151] * [-2068.735] (-2090.676) (-2080.582) (-2083.973) -- 0:01:58
584500 -- [-2081.122] (-2075.164) (-2090.338) (-2082.392) * (-2079.823) (-2089.934) [-2071.501] (-2088.856) -- 0:01:58
584600 -- (-2069.461) [-2071.474] (-2086.539) (-2085.474) * (-2084.177) (-2082.347) (-2073.075) [-2077.533] -- 0:01:57
584700 -- [-2070.655] (-2079.086) (-2090.709) (-2077.860) * (-2091.598) (-2083.356) (-2083.102) [-2072.183] -- 0:01:57
584800 -- [-2072.699] (-2090.220) (-2086.769) (-2094.051) * (-2087.523) (-2092.012) (-2079.268) [-2075.151] -- 0:01:57
584900 -- (-2081.950) [-2078.209] (-2079.565) (-2081.513) * (-2071.368) (-2086.677) [-2077.673] (-2076.932) -- 0:01:57
585000 -- (-2085.404) [-2072.373] (-2081.887) (-2077.941) * (-2072.524) (-2087.199) [-2077.323] (-2082.535) -- 0:01:57
Average standard deviation of split frequencies: 0.006882
585100 -- (-2084.322) [-2068.399] (-2081.770) (-2086.848) * (-2074.875) (-2087.968) [-2073.412] (-2076.887) -- 0:01:57
585200 -- [-2074.399] (-2067.819) (-2080.605) (-2085.354) * (-2074.500) (-2088.096) [-2071.662] (-2078.522) -- 0:01:57
585300 -- (-2072.381) [-2068.635] (-2078.213) (-2082.278) * (-2078.499) (-2083.108) [-2075.522] (-2073.246) -- 0:01:57
585400 -- (-2082.780) [-2069.769] (-2075.315) (-2081.271) * (-2082.793) (-2084.145) [-2070.652] (-2076.805) -- 0:01:57
585500 -- (-2082.446) [-2079.072] (-2088.996) (-2080.347) * (-2084.440) (-2082.113) [-2074.756] (-2073.575) -- 0:01:57
585600 -- (-2075.266) [-2073.999] (-2086.136) (-2087.416) * (-2080.795) (-2084.845) [-2066.513] (-2077.396) -- 0:01:57
585700 -- (-2074.680) (-2079.111) [-2071.692] (-2096.932) * [-2078.651] (-2078.520) (-2073.670) (-2074.170) -- 0:01:57
585800 -- (-2074.452) (-2083.809) [-2070.588] (-2082.579) * (-2076.960) [-2072.749] (-2074.763) (-2078.244) -- 0:01:57
585900 -- (-2069.976) (-2083.113) [-2071.188] (-2074.958) * (-2079.166) (-2074.350) [-2077.555] (-2072.921) -- 0:01:57
586000 -- [-2071.254] (-2081.218) (-2079.812) (-2078.713) * (-2081.540) (-2083.591) (-2075.268) [-2079.918] -- 0:01:57
Average standard deviation of split frequencies: 0.006779
586100 -- (-2086.010) (-2083.224) (-2077.485) [-2085.298] * (-2077.810) (-2085.883) (-2072.635) [-2072.115] -- 0:01:57
586200 -- (-2081.645) (-2080.015) [-2073.987] (-2084.473) * (-2080.633) [-2073.957] (-2081.570) (-2084.226) -- 0:01:57
586300 -- (-2085.513) (-2075.088) [-2070.596] (-2079.627) * (-2076.061) (-2078.736) [-2076.779] (-2082.281) -- 0:01:57
586400 -- (-2084.929) (-2077.280) (-2077.477) [-2078.704] * [-2077.052] (-2078.478) (-2081.593) (-2079.171) -- 0:01:57
586500 -- (-2082.425) (-2076.606) [-2076.465] (-2082.503) * [-2074.623] (-2075.876) (-2084.183) (-2083.122) -- 0:01:57
586600 -- (-2078.794) (-2077.734) [-2073.437] (-2092.655) * (-2077.597) (-2077.503) [-2075.036] (-2087.476) -- 0:01:57
586700 -- (-2088.000) [-2078.220] (-2076.458) (-2099.005) * [-2074.791] (-2083.535) (-2075.369) (-2077.968) -- 0:01:57
586800 -- (-2081.071) [-2086.030] (-2072.312) (-2088.727) * (-2085.388) (-2081.788) [-2069.223] (-2071.906) -- 0:01:57
586900 -- [-2080.478] (-2081.857) (-2085.466) (-2084.590) * [-2075.557] (-2080.595) (-2075.033) (-2072.070) -- 0:01:57
587000 -- (-2083.381) (-2080.805) [-2074.470] (-2084.124) * (-2078.725) (-2090.210) (-2083.176) [-2075.512] -- 0:01:57
Average standard deviation of split frequencies: 0.006881
587100 -- (-2084.912) [-2081.223] (-2082.104) (-2083.177) * [-2073.477] (-2084.037) (-2078.043) (-2071.916) -- 0:01:57
587200 -- (-2081.798) (-2084.195) (-2075.298) [-2082.747] * (-2077.979) (-2083.121) (-2083.048) [-2072.362] -- 0:01:57
587300 -- (-2081.946) [-2079.495] (-2085.049) (-2081.131) * [-2078.940] (-2081.408) (-2082.868) (-2074.326) -- 0:01:57
587400 -- (-2076.456) (-2087.337) (-2090.174) [-2077.255] * [-2074.443] (-2078.131) (-2088.398) (-2077.720) -- 0:01:57
587500 -- (-2074.803) (-2083.748) (-2085.963) [-2078.868] * (-2074.987) (-2084.510) (-2086.784) [-2073.804] -- 0:01:57
587600 -- [-2082.012] (-2083.716) (-2075.369) (-2083.332) * [-2079.367] (-2079.973) (-2084.006) (-2076.814) -- 0:01:57
587700 -- (-2077.258) (-2087.857) [-2074.542] (-2087.146) * (-2080.609) (-2080.591) (-2079.566) [-2071.590] -- 0:01:57
587800 -- (-2071.772) (-2079.049) [-2075.537] (-2088.620) * (-2083.219) (-2077.767) (-2073.521) [-2067.638] -- 0:01:57
587900 -- (-2072.228) (-2090.539) [-2075.769] (-2089.071) * (-2079.410) (-2078.763) (-2073.916) [-2070.280] -- 0:01:57
588000 -- [-2070.135] (-2087.129) (-2075.287) (-2090.741) * (-2086.435) (-2076.840) [-2073.355] (-2076.710) -- 0:01:57
Average standard deviation of split frequencies: 0.006618
588100 -- [-2074.243] (-2077.975) (-2071.891) (-2087.692) * (-2094.945) (-2085.086) [-2074.722] (-2084.072) -- 0:01:56
588200 -- [-2073.603] (-2078.517) (-2069.533) (-2081.122) * (-2085.043) (-2081.397) [-2066.760] (-2083.841) -- 0:01:56
588300 -- (-2081.031) (-2080.395) [-2067.364] (-2082.914) * (-2080.240) (-2088.614) (-2068.991) [-2077.934] -- 0:01:56
588400 -- (-2074.044) (-2075.678) [-2068.650] (-2084.367) * (-2076.433) [-2078.144] (-2073.463) (-2081.356) -- 0:01:56
588500 -- (-2069.764) (-2078.155) [-2076.055] (-2078.339) * (-2076.829) (-2077.704) (-2080.643) [-2078.765] -- 0:01:56
588600 -- (-2069.875) (-2082.167) [-2077.371] (-2076.590) * (-2080.158) (-2080.554) [-2072.507] (-2083.335) -- 0:01:56
588700 -- (-2077.617) (-2080.189) [-2076.681] (-2075.903) * (-2078.812) (-2083.364) [-2071.761] (-2074.141) -- 0:01:56
588800 -- (-2075.889) (-2075.718) (-2076.117) [-2078.675] * (-2092.646) (-2085.677) (-2073.322) [-2072.257] -- 0:01:56
588900 -- (-2077.723) [-2072.873] (-2074.336) (-2080.876) * (-2081.489) (-2080.189) (-2074.572) [-2072.951] -- 0:01:56
589000 -- [-2070.980] (-2077.406) (-2077.375) (-2076.675) * (-2091.878) [-2076.717] (-2070.551) (-2080.726) -- 0:01:56
Average standard deviation of split frequencies: 0.006629
589100 -- (-2076.185) (-2075.211) (-2080.827) [-2075.198] * (-2082.546) (-2073.848) (-2070.226) [-2075.774] -- 0:01:56
589200 -- (-2074.713) (-2077.815) (-2079.874) [-2079.694] * (-2080.727) (-2077.423) [-2074.688] (-2076.026) -- 0:01:56
589300 -- [-2081.890] (-2081.073) (-2080.438) (-2080.585) * (-2089.809) (-2078.881) [-2075.289] (-2078.744) -- 0:01:56
589400 -- (-2081.195) (-2079.097) (-2076.747) [-2078.024] * (-2080.552) (-2082.658) [-2068.898] (-2074.613) -- 0:01:56
589500 -- [-2069.878] (-2077.688) (-2077.577) (-2078.658) * (-2089.292) (-2084.173) [-2071.841] (-2076.275) -- 0:01:56
589600 -- (-2069.905) (-2094.004) [-2068.503] (-2080.722) * (-2093.381) (-2078.143) (-2073.871) [-2079.427] -- 0:01:56
589700 -- [-2073.096] (-2083.103) (-2072.668) (-2082.385) * (-2080.694) (-2085.279) [-2070.024] (-2073.826) -- 0:01:56
589800 -- (-2067.749) [-2078.656] (-2075.781) (-2086.059) * (-2089.877) (-2084.199) [-2073.780] (-2073.842) -- 0:01:56
589900 -- (-2081.583) (-2080.358) [-2073.204] (-2086.144) * (-2083.775) (-2084.650) [-2071.803] (-2075.305) -- 0:01:56
590000 -- (-2074.475) (-2088.201) [-2078.781] (-2074.442) * (-2080.670) (-2093.202) [-2070.960] (-2072.816) -- 0:01:56
Average standard deviation of split frequencies: 0.006756
590100 -- (-2077.663) (-2086.891) (-2075.802) [-2073.181] * (-2077.940) (-2087.066) (-2078.445) [-2067.523] -- 0:01:56
590200 -- (-2073.947) (-2087.603) [-2076.565] (-2079.624) * (-2071.897) (-2083.004) (-2078.314) [-2075.597] -- 0:01:56
590300 -- [-2073.965] (-2091.382) (-2084.666) (-2083.791) * [-2073.470] (-2083.749) (-2089.497) (-2074.528) -- 0:01:56
590400 -- [-2071.114] (-2083.034) (-2074.055) (-2081.513) * [-2073.991] (-2085.191) (-2074.105) (-2075.186) -- 0:01:56
590500 -- [-2071.836] (-2080.694) (-2077.668) (-2078.370) * (-2082.369) (-2092.982) [-2073.510] (-2076.782) -- 0:01:56
590600 -- (-2073.434) (-2077.016) [-2072.378] (-2077.682) * (-2077.784) (-2089.176) (-2074.053) [-2073.340] -- 0:01:56
590700 -- (-2072.763) (-2076.018) [-2072.347] (-2082.254) * (-2077.006) (-2096.030) (-2080.799) [-2072.008] -- 0:01:56
590800 -- [-2077.782] (-2076.064) (-2075.853) (-2085.333) * (-2082.256) (-2092.501) [-2076.209] (-2074.664) -- 0:01:56
590900 -- (-2076.076) [-2077.877] (-2075.970) (-2098.441) * [-2075.252] (-2092.682) (-2078.204) (-2072.692) -- 0:01:56
591000 -- (-2076.311) (-2072.782) (-2080.941) [-2077.054] * (-2074.592) (-2077.080) [-2071.771] (-2068.480) -- 0:01:56
Average standard deviation of split frequencies: 0.006835
591100 -- (-2081.423) (-2074.536) [-2070.506] (-2087.217) * (-2083.595) (-2078.514) (-2074.086) [-2074.251] -- 0:01:56
591200 -- [-2079.341] (-2083.035) (-2076.608) (-2084.637) * [-2076.073] (-2081.170) (-2082.355) (-2076.271) -- 0:01:56
591300 -- (-2079.644) (-2078.019) [-2071.430] (-2078.115) * (-2071.131) (-2088.817) [-2074.104] (-2077.390) -- 0:01:56
591400 -- (-2083.224) (-2078.656) [-2071.353] (-2085.360) * (-2073.102) (-2088.654) (-2078.130) [-2072.391] -- 0:01:56
591500 -- (-2078.680) (-2074.692) [-2074.774] (-2085.132) * (-2072.080) (-2088.454) (-2088.634) [-2069.140] -- 0:01:56
591600 -- (-2081.631) (-2075.653) [-2068.891] (-2079.559) * [-2069.795] (-2084.658) (-2077.276) (-2069.759) -- 0:01:55
591700 -- (-2077.970) (-2080.619) (-2079.467) [-2077.488] * (-2075.337) (-2085.539) (-2077.606) [-2068.959] -- 0:01:55
591800 -- (-2077.388) (-2080.530) [-2073.622] (-2081.186) * (-2078.533) [-2073.709] (-2081.450) (-2076.809) -- 0:01:55
591900 -- (-2086.085) (-2076.559) [-2069.436] (-2077.814) * (-2077.421) (-2081.850) [-2075.616] (-2076.455) -- 0:01:55
592000 -- (-2077.484) (-2076.849) [-2071.769] (-2077.313) * (-2078.459) (-2086.391) (-2077.863) [-2072.318] -- 0:01:55
Average standard deviation of split frequencies: 0.006756
592100 -- (-2081.085) (-2074.954) (-2065.561) [-2067.792] * [-2078.068] (-2082.396) (-2082.234) (-2071.264) -- 0:01:55
592200 -- (-2076.729) [-2072.567] (-2074.067) (-2069.821) * (-2085.245) [-2077.872] (-2079.731) (-2078.640) -- 0:01:55
592300 -- (-2084.548) (-2075.889) (-2075.278) [-2071.707] * (-2083.301) (-2082.258) (-2079.621) [-2071.722] -- 0:01:55
592400 -- (-2085.180) (-2080.201) [-2076.280] (-2072.415) * (-2085.781) (-2083.921) (-2085.920) [-2077.886] -- 0:01:55
592500 -- (-2087.690) (-2072.410) (-2076.571) [-2068.483] * (-2079.622) (-2084.638) (-2074.973) [-2070.373] -- 0:01:55
592600 -- (-2088.570) (-2073.317) [-2069.452] (-2075.019) * (-2077.811) [-2080.064] (-2077.924) (-2079.430) -- 0:01:55
592700 -- (-2084.443) [-2073.999] (-2073.685) (-2086.983) * (-2080.138) (-2078.324) (-2080.498) [-2070.400] -- 0:01:55
592800 -- (-2090.609) [-2074.999] (-2073.324) (-2076.551) * (-2076.947) (-2084.181) (-2077.040) [-2072.206] -- 0:01:55
592900 -- (-2075.740) (-2079.360) [-2070.205] (-2078.480) * (-2081.602) (-2082.421) (-2079.736) [-2071.855] -- 0:01:55
593000 -- (-2076.277) [-2073.915] (-2072.286) (-2081.389) * (-2077.927) (-2082.451) (-2073.408) [-2073.288] -- 0:01:55
Average standard deviation of split frequencies: 0.006857
593100 -- (-2077.492) (-2084.529) [-2068.764] (-2081.541) * (-2074.547) (-2083.541) (-2073.044) [-2073.286] -- 0:01:55
593200 -- (-2079.278) (-2087.615) (-2073.213) [-2075.902] * [-2074.662] (-2082.709) (-2076.328) (-2092.867) -- 0:01:55
593300 -- (-2084.626) (-2087.856) [-2071.449] (-2079.219) * [-2080.797] (-2083.361) (-2079.747) (-2083.750) -- 0:01:55
593400 -- [-2075.437] (-2083.884) (-2076.121) (-2075.842) * [-2076.228] (-2080.703) (-2075.132) (-2083.095) -- 0:01:55
593500 -- (-2080.902) (-2079.370) [-2072.811] (-2080.264) * (-2073.316) (-2092.576) (-2077.834) [-2072.405] -- 0:01:55
593600 -- (-2082.458) (-2077.949) [-2074.161] (-2072.981) * (-2091.019) (-2082.459) [-2074.713] (-2080.191) -- 0:01:55
593700 -- (-2084.847) (-2080.000) [-2070.937] (-2079.290) * (-2074.290) [-2080.439] (-2081.259) (-2073.976) -- 0:01:55
593800 -- [-2075.657] (-2082.375) (-2079.988) (-2076.210) * (-2078.751) (-2085.892) (-2073.967) [-2083.732] -- 0:01:55
593900 -- (-2078.584) (-2081.206) (-2084.201) [-2075.754] * [-2072.178] (-2081.567) (-2084.244) (-2078.748) -- 0:01:55
594000 -- (-2079.140) (-2080.480) (-2087.382) [-2070.433] * [-2074.543] (-2080.124) (-2080.642) (-2080.067) -- 0:01:55
Average standard deviation of split frequencies: 0.006597
594100 -- (-2084.018) (-2084.493) [-2070.870] (-2068.873) * (-2073.848) (-2078.999) [-2073.918] (-2080.500) -- 0:01:55
594200 -- (-2085.431) (-2095.895) [-2069.343] (-2077.163) * [-2072.396] (-2084.861) (-2094.107) (-2070.883) -- 0:01:55
594300 -- (-2082.533) (-2079.675) [-2072.396] (-2075.451) * (-2074.189) (-2088.828) (-2079.187) [-2074.820] -- 0:01:55
594400 -- (-2083.806) (-2078.425) [-2075.473] (-2072.129) * (-2076.007) (-2081.689) (-2076.468) [-2072.006] -- 0:01:55
594500 -- (-2084.918) [-2076.677] (-2077.393) (-2082.049) * (-2070.710) (-2077.551) (-2084.300) [-2068.285] -- 0:01:55
594600 -- [-2081.205] (-2084.647) (-2077.347) (-2079.047) * [-2077.656] (-2076.687) (-2089.972) (-2070.024) -- 0:01:55
594700 -- (-2075.519) [-2085.268] (-2075.550) (-2071.080) * (-2069.123) (-2077.686) (-2089.571) [-2070.677] -- 0:01:55
594800 -- (-2081.583) (-2083.237) [-2068.718] (-2076.087) * [-2068.908] (-2080.686) (-2089.430) (-2068.737) -- 0:01:55
594900 -- (-2081.065) (-2087.050) (-2071.095) [-2080.484] * (-2069.837) [-2079.110] (-2081.978) (-2071.377) -- 0:01:55
595000 -- (-2086.946) (-2100.392) (-2076.576) [-2084.969] * [-2068.459] (-2083.078) (-2079.020) (-2072.338) -- 0:01:55
Average standard deviation of split frequencies: 0.006721
595100 -- [-2073.261] (-2095.295) (-2071.811) (-2087.579) * [-2072.195] (-2094.312) (-2078.868) (-2075.052) -- 0:01:54
595200 -- (-2077.588) (-2081.255) (-2070.006) [-2080.468] * (-2072.078) (-2099.652) (-2087.375) [-2072.192] -- 0:01:54
595300 -- (-2074.743) (-2081.556) [-2069.437] (-2082.268) * (-2078.630) (-2091.371) (-2073.872) [-2067.579] -- 0:01:54
595400 -- (-2078.539) (-2074.292) [-2071.701] (-2086.259) * (-2074.048) (-2099.413) (-2080.334) [-2070.809] -- 0:01:54
595500 -- (-2087.660) [-2077.227] (-2069.916) (-2085.170) * (-2078.524) (-2090.228) (-2088.578) [-2073.636] -- 0:01:54
595600 -- (-2093.754) [-2076.431] (-2070.448) (-2088.066) * (-2076.777) (-2096.440) [-2072.333] (-2076.069) -- 0:01:54
595700 -- (-2082.546) [-2077.633] (-2076.405) (-2085.390) * [-2078.161] (-2090.728) (-2076.763) (-2079.190) -- 0:01:54
595800 -- (-2083.173) [-2075.994] (-2077.337) (-2077.419) * (-2081.526) (-2085.812) [-2087.528] (-2077.461) -- 0:01:54
595900 -- (-2081.874) (-2072.866) (-2079.917) [-2076.408] * (-2076.768) (-2084.986) (-2076.149) [-2076.189] -- 0:01:54
596000 -- (-2085.098) (-2091.320) (-2078.643) [-2071.837] * (-2076.427) (-2088.949) [-2078.655] (-2087.192) -- 0:01:54
Average standard deviation of split frequencies: 0.006665
596100 -- (-2083.948) (-2084.206) (-2073.960) [-2071.867] * [-2069.317] (-2081.384) (-2078.703) (-2078.409) -- 0:01:54
596200 -- [-2079.455] (-2091.537) (-2078.385) (-2086.242) * (-2072.252) (-2089.005) (-2078.632) [-2074.475] -- 0:01:54
596300 -- (-2079.678) (-2090.398) [-2078.144] (-2084.320) * [-2072.556] (-2079.076) (-2077.964) (-2078.652) -- 0:01:54
596400 -- (-2085.467) (-2094.778) (-2075.946) [-2072.851] * [-2070.281] (-2083.203) (-2077.819) (-2082.464) -- 0:01:54
596500 -- (-2078.554) (-2093.285) [-2070.829] (-2076.053) * (-2071.577) (-2085.849) (-2082.076) [-2069.723] -- 0:01:54
596600 -- (-2080.049) (-2088.795) [-2082.292] (-2074.821) * (-2071.133) [-2076.686] (-2076.931) (-2069.385) -- 0:01:54
596700 -- (-2080.354) (-2081.255) [-2070.749] (-2071.430) * (-2082.300) (-2075.410) (-2078.460) [-2073.876] -- 0:01:54
596800 -- (-2088.831) (-2081.261) (-2071.053) [-2071.299] * (-2081.047) (-2082.358) (-2084.521) [-2073.232] -- 0:01:54
596900 -- (-2088.953) (-2084.083) [-2069.569] (-2078.041) * [-2077.118] (-2073.223) (-2078.450) (-2081.686) -- 0:01:54
597000 -- (-2088.801) (-2075.950) (-2071.794) [-2074.924] * (-2076.774) [-2074.275] (-2081.148) (-2072.333) -- 0:01:54
Average standard deviation of split frequencies: 0.006743
597100 -- (-2084.210) [-2075.614] (-2081.929) (-2076.184) * (-2070.187) (-2077.984) (-2080.570) [-2067.155] -- 0:01:54
597200 -- (-2082.135) (-2082.094) (-2078.603) [-2071.165] * (-2078.026) (-2081.428) (-2076.944) [-2070.220] -- 0:01:54
597300 -- (-2087.930) (-2082.488) [-2084.630] (-2086.980) * [-2073.069] (-2088.385) (-2077.578) (-2068.935) -- 0:01:54
597400 -- (-2083.086) [-2078.678] (-2080.512) (-2080.388) * (-2077.515) (-2091.014) [-2076.968] (-2068.695) -- 0:01:54
597500 -- (-2087.490) [-2073.809] (-2076.352) (-2092.211) * (-2088.024) (-2082.858) (-2077.531) [-2072.308] -- 0:01:54
597600 -- (-2081.787) (-2075.659) [-2072.693] (-2079.478) * (-2083.806) (-2082.282) (-2077.262) [-2073.854] -- 0:01:54
597700 -- (-2081.768) (-2084.925) (-2081.057) [-2074.764] * [-2077.605] (-2085.678) (-2078.801) (-2069.356) -- 0:01:54
597800 -- (-2078.908) (-2082.192) [-2079.639] (-2082.687) * (-2078.660) (-2091.191) (-2086.951) [-2070.085] -- 0:01:54
597900 -- (-2077.637) (-2079.793) [-2071.044] (-2080.325) * (-2073.316) (-2085.082) (-2081.062) [-2074.951] -- 0:01:54
598000 -- [-2076.609] (-2082.649) (-2070.073) (-2078.721) * (-2077.517) [-2075.358] (-2077.488) (-2075.283) -- 0:01:54
Average standard deviation of split frequencies: 0.006688
598100 -- (-2085.321) (-2087.244) [-2069.084] (-2073.085) * (-2084.856) [-2074.744] (-2074.296) (-2078.577) -- 0:01:54
598200 -- (-2079.091) (-2082.102) [-2074.374] (-2069.902) * (-2080.146) (-2078.416) (-2079.662) [-2072.762] -- 0:01:54
598300 -- (-2075.651) (-2087.318) (-2080.037) [-2075.966] * [-2075.308] (-2080.059) (-2078.637) (-2076.256) -- 0:01:54
598400 -- (-2072.448) (-2079.475) (-2083.828) [-2068.793] * (-2081.370) (-2085.210) [-2080.988] (-2078.006) -- 0:01:54
598500 -- [-2072.494] (-2085.647) (-2077.280) (-2079.905) * (-2078.043) (-2080.369) [-2078.616] (-2075.689) -- 0:01:54
598600 -- [-2075.574] (-2091.787) (-2082.782) (-2075.485) * (-2079.047) (-2084.574) (-2079.196) [-2072.216] -- 0:01:53
598700 -- (-2078.111) (-2088.786) [-2082.773] (-2082.277) * [-2070.387] (-2079.746) (-2079.601) (-2077.958) -- 0:01:53
598800 -- (-2084.847) (-2079.117) (-2089.628) [-2077.769] * (-2077.652) (-2082.070) (-2077.093) [-2068.772] -- 0:01:53
598900 -- (-2083.808) (-2094.142) (-2073.494) [-2076.249] * (-2073.897) (-2078.155) (-2074.997) [-2070.192] -- 0:01:53
599000 -- (-2092.057) (-2083.196) (-2076.827) [-2078.713] * (-2080.916) (-2076.592) (-2076.029) [-2069.499] -- 0:01:53
Average standard deviation of split frequencies: 0.006721
599100 -- (-2093.224) (-2087.555) [-2075.343] (-2073.298) * [-2073.129] (-2079.204) (-2085.549) (-2075.472) -- 0:01:53
599200 -- (-2089.974) (-2083.278) (-2085.667) [-2074.038] * [-2080.973] (-2080.613) (-2078.637) (-2073.281) -- 0:01:53
599300 -- (-2082.787) (-2083.871) (-2078.041) [-2070.964] * (-2078.500) (-2077.803) [-2076.268] (-2072.803) -- 0:01:53
599400 -- (-2085.987) (-2082.069) [-2083.883] (-2072.553) * (-2081.436) [-2071.552] (-2080.423) (-2090.696) -- 0:01:53
599500 -- (-2079.371) [-2080.661] (-2085.335) (-2075.142) * (-2075.083) (-2081.009) [-2076.162] (-2083.106) -- 0:01:53
599600 -- [-2073.672] (-2083.076) (-2085.222) (-2077.300) * (-2078.358) (-2085.938) [-2075.763] (-2077.265) -- 0:01:53
599700 -- [-2077.223] (-2100.092) (-2089.052) (-2072.933) * (-2074.947) (-2083.904) [-2073.116] (-2073.136) -- 0:01:53
599800 -- [-2073.829] (-2103.605) (-2079.105) (-2071.874) * (-2077.221) (-2079.687) [-2075.219] (-2081.302) -- 0:01:53
599900 -- (-2079.449) (-2084.635) (-2083.323) [-2074.426] * (-2077.033) [-2075.293] (-2083.627) (-2090.530) -- 0:01:53
600000 -- (-2075.793) (-2087.354) (-2083.373) [-2075.181] * (-2081.247) [-2076.392] (-2089.850) (-2083.802) -- 0:01:53
Average standard deviation of split frequencies: 0.006666
600100 -- (-2077.462) (-2083.256) (-2082.133) [-2070.304] * [-2073.282] (-2084.761) (-2096.189) (-2086.371) -- 0:01:53
600200 -- (-2076.814) (-2085.046) (-2078.057) [-2068.096] * [-2070.240] (-2078.205) (-2096.562) (-2076.056) -- 0:01:53
600300 -- [-2078.137] (-2088.106) (-2077.262) (-2069.912) * [-2069.614] (-2081.246) (-2089.959) (-2077.951) -- 0:01:53
600400 -- (-2085.463) (-2085.479) [-2077.222] (-2074.168) * [-2069.544] (-2078.180) (-2082.440) (-2080.737) -- 0:01:53
600500 -- (-2088.880) (-2084.135) (-2081.796) [-2069.481] * [-2067.811] (-2078.162) (-2085.575) (-2073.474) -- 0:01:53
600600 -- (-2086.849) (-2075.441) (-2080.158) [-2070.739] * [-2067.362] (-2072.569) (-2083.737) (-2080.140) -- 0:01:53
600700 -- (-2097.252) (-2081.083) (-2073.643) [-2072.015] * (-2072.229) (-2075.232) (-2077.348) [-2074.434] -- 0:01:53
600800 -- (-2083.542) (-2078.665) [-2071.432] (-2070.023) * (-2083.171) [-2069.515] (-2075.063) (-2079.879) -- 0:01:53
600900 -- (-2085.272) (-2076.763) (-2075.698) [-2067.928] * (-2076.016) (-2076.202) (-2081.485) [-2081.846] -- 0:01:53
601000 -- (-2078.968) (-2073.964) (-2076.802) [-2077.379] * (-2069.547) (-2074.866) [-2075.535] (-2080.973) -- 0:01:53
Average standard deviation of split frequencies: 0.006788
601100 -- [-2075.007] (-2080.923) (-2085.752) (-2079.401) * (-2069.389) [-2078.542] (-2078.453) (-2080.167) -- 0:01:53
601200 -- (-2085.949) [-2079.348] (-2078.620) (-2085.071) * (-2075.519) [-2080.145] (-2083.323) (-2080.478) -- 0:01:53
601300 -- (-2081.671) (-2080.856) (-2087.628) [-2071.973] * (-2077.191) (-2083.455) [-2084.055] (-2082.566) -- 0:01:53
601400 -- (-2078.483) (-2076.955) (-2082.742) [-2075.728] * [-2082.091] (-2077.973) (-2092.264) (-2079.704) -- 0:01:53
601500 -- [-2078.947] (-2078.722) (-2088.197) (-2072.577) * [-2078.398] (-2075.772) (-2083.951) (-2077.525) -- 0:01:53
601600 -- (-2075.354) (-2075.457) (-2076.161) [-2071.782] * [-2074.882] (-2072.877) (-2076.924) (-2080.533) -- 0:01:53
601700 -- (-2077.848) [-2075.834] (-2081.164) (-2067.851) * (-2076.359) [-2075.111] (-2086.929) (-2073.357) -- 0:01:53
601800 -- (-2080.431) (-2073.335) (-2076.976) [-2065.093] * [-2069.767] (-2075.078) (-2085.389) (-2073.082) -- 0:01:53
601900 -- (-2076.500) (-2081.317) (-2081.245) [-2073.674] * [-2069.324] (-2073.531) (-2082.234) (-2076.194) -- 0:01:53
602000 -- (-2081.386) (-2089.522) (-2085.167) [-2071.939] * (-2072.465) (-2073.452) [-2077.414] (-2074.601) -- 0:01:53
Average standard deviation of split frequencies: 0.006822
602100 -- (-2076.732) (-2085.603) (-2097.306) [-2073.777] * [-2075.569] (-2081.441) (-2086.046) (-2070.973) -- 0:01:53
602200 -- (-2073.239) (-2086.923) (-2086.237) [-2073.442] * (-2075.973) (-2077.530) (-2083.537) [-2073.010] -- 0:01:52
602300 -- [-2076.160] (-2086.820) (-2078.869) (-2085.492) * (-2072.144) (-2075.199) (-2085.864) [-2076.897] -- 0:01:52
602400 -- (-2075.306) (-2090.365) (-2076.322) [-2077.244] * [-2074.440] (-2076.073) (-2081.561) (-2079.959) -- 0:01:52
602500 -- (-2079.447) (-2079.585) (-2078.867) [-2074.206] * (-2074.741) (-2075.756) [-2074.218] (-2093.042) -- 0:01:52
602600 -- (-2081.316) (-2081.416) (-2078.063) [-2074.598] * (-2073.778) [-2071.814] (-2071.748) (-2073.394) -- 0:01:52
602700 -- (-2074.630) (-2076.506) (-2080.380) [-2077.117] * (-2080.899) (-2070.315) [-2073.347] (-2074.772) -- 0:01:52
602800 -- (-2078.213) (-2081.773) (-2069.408) [-2076.829] * (-2080.866) [-2070.805] (-2076.877) (-2081.877) -- 0:01:52
602900 -- (-2082.212) (-2079.868) (-2074.536) [-2077.422] * [-2078.857] (-2072.482) (-2075.887) (-2081.297) -- 0:01:52
603000 -- (-2073.114) [-2086.147] (-2073.906) (-2078.078) * [-2074.204] (-2080.911) (-2072.330) (-2085.122) -- 0:01:52
Average standard deviation of split frequencies: 0.006475
603100 -- [-2077.201] (-2078.338) (-2073.699) (-2078.913) * [-2069.286] (-2088.849) (-2076.395) (-2082.315) -- 0:01:52
603200 -- (-2077.812) (-2079.707) [-2072.597] (-2087.401) * (-2071.492) (-2081.736) (-2078.162) [-2082.456] -- 0:01:52
603300 -- (-2075.098) (-2079.545) [-2075.739] (-2093.249) * (-2074.314) (-2077.501) (-2076.428) [-2077.610] -- 0:01:52
603400 -- (-2075.768) [-2074.578] (-2075.285) (-2085.221) * [-2069.835] (-2079.474) (-2082.956) (-2074.685) -- 0:01:52
603500 -- (-2078.431) (-2078.801) [-2070.706] (-2087.734) * (-2072.194) (-2084.697) [-2074.191] (-2082.124) -- 0:01:52
603600 -- (-2078.584) (-2079.913) [-2069.137] (-2081.578) * [-2075.907] (-2082.799) (-2079.593) (-2074.763) -- 0:01:52
603700 -- (-2075.463) (-2080.884) [-2075.358] (-2078.082) * (-2074.978) (-2073.162) (-2090.308) [-2074.646] -- 0:01:52
603800 -- (-2075.310) (-2080.647) [-2074.202] (-2080.362) * [-2075.677] (-2074.153) (-2093.896) (-2076.627) -- 0:01:52
603900 -- (-2074.957) [-2078.227] (-2085.068) (-2087.544) * (-2073.776) (-2077.061) (-2086.620) [-2077.001] -- 0:01:52
604000 -- (-2082.149) (-2076.405) [-2071.613] (-2091.393) * [-2078.477] (-2078.452) (-2089.540) (-2070.563) -- 0:01:52
Average standard deviation of split frequencies: 0.006421
604100 -- (-2080.299) [-2076.810] (-2070.755) (-2081.723) * (-2073.602) [-2072.194] (-2081.097) (-2078.518) -- 0:01:52
604200 -- (-2081.417) [-2078.158] (-2075.997) (-2076.519) * (-2070.464) (-2069.347) (-2093.576) [-2082.588] -- 0:01:52
604300 -- (-2081.894) [-2079.299] (-2080.128) (-2086.284) * [-2069.674] (-2071.789) (-2083.955) (-2078.985) -- 0:01:52
604400 -- (-2079.436) (-2085.836) [-2075.296] (-2081.464) * [-2071.493] (-2081.230) (-2076.958) (-2080.065) -- 0:01:52
604500 -- (-2078.429) (-2080.561) [-2071.229] (-2075.486) * [-2070.421] (-2075.028) (-2078.479) (-2079.253) -- 0:01:52
604600 -- (-2078.655) (-2083.731) [-2068.169] (-2081.469) * [-2073.418] (-2081.058) (-2078.009) (-2079.357) -- 0:01:52
604700 -- (-2073.532) (-2084.373) [-2068.440] (-2081.862) * (-2073.618) [-2073.985] (-2077.571) (-2081.228) -- 0:01:52
604800 -- [-2078.607] (-2090.663) (-2072.437) (-2078.348) * (-2072.917) (-2074.659) (-2081.522) [-2070.106] -- 0:01:52
604900 -- (-2084.429) (-2084.456) (-2072.752) [-2078.955] * [-2071.208] (-2075.381) (-2077.353) (-2069.785) -- 0:01:52
605000 -- (-2075.374) (-2081.461) [-2069.745] (-2083.145) * (-2075.180) [-2073.884] (-2079.093) (-2070.343) -- 0:01:52
Average standard deviation of split frequencies: 0.006387
605100 -- [-2079.319] (-2081.019) (-2069.698) (-2095.958) * (-2076.622) (-2078.782) [-2083.704] (-2070.221) -- 0:01:52
605200 -- (-2077.328) (-2086.438) [-2078.369] (-2096.344) * (-2080.317) (-2075.891) (-2073.689) [-2073.547] -- 0:01:52
605300 -- (-2076.425) (-2094.596) [-2072.059] (-2085.129) * (-2082.743) [-2069.834] (-2073.225) (-2074.833) -- 0:01:52
605400 -- (-2076.257) (-2082.167) (-2073.662) [-2081.500] * (-2077.906) [-2077.431] (-2076.000) (-2077.711) -- 0:01:52
605500 -- (-2080.078) [-2069.854] (-2069.130) (-2088.587) * (-2087.968) (-2075.367) (-2079.235) [-2078.385] -- 0:01:52
605600 -- (-2083.223) (-2077.097) [-2072.057] (-2077.152) * (-2097.686) [-2078.441] (-2080.233) (-2080.194) -- 0:01:52
605700 -- (-2081.894) (-2073.950) (-2082.519) [-2075.503] * [-2077.731] (-2074.739) (-2087.064) (-2085.748) -- 0:01:51
605800 -- (-2077.464) [-2074.575] (-2079.391) (-2072.963) * (-2075.747) [-2072.053] (-2086.491) (-2084.492) -- 0:01:51
605900 -- (-2076.584) [-2071.365] (-2075.161) (-2079.470) * (-2081.152) [-2075.172] (-2083.174) (-2082.479) -- 0:01:51
606000 -- (-2084.705) [-2078.229] (-2082.961) (-2090.330) * (-2080.003) (-2070.740) (-2075.517) [-2075.247] -- 0:01:51
Average standard deviation of split frequencies: 0.006644
606100 -- (-2093.510) (-2074.450) (-2078.863) [-2083.234] * (-2077.167) [-2074.109] (-2082.989) (-2075.213) -- 0:01:51
606200 -- (-2095.851) (-2072.739) [-2078.438] (-2090.260) * (-2080.448) [-2070.402] (-2079.025) (-2072.933) -- 0:01:51
606300 -- (-2094.638) [-2071.122] (-2079.056) (-2083.062) * (-2085.464) [-2068.140] (-2092.016) (-2073.433) -- 0:01:51
606400 -- (-2089.378) [-2071.196] (-2077.470) (-2083.384) * (-2082.366) (-2069.888) [-2078.948] (-2075.816) -- 0:01:51
606500 -- [-2076.032] (-2072.802) (-2084.210) (-2092.689) * (-2072.210) [-2067.289] (-2076.403) (-2076.074) -- 0:01:51
606600 -- (-2075.277) [-2067.219] (-2084.099) (-2084.000) * [-2068.417] (-2070.714) (-2077.094) (-2082.507) -- 0:01:51
606700 -- (-2081.821) (-2070.088) [-2073.604] (-2088.308) * [-2077.671] (-2072.007) (-2084.811) (-2075.960) -- 0:01:51
606800 -- (-2084.271) (-2077.829) [-2070.882] (-2083.411) * [-2072.802] (-2069.110) (-2077.592) (-2080.189) -- 0:01:51
606900 -- (-2084.020) [-2072.425] (-2072.384) (-2080.658) * [-2073.243] (-2072.288) (-2077.646) (-2084.720) -- 0:01:51
607000 -- [-2080.238] (-2071.324) (-2081.683) (-2078.655) * (-2078.533) (-2074.809) (-2078.537) [-2074.369] -- 0:01:51
Average standard deviation of split frequencies: 0.006544
607100 -- (-2082.651) [-2070.346] (-2075.931) (-2079.288) * (-2077.460) [-2075.745] (-2078.882) (-2075.006) -- 0:01:51
607200 -- (-2077.513) [-2071.198] (-2068.369) (-2087.332) * (-2083.889) (-2074.584) (-2082.518) [-2070.815] -- 0:01:51
607300 -- (-2084.868) (-2069.316) [-2072.086] (-2073.818) * (-2095.080) (-2080.187) (-2080.371) [-2077.875] -- 0:01:51
607400 -- [-2076.998] (-2072.539) (-2071.934) (-2072.692) * (-2080.928) [-2074.586] (-2077.121) (-2074.073) -- 0:01:51
607500 -- [-2074.325] (-2076.691) (-2077.071) (-2071.598) * (-2078.796) (-2083.104) (-2072.125) [-2071.806] -- 0:01:51
607600 -- (-2081.075) (-2081.568) (-2073.974) [-2072.888] * (-2079.486) (-2075.333) [-2078.013] (-2074.970) -- 0:01:51
607700 -- (-2081.074) (-2071.192) [-2077.701] (-2075.894) * (-2080.157) (-2079.699) [-2078.965] (-2076.875) -- 0:01:51
607800 -- (-2086.119) (-2077.580) (-2073.979) [-2074.611] * (-2081.828) [-2077.428] (-2078.771) (-2072.648) -- 0:01:51
607900 -- (-2092.329) [-2080.438] (-2072.521) (-2068.797) * (-2086.677) (-2075.101) [-2076.153] (-2072.575) -- 0:01:51
608000 -- (-2088.580) (-2073.236) [-2070.455] (-2075.435) * (-2085.033) [-2074.160] (-2078.032) (-2077.031) -- 0:01:51
Average standard deviation of split frequencies: 0.006556
608100 -- (-2090.554) (-2078.498) [-2070.834] (-2077.320) * (-2080.127) (-2077.650) [-2080.713] (-2075.753) -- 0:01:51
608200 -- (-2089.986) [-2070.639] (-2071.743) (-2072.650) * (-2087.251) (-2073.840) (-2083.605) [-2073.075] -- 0:01:51
608300 -- (-2082.825) (-2079.249) [-2078.464] (-2072.868) * (-2077.878) (-2070.603) (-2082.121) [-2074.013] -- 0:01:51
608400 -- [-2081.462] (-2079.966) (-2079.738) (-2076.556) * (-2083.646) (-2074.366) (-2078.898) [-2073.273] -- 0:01:51
608500 -- (-2075.869) [-2072.738] (-2080.697) (-2076.700) * (-2082.706) (-2074.721) (-2081.684) [-2075.963] -- 0:01:51
608600 -- (-2084.751) [-2075.112] (-2075.114) (-2071.395) * (-2076.953) (-2075.309) (-2073.823) [-2069.273] -- 0:01:51
608700 -- (-2078.146) (-2080.852) (-2078.243) [-2072.008] * (-2078.550) [-2071.276] (-2077.159) (-2073.629) -- 0:01:51
608800 -- (-2084.550) (-2077.166) [-2075.356] (-2069.812) * (-2083.840) (-2070.528) (-2079.612) [-2069.080] -- 0:01:51
608900 -- (-2077.155) [-2073.493] (-2083.536) (-2070.837) * (-2086.628) (-2083.812) (-2076.239) [-2070.059] -- 0:01:51
609000 -- (-2078.288) [-2071.534] (-2081.399) (-2074.665) * (-2092.987) (-2082.912) (-2084.869) [-2074.401] -- 0:01:51
Average standard deviation of split frequencies: 0.006633
609100 -- (-2079.615) (-2079.434) (-2078.176) [-2071.277] * (-2095.660) (-2082.192) (-2081.032) [-2073.075] -- 0:01:51
609200 -- (-2076.852) [-2075.352] (-2080.808) (-2074.189) * (-2100.220) [-2076.002] (-2075.174) (-2074.948) -- 0:01:50
609300 -- (-2080.513) [-2077.077] (-2077.283) (-2077.141) * (-2103.841) (-2080.348) [-2075.529] (-2075.536) -- 0:01:50
609400 -- (-2087.175) (-2076.828) (-2093.264) [-2072.142] * (-2096.215) (-2073.866) (-2076.620) [-2074.472] -- 0:01:50
609500 -- (-2081.272) (-2085.746) (-2090.691) [-2069.692] * (-2104.921) [-2071.784] (-2076.742) (-2073.046) -- 0:01:50
609600 -- (-2076.851) (-2082.919) (-2088.445) [-2072.183] * (-2097.073) [-2070.811] (-2090.730) (-2073.596) -- 0:01:50
609700 -- [-2078.965] (-2074.358) (-2091.045) (-2074.203) * (-2091.313) (-2075.487) (-2076.204) [-2071.724] -- 0:01:50
609800 -- (-2075.844) [-2078.934] (-2086.217) (-2074.632) * (-2092.891) (-2084.326) (-2079.659) [-2069.298] -- 0:01:50
609900 -- (-2081.344) (-2072.175) (-2087.597) [-2073.546] * (-2087.367) (-2080.597) (-2081.855) [-2073.097] -- 0:01:50
610000 -- (-2084.688) [-2069.754] (-2089.514) (-2078.441) * (-2099.492) (-2074.182) (-2078.327) [-2069.987] -- 0:01:50
Average standard deviation of split frequencies: 0.006623
610100 -- (-2089.341) [-2070.750] (-2087.690) (-2071.163) * (-2099.326) (-2083.749) (-2084.026) [-2075.282] -- 0:01:50
610200 -- (-2082.171) [-2067.132] (-2076.989) (-2070.720) * (-2088.293) (-2075.913) (-2083.565) [-2070.458] -- 0:01:50
610300 -- (-2093.167) (-2071.787) (-2084.290) [-2073.976] * (-2084.579) (-2075.186) (-2092.095) [-2067.126] -- 0:01:50
610400 -- (-2078.350) (-2072.687) (-2088.035) [-2075.989] * (-2090.654) (-2075.341) (-2084.505) [-2074.624] -- 0:01:50
610500 -- (-2081.716) (-2078.587) (-2075.857) [-2073.394] * (-2089.395) [-2072.147] (-2089.960) (-2074.947) -- 0:01:51
610600 -- (-2083.383) (-2077.707) [-2077.147] (-2074.906) * (-2086.742) [-2075.733] (-2090.180) (-2071.121) -- 0:01:50
610700 -- [-2079.689] (-2079.569) (-2075.289) (-2068.788) * (-2087.839) (-2075.197) (-2084.714) [-2076.530] -- 0:01:50
610800 -- (-2079.063) (-2084.614) (-2078.803) [-2070.737] * (-2087.169) [-2078.279] (-2087.952) (-2075.498) -- 0:01:50
610900 -- (-2082.095) (-2086.680) (-2076.461) [-2073.755] * (-2083.992) (-2086.175) (-2087.054) [-2075.090] -- 0:01:50
611000 -- (-2084.986) (-2077.701) (-2075.245) [-2073.260] * (-2086.662) (-2082.002) (-2082.447) [-2077.888] -- 0:01:50
Average standard deviation of split frequencies: 0.006413
611100 -- (-2082.961) (-2081.704) (-2073.498) [-2069.409] * (-2089.974) (-2086.475) (-2083.974) [-2073.261] -- 0:01:50
611200 -- (-2079.159) (-2075.302) [-2073.966] (-2073.530) * (-2084.488) (-2078.923) (-2086.239) [-2075.764] -- 0:01:50
611300 -- (-2079.763) (-2081.655) (-2078.047) [-2079.647] * (-2091.126) (-2078.919) (-2089.354) [-2072.872] -- 0:01:50
611400 -- (-2075.244) (-2079.623) [-2070.027] (-2083.891) * (-2081.106) (-2075.198) (-2084.632) [-2076.094] -- 0:01:50
611500 -- (-2080.916) (-2083.732) (-2072.071) [-2078.792] * (-2085.691) (-2074.985) (-2088.737) [-2077.952] -- 0:01:50
611600 -- (-2085.799) (-2085.283) [-2074.723] (-2082.144) * (-2074.674) (-2075.692) (-2091.497) [-2076.335] -- 0:01:50
611700 -- (-2073.803) [-2086.009] (-2073.559) (-2077.746) * (-2083.361) [-2069.769] (-2085.047) (-2075.039) -- 0:01:50
611800 -- [-2077.968] (-2088.274) (-2070.122) (-2085.126) * (-2076.367) [-2071.884] (-2082.676) (-2074.015) -- 0:01:50
611900 -- (-2072.216) (-2096.061) (-2071.531) [-2073.334] * [-2081.889] (-2074.775) (-2081.402) (-2085.033) -- 0:01:50
612000 -- [-2074.501] (-2083.455) (-2084.210) (-2076.404) * (-2080.325) (-2075.909) (-2085.479) [-2076.567] -- 0:01:50
Average standard deviation of split frequencies: 0.006667
612100 -- (-2082.860) (-2077.979) (-2080.316) [-2072.375] * (-2080.389) [-2068.724] (-2078.431) (-2074.808) -- 0:01:50
612200 -- [-2076.907] (-2082.902) (-2079.511) (-2075.578) * (-2083.241) [-2072.028] (-2083.339) (-2074.320) -- 0:01:50
612300 -- (-2088.288) (-2082.113) [-2077.936] (-2072.489) * (-2090.642) (-2075.870) (-2080.815) [-2081.194] -- 0:01:50
612400 -- (-2077.112) (-2085.889) (-2078.525) [-2074.328] * (-2077.113) [-2076.190] (-2080.727) (-2074.678) -- 0:01:50
612500 -- (-2077.679) (-2086.921) [-2076.836] (-2081.053) * (-2080.656) [-2068.642] (-2085.535) (-2071.784) -- 0:01:50
612600 -- (-2079.298) (-2074.783) (-2070.214) [-2068.772] * (-2079.936) [-2074.055] (-2080.633) (-2075.938) -- 0:01:50
612700 -- [-2078.324] (-2087.110) (-2075.164) (-2072.474) * (-2079.569) (-2077.411) (-2084.719) [-2071.868] -- 0:01:49
612800 -- (-2086.417) (-2087.926) [-2075.618] (-2073.037) * (-2079.437) (-2080.088) (-2087.190) [-2072.678] -- 0:01:49
612900 -- (-2084.409) (-2071.436) [-2076.910] (-2081.974) * (-2082.977) [-2071.896] (-2079.883) (-2074.914) -- 0:01:49
613000 -- (-2082.787) (-2077.583) (-2074.374) [-2077.659] * [-2081.851] (-2075.677) (-2084.582) (-2087.811) -- 0:01:49
Average standard deviation of split frequencies: 0.006502
613100 -- [-2077.801] (-2074.289) (-2083.468) (-2073.787) * [-2083.455] (-2073.820) (-2085.343) (-2089.502) -- 0:01:49
613200 -- (-2077.190) (-2071.912) (-2078.443) [-2069.206] * [-2078.295] (-2073.381) (-2082.471) (-2079.883) -- 0:01:49
613300 -- (-2082.722) (-2073.823) (-2085.692) [-2070.283] * (-2076.293) [-2069.834] (-2083.512) (-2085.045) -- 0:01:49
613400 -- (-2077.018) (-2072.291) (-2080.337) [-2072.651] * (-2081.343) [-2071.083] (-2082.612) (-2078.864) -- 0:01:49
613500 -- (-2081.194) [-2071.217] (-2078.470) (-2074.405) * (-2082.904) [-2077.368] (-2079.020) (-2077.564) -- 0:01:49
613600 -- (-2077.441) [-2072.138] (-2079.517) (-2082.404) * (-2082.520) [-2074.984] (-2077.125) (-2081.941) -- 0:01:49
613700 -- (-2078.787) [-2066.440] (-2078.397) (-2082.900) * (-2082.658) (-2079.007) (-2079.862) [-2074.633] -- 0:01:49
613800 -- (-2081.502) [-2068.958] (-2094.205) (-2076.658) * (-2092.617) (-2078.228) [-2079.304] (-2072.816) -- 0:01:49
613900 -- (-2075.814) (-2073.261) (-2085.552) [-2071.638] * (-2085.761) [-2080.243] (-2076.506) (-2075.147) -- 0:01:49
614000 -- [-2077.186] (-2083.622) (-2080.226) (-2076.984) * (-2076.598) (-2074.239) [-2077.154] (-2075.553) -- 0:01:50
Average standard deviation of split frequencies: 0.006360
614100 -- (-2082.459) (-2078.658) (-2080.305) [-2075.776] * (-2072.115) (-2074.392) (-2083.622) [-2073.801] -- 0:01:49
614200 -- (-2077.209) (-2082.479) (-2075.432) [-2080.023] * (-2072.553) (-2076.060) (-2084.234) [-2074.377] -- 0:01:49
614300 -- (-2077.249) (-2075.383) [-2074.083] (-2083.900) * (-2083.227) [-2073.603] (-2087.103) (-2070.865) -- 0:01:49
614400 -- (-2090.213) (-2076.109) (-2075.864) [-2070.723] * (-2078.415) (-2071.832) (-2089.894) [-2071.288] -- 0:01:49
614500 -- (-2081.701) (-2073.106) (-2078.445) [-2070.841] * (-2085.395) (-2076.506) (-2081.904) [-2068.223] -- 0:01:49
614600 -- (-2079.642) (-2076.368) (-2075.217) [-2072.271] * (-2087.936) (-2076.499) (-2087.625) [-2068.733] -- 0:01:49
614700 -- (-2079.166) [-2068.954] (-2078.182) (-2078.173) * (-2088.150) (-2079.574) (-2089.284) [-2071.230] -- 0:01:49
614800 -- (-2076.467) [-2071.430] (-2086.801) (-2072.146) * (-2085.671) (-2075.329) (-2084.564) [-2074.311] -- 0:01:49
614900 -- (-2072.368) [-2070.830] (-2086.264) (-2076.855) * (-2086.432) (-2073.994) [-2076.788] (-2072.844) -- 0:01:49
615000 -- (-2080.764) (-2074.432) (-2082.084) [-2069.152] * (-2089.994) (-2072.972) [-2075.019] (-2077.337) -- 0:01:49
Average standard deviation of split frequencies: 0.006502
615100 -- (-2082.860) [-2070.690] (-2083.389) (-2071.529) * (-2089.042) (-2071.865) (-2074.375) [-2076.539] -- 0:01:49
615200 -- (-2079.162) [-2073.446] (-2079.082) (-2074.371) * (-2085.185) [-2073.086] (-2075.946) (-2072.568) -- 0:01:49
615300 -- [-2079.289] (-2071.215) (-2078.094) (-2073.831) * (-2084.892) (-2070.432) (-2074.033) [-2079.747] -- 0:01:49
615400 -- (-2077.491) (-2077.444) (-2077.397) [-2077.593] * (-2086.396) (-2082.866) [-2075.577] (-2075.822) -- 0:01:49
615500 -- (-2080.470) [-2069.640] (-2074.090) (-2082.774) * (-2084.832) [-2074.335] (-2078.422) (-2073.906) -- 0:01:49
615600 -- (-2078.040) (-2073.643) [-2071.172] (-2077.440) * (-2083.874) (-2079.925) (-2079.062) [-2067.521] -- 0:01:49
615700 -- (-2078.802) (-2078.560) (-2071.648) [-2076.706] * (-2088.575) [-2075.425] (-2079.423) (-2071.399) -- 0:01:49
615800 -- (-2078.996) (-2073.408) (-2070.902) [-2071.576] * (-2084.923) (-2073.178) (-2084.049) [-2076.532] -- 0:01:49
615900 -- (-2088.771) (-2079.852) (-2076.635) [-2073.108] * (-2081.246) (-2070.681) [-2080.022] (-2071.979) -- 0:01:49
616000 -- (-2082.191) [-2072.422] (-2073.904) (-2077.496) * (-2082.199) (-2073.198) (-2076.209) [-2075.324] -- 0:01:49
Average standard deviation of split frequencies: 0.006383
616100 -- (-2080.125) (-2075.110) (-2080.031) [-2078.464] * (-2076.637) [-2069.985] (-2075.555) (-2082.236) -- 0:01:49
616200 -- [-2080.325] (-2082.740) (-2072.419) (-2077.022) * (-2088.142) (-2075.405) (-2089.415) [-2072.529] -- 0:01:48
616300 -- (-2077.265) [-2070.512] (-2078.625) (-2074.397) * (-2079.027) (-2078.665) (-2086.467) [-2073.341] -- 0:01:48
616400 -- (-2079.532) [-2067.119] (-2086.349) (-2075.631) * (-2083.181) [-2070.162] (-2079.442) (-2067.536) -- 0:01:48
616500 -- (-2082.195) [-2071.589] (-2085.642) (-2073.225) * (-2090.995) [-2073.730] (-2076.971) (-2072.512) -- 0:01:48
616600 -- (-2081.630) (-2074.774) (-2078.691) [-2069.898] * (-2099.404) (-2081.578) (-2079.544) [-2075.782] -- 0:01:48
616700 -- (-2083.396) (-2071.698) (-2084.678) [-2072.309] * (-2090.529) (-2078.441) [-2079.232] (-2081.714) -- 0:01:48
616800 -- (-2079.553) (-2073.558) (-2078.982) [-2068.271] * (-2084.275) (-2079.567) (-2078.885) [-2075.152] -- 0:01:48
616900 -- (-2076.504) (-2074.945) (-2084.638) [-2071.617] * (-2092.672) (-2077.828) (-2074.069) [-2079.029] -- 0:01:48
617000 -- (-2079.973) (-2080.777) (-2080.622) [-2072.297] * (-2086.685) [-2078.566] (-2075.967) (-2081.100) -- 0:01:48
Average standard deviation of split frequencies: 0.006176
617100 -- (-2076.915) (-2080.583) (-2086.309) [-2068.146] * (-2085.622) (-2076.323) (-2079.355) [-2076.434] -- 0:01:48
617200 -- (-2079.277) (-2081.015) (-2081.178) [-2072.815] * (-2085.030) (-2075.803) (-2079.378) [-2075.077] -- 0:01:48
617300 -- (-2074.232) [-2077.071] (-2085.982) (-2078.823) * (-2092.435) [-2074.539] (-2074.333) (-2077.170) -- 0:01:48
617400 -- [-2075.882] (-2083.499) (-2083.130) (-2071.802) * (-2094.075) [-2068.760] (-2093.116) (-2074.465) -- 0:01:49
617500 -- (-2075.747) (-2078.435) (-2082.728) [-2070.498] * (-2087.127) [-2071.119] (-2075.502) (-2079.510) -- 0:01:49
617600 -- [-2077.385] (-2083.449) (-2082.955) (-2080.136) * (-2087.596) [-2077.683] (-2078.081) (-2074.154) -- 0:01:48
617700 -- (-2074.169) [-2084.108] (-2085.509) (-2076.812) * [-2074.258] (-2079.420) (-2079.512) (-2080.593) -- 0:01:48
617800 -- [-2077.592] (-2082.513) (-2093.028) (-2078.200) * [-2075.338] (-2070.686) (-2079.667) (-2075.856) -- 0:01:48
617900 -- (-2075.522) (-2074.984) (-2093.232) [-2078.572] * [-2081.215] (-2080.763) (-2096.962) (-2070.052) -- 0:01:48
618000 -- (-2076.334) [-2071.829] (-2093.773) (-2076.681) * (-2088.408) (-2087.591) (-2085.560) [-2071.123] -- 0:01:48
Average standard deviation of split frequencies: 0.006101
618100 -- (-2074.575) [-2073.061] (-2088.094) (-2078.268) * (-2087.182) (-2089.885) [-2077.043] (-2074.904) -- 0:01:48
618200 -- (-2075.039) [-2076.313] (-2089.362) (-2081.200) * (-2089.178) (-2076.081) (-2082.196) [-2071.119] -- 0:01:48
618300 -- (-2076.053) [-2073.235] (-2078.902) (-2079.793) * (-2083.618) (-2072.745) (-2088.835) [-2069.291] -- 0:01:48
618400 -- (-2085.498) (-2076.680) (-2081.416) [-2079.253] * (-2081.051) (-2075.933) (-2088.384) [-2069.005] -- 0:01:48
618500 -- (-2084.553) (-2086.574) (-2080.620) [-2083.084] * (-2091.918) (-2074.811) (-2086.259) [-2076.372] -- 0:01:48
618600 -- (-2080.762) (-2080.930) (-2083.700) [-2084.973] * (-2089.110) (-2087.319) (-2082.782) [-2071.173] -- 0:01:48
618700 -- (-2080.998) [-2078.010] (-2083.921) (-2092.949) * (-2082.892) (-2087.098) (-2078.483) [-2070.672] -- 0:01:48
618800 -- (-2081.065) (-2082.781) [-2080.893] (-2096.293) * (-2080.899) (-2082.075) (-2083.402) [-2073.717] -- 0:01:48
618900 -- (-2090.813) (-2076.007) [-2077.944] (-2085.955) * (-2089.556) (-2075.411) [-2072.831] (-2075.005) -- 0:01:48
619000 -- (-2083.730) (-2077.833) (-2079.901) [-2082.622] * (-2089.420) (-2080.068) (-2074.447) [-2077.008] -- 0:01:48
Average standard deviation of split frequencies: 0.006025
619100 -- (-2080.703) [-2074.040] (-2081.243) (-2082.090) * (-2084.318) (-2084.822) (-2078.621) [-2073.435] -- 0:01:48
619200 -- (-2078.732) [-2072.319] (-2075.431) (-2084.227) * (-2084.547) (-2076.665) (-2074.153) [-2070.673] -- 0:01:48
619300 -- (-2088.072) [-2078.839] (-2083.169) (-2085.317) * (-2088.069) [-2084.061] (-2075.054) (-2072.940) -- 0:01:48
619400 -- (-2076.645) (-2075.375) (-2078.034) [-2075.660] * (-2077.673) (-2077.885) [-2076.101] (-2076.390) -- 0:01:48
619500 -- (-2093.167) (-2074.915) [-2071.681] (-2078.052) * [-2075.813] (-2078.921) (-2077.420) (-2085.394) -- 0:01:48
619600 -- (-2081.002) (-2076.830) (-2084.762) [-2070.118] * (-2087.361) (-2075.226) (-2089.303) [-2072.709] -- 0:01:48
619700 -- (-2080.751) (-2082.189) (-2072.677) [-2069.425] * (-2080.125) (-2077.268) (-2090.471) [-2070.510] -- 0:01:48
619800 -- (-2086.180) (-2073.882) (-2076.201) [-2069.763] * (-2093.558) (-2080.010) (-2084.615) [-2073.272] -- 0:01:47
619900 -- (-2081.147) [-2068.856] (-2073.664) (-2076.403) * (-2091.417) (-2074.497) (-2082.476) [-2073.262] -- 0:01:47
620000 -- (-2078.320) (-2084.047) (-2073.280) [-2075.570] * (-2094.864) [-2072.667] (-2089.452) (-2078.024) -- 0:01:47
Average standard deviation of split frequencies: 0.005864
620100 -- (-2075.543) (-2068.477) [-2069.785] (-2074.157) * (-2091.612) [-2073.384] (-2084.283) (-2074.741) -- 0:01:47
620200 -- (-2077.659) (-2071.553) (-2080.744) [-2075.947] * (-2094.866) [-2070.643] (-2079.088) (-2078.121) -- 0:01:47
620300 -- (-2074.864) [-2078.000] (-2078.680) (-2075.406) * (-2084.380) (-2073.903) [-2077.019] (-2080.916) -- 0:01:47
620400 -- (-2073.742) (-2082.495) (-2069.215) [-2072.707] * (-2085.250) [-2073.224] (-2081.016) (-2082.783) -- 0:01:47
620500 -- (-2075.166) [-2069.412] (-2077.973) (-2082.892) * (-2082.963) (-2074.430) (-2080.481) [-2075.451] -- 0:01:47
620600 -- (-2077.977) (-2074.168) [-2071.541] (-2090.881) * (-2086.342) [-2074.412] (-2084.089) (-2084.933) -- 0:01:47
620700 -- (-2078.098) (-2073.554) [-2077.062] (-2081.868) * [-2074.067] (-2076.950) (-2080.374) (-2088.737) -- 0:01:47
620800 -- (-2075.609) [-2072.350] (-2076.590) (-2080.680) * (-2082.916) [-2075.025] (-2085.788) (-2072.671) -- 0:01:47
620900 -- (-2076.761) (-2076.545) [-2074.894] (-2085.850) * (-2087.848) (-2086.305) (-2083.033) [-2074.173] -- 0:01:48
621000 -- [-2072.648] (-2074.026) (-2079.184) (-2076.855) * (-2083.206) (-2088.617) [-2080.031] (-2080.258) -- 0:01:48
Average standard deviation of split frequencies: 0.006028
621100 -- (-2073.374) [-2074.289] (-2085.524) (-2080.378) * (-2082.029) (-2086.236) (-2081.371) [-2074.504] -- 0:01:47
621200 -- (-2077.919) [-2069.685] (-2082.028) (-2078.309) * (-2080.462) (-2087.170) (-2075.525) [-2074.416] -- 0:01:47
621300 -- (-2077.649) [-2072.022] (-2081.471) (-2078.950) * (-2079.926) (-2082.976) [-2075.653] (-2070.588) -- 0:01:47
621400 -- (-2080.541) (-2074.143) (-2080.823) [-2075.989] * (-2073.209) (-2081.205) (-2081.239) [-2067.910] -- 0:01:47
621500 -- (-2075.459) [-2075.454] (-2087.462) (-2084.910) * (-2076.316) (-2089.945) [-2077.994] (-2068.804) -- 0:01:47
621600 -- (-2086.655) [-2073.662] (-2081.410) (-2077.477) * (-2085.605) (-2088.437) (-2073.057) [-2071.696] -- 0:01:47
621700 -- (-2078.330) [-2074.593] (-2078.196) (-2081.979) * [-2074.033] (-2086.415) (-2079.947) (-2076.782) -- 0:01:47
621800 -- (-2090.788) (-2078.863) [-2073.862] (-2075.385) * [-2075.165] (-2085.910) (-2079.418) (-2074.848) -- 0:01:47
621900 -- (-2082.975) (-2072.270) [-2081.372] (-2080.057) * (-2080.047) (-2086.925) [-2076.710] (-2076.891) -- 0:01:47
622000 -- (-2084.173) (-2081.526) (-2077.674) [-2080.972] * (-2083.332) (-2098.213) (-2082.487) [-2074.821] -- 0:01:47
Average standard deviation of split frequencies: 0.006148
622100 -- (-2083.827) (-2076.072) [-2079.701] (-2084.684) * [-2079.891] (-2096.235) (-2082.201) (-2079.717) -- 0:01:47
622200 -- (-2083.073) [-2077.863] (-2081.356) (-2077.226) * (-2081.825) (-2081.153) [-2078.362] (-2083.042) -- 0:01:47
622300 -- (-2077.285) [-2075.590] (-2078.857) (-2081.092) * (-2085.891) (-2082.068) (-2083.712) [-2073.437] -- 0:01:47
622400 -- (-2073.758) [-2076.161] (-2081.018) (-2074.848) * (-2085.339) (-2086.120) (-2079.760) [-2073.821] -- 0:01:47
622500 -- [-2074.934] (-2074.030) (-2095.772) (-2076.378) * (-2077.935) (-2084.409) (-2072.797) [-2070.397] -- 0:01:47
622600 -- [-2074.587] (-2072.080) (-2079.194) (-2079.625) * [-2081.019] (-2080.364) (-2076.362) (-2074.980) -- 0:01:47
622700 -- (-2070.532) [-2075.342] (-2079.055) (-2079.442) * (-2076.509) [-2079.267] (-2081.734) (-2069.286) -- 0:01:47
622800 -- (-2086.995) (-2077.728) [-2073.211] (-2072.007) * (-2082.240) (-2076.911) [-2079.444] (-2082.842) -- 0:01:47
622900 -- (-2079.485) [-2068.512] (-2072.667) (-2079.498) * (-2084.729) (-2075.240) (-2086.712) [-2068.146] -- 0:01:47
623000 -- [-2073.909] (-2081.049) (-2076.313) (-2080.645) * (-2079.986) [-2070.472] (-2088.838) (-2074.831) -- 0:01:47
Average standard deviation of split frequencies: 0.006181
623100 -- (-2076.466) [-2071.457] (-2072.897) (-2075.987) * (-2084.720) (-2074.669) (-2090.006) [-2075.029] -- 0:01:47
623200 -- [-2072.427] (-2080.287) (-2072.791) (-2075.025) * (-2077.714) (-2080.178) (-2075.678) [-2074.273] -- 0:01:47
623300 -- (-2078.047) (-2084.369) [-2069.644] (-2085.023) * (-2079.947) (-2082.156) [-2076.349] (-2072.690) -- 0:01:46
623400 -- (-2078.099) (-2084.391) [-2072.961] (-2078.255) * [-2081.773] (-2078.950) (-2073.044) (-2085.398) -- 0:01:46
623500 -- (-2085.298) [-2072.820] (-2072.309) (-2076.321) * (-2072.365) (-2080.463) [-2081.820] (-2073.659) -- 0:01:46
623600 -- (-2080.236) (-2081.535) [-2067.328] (-2080.493) * [-2074.366] (-2076.932) (-2081.986) (-2071.297) -- 0:01:46
623700 -- [-2076.486] (-2077.210) (-2069.814) (-2081.388) * (-2085.936) [-2074.988] (-2084.796) (-2073.704) -- 0:01:46
623800 -- (-2074.080) (-2082.763) [-2072.172] (-2076.431) * (-2086.570) (-2074.201) (-2084.112) [-2071.600] -- 0:01:46
623900 -- [-2075.979] (-2082.212) (-2069.299) (-2075.332) * (-2077.356) [-2067.793] (-2095.862) (-2072.247) -- 0:01:46
624000 -- (-2079.285) (-2083.127) [-2071.030] (-2081.095) * (-2077.851) [-2068.067] (-2086.464) (-2071.058) -- 0:01:46
Average standard deviation of split frequencies: 0.006150
624100 -- (-2078.682) (-2083.009) [-2067.933] (-2085.477) * (-2084.719) [-2071.913] (-2082.577) (-2072.641) -- 0:01:46
624200 -- [-2076.714] (-2086.078) (-2068.572) (-2098.287) * (-2081.983) (-2075.803) (-2085.996) [-2077.050] -- 0:01:46
624300 -- [-2074.719] (-2092.828) (-2082.872) (-2092.926) * (-2076.975) (-2071.418) (-2088.633) [-2072.859] -- 0:01:46
624400 -- (-2071.994) (-2087.297) [-2076.302] (-2092.743) * (-2081.688) (-2082.960) (-2092.765) [-2070.233] -- 0:01:47
624500 -- [-2070.181] (-2089.532) (-2067.513) (-2092.599) * (-2089.516) (-2081.659) (-2089.727) [-2075.522] -- 0:01:47
624600 -- [-2071.270] (-2080.082) (-2068.964) (-2093.976) * (-2087.129) (-2081.724) (-2085.592) [-2074.776] -- 0:01:46
624700 -- (-2078.144) [-2072.265] (-2072.193) (-2087.965) * (-2078.366) (-2074.027) (-2082.320) [-2073.237] -- 0:01:46
624800 -- (-2070.033) [-2072.194] (-2073.707) (-2084.010) * [-2085.388] (-2081.251) (-2080.863) (-2085.261) -- 0:01:46
624900 -- (-2077.866) (-2079.388) [-2068.374] (-2081.487) * (-2083.368) [-2071.770] (-2082.816) (-2071.052) -- 0:01:46
625000 -- (-2075.838) (-2078.584) [-2073.561] (-2080.754) * (-2083.655) (-2075.731) (-2082.621) [-2072.829] -- 0:01:46
Average standard deviation of split frequencies: 0.006011
625100 -- [-2073.564] (-2079.988) (-2068.755) (-2074.473) * (-2080.320) (-2083.651) [-2078.578] (-2070.846) -- 0:01:46
625200 -- (-2078.018) [-2076.769] (-2078.985) (-2075.936) * (-2078.096) (-2081.759) (-2079.412) [-2072.632] -- 0:01:46
625300 -- (-2078.632) [-2079.507] (-2073.121) (-2079.074) * (-2080.665) [-2073.045] (-2075.693) (-2079.426) -- 0:01:46
625400 -- [-2076.209] (-2088.312) (-2069.701) (-2070.447) * [-2076.947] (-2075.437) (-2082.372) (-2075.765) -- 0:01:46
625500 -- (-2079.824) (-2085.643) [-2070.842] (-2070.679) * (-2079.336) [-2076.426] (-2080.614) (-2074.760) -- 0:01:46
625600 -- (-2078.858) (-2082.138) (-2080.308) [-2070.165] * (-2088.225) [-2078.376] (-2080.497) (-2077.482) -- 0:01:46
625700 -- (-2078.731) (-2084.905) (-2076.808) [-2071.228] * (-2078.324) (-2072.323) (-2080.696) [-2073.698] -- 0:01:46
625800 -- (-2100.580) (-2085.685) [-2069.873] (-2071.787) * (-2075.294) (-2072.325) (-2096.304) [-2078.394] -- 0:01:46
625900 -- (-2075.106) (-2085.301) [-2069.704] (-2074.170) * (-2084.135) (-2077.886) (-2091.471) [-2075.147] -- 0:01:46
626000 -- (-2081.309) (-2076.540) (-2074.239) [-2075.743] * (-2081.609) (-2070.008) (-2084.139) [-2079.424] -- 0:01:46
Average standard deviation of split frequencies: 0.005786
626100 -- (-2078.607) (-2071.084) [-2075.153] (-2084.711) * (-2080.597) [-2069.074] (-2078.772) (-2078.306) -- 0:01:46
626200 -- (-2077.958) [-2076.117] (-2072.623) (-2070.237) * (-2092.468) [-2069.528] (-2081.492) (-2087.953) -- 0:01:46
626300 -- [-2072.391] (-2085.875) (-2079.549) (-2072.563) * (-2084.595) [-2068.442] (-2079.706) (-2082.855) -- 0:01:46
626400 -- (-2071.898) [-2074.627] (-2074.734) (-2075.819) * (-2083.846) [-2069.117] (-2077.083) (-2075.438) -- 0:01:46
626500 -- [-2071.874] (-2073.395) (-2073.746) (-2073.486) * (-2089.567) [-2077.795] (-2079.393) (-2081.642) -- 0:01:46
626600 -- (-2073.154) (-2079.655) [-2070.624] (-2071.750) * [-2078.547] (-2072.673) (-2077.693) (-2084.759) -- 0:01:46
626700 -- (-2073.752) (-2079.997) (-2074.134) [-2080.195] * [-2076.996] (-2079.466) (-2079.172) (-2082.870) -- 0:01:46
626800 -- (-2083.534) (-2079.729) (-2072.626) [-2072.969] * (-2081.787) (-2076.331) (-2077.677) [-2083.374] -- 0:01:45
626900 -- (-2078.783) (-2081.307) [-2072.834] (-2067.557) * (-2078.488) (-2079.201) [-2079.883] (-2076.079) -- 0:01:45
627000 -- (-2081.028) (-2075.218) (-2075.761) [-2074.018] * [-2078.416] (-2075.764) (-2080.625) (-2082.253) -- 0:01:45
Average standard deviation of split frequencies: 0.005820
627100 -- [-2073.066] (-2076.398) (-2086.912) (-2074.830) * (-2078.995) (-2083.027) (-2080.493) [-2073.143] -- 0:01:45
627200 -- (-2074.726) [-2070.800] (-2084.658) (-2073.872) * (-2086.345) (-2084.989) (-2085.115) [-2076.314] -- 0:01:45
627300 -- (-2073.194) [-2074.122] (-2078.702) (-2071.605) * (-2076.780) [-2075.255] (-2081.993) (-2072.389) -- 0:01:45
627400 -- (-2077.272) (-2071.768) [-2074.306] (-2074.622) * (-2080.717) (-2075.478) (-2079.213) [-2072.100] -- 0:01:45
627500 -- (-2073.175) (-2082.334) [-2069.630] (-2093.990) * (-2080.013) [-2072.249] (-2080.578) (-2070.802) -- 0:01:45
627600 -- (-2073.557) (-2086.416) [-2070.941] (-2089.308) * [-2075.548] (-2077.509) (-2083.825) (-2079.042) -- 0:01:45
627700 -- (-2081.115) (-2086.106) [-2072.807] (-2081.792) * [-2078.715] (-2079.551) (-2088.568) (-2081.775) -- 0:01:45
627800 -- (-2078.341) (-2081.853) [-2070.330] (-2079.987) * (-2079.718) (-2078.450) (-2082.889) [-2075.962] -- 0:01:46
627900 -- (-2079.441) (-2087.405) [-2082.646] (-2081.789) * (-2091.870) [-2075.477] (-2082.299) (-2079.885) -- 0:01:46
628000 -- (-2073.690) [-2078.771] (-2074.943) (-2081.549) * (-2100.618) [-2070.448] (-2080.018) (-2080.749) -- 0:01:46
Average standard deviation of split frequencies: 0.005940
628100 -- [-2074.797] (-2072.363) (-2088.612) (-2080.996) * (-2092.890) [-2070.844] (-2079.059) (-2076.759) -- 0:01:45
628200 -- [-2076.054] (-2071.096) (-2077.588) (-2082.600) * (-2095.451) (-2076.510) (-2086.373) [-2069.219] -- 0:01:45
628300 -- (-2080.147) (-2074.273) [-2085.865] (-2077.869) * (-2092.281) [-2076.920] (-2081.805) (-2078.585) -- 0:01:45
628400 -- (-2082.494) (-2072.618) [-2070.922] (-2084.862) * (-2083.369) [-2071.775] (-2087.468) (-2073.385) -- 0:01:45
628500 -- (-2075.734) (-2072.519) [-2071.436] (-2091.369) * (-2085.611) [-2071.325] (-2087.188) (-2070.270) -- 0:01:45
628600 -- (-2074.566) (-2074.128) [-2074.351] (-2087.743) * (-2080.658) [-2071.599] (-2076.342) (-2066.935) -- 0:01:45
628700 -- (-2074.893) (-2073.840) [-2078.093] (-2083.073) * (-2103.706) [-2079.679] (-2078.946) (-2074.618) -- 0:01:45
628800 -- [-2077.128] (-2077.017) (-2091.924) (-2081.787) * (-2097.325) [-2077.084] (-2075.615) (-2078.734) -- 0:01:45
628900 -- [-2076.792] (-2083.601) (-2077.027) (-2082.877) * (-2080.011) (-2073.207) (-2076.444) [-2071.473] -- 0:01:45
629000 -- (-2082.327) [-2074.512] (-2077.905) (-2080.169) * (-2081.807) (-2074.301) (-2078.177) [-2077.203] -- 0:01:45
Average standard deviation of split frequencies: 0.005929
629100 -- (-2082.105) [-2071.400] (-2076.626) (-2085.184) * (-2078.726) [-2074.436] (-2081.605) (-2076.752) -- 0:01:45
629200 -- (-2082.166) (-2076.099) [-2071.192] (-2085.333) * (-2076.206) [-2072.959] (-2084.214) (-2085.384) -- 0:01:45
629300 -- (-2085.155) (-2083.209) (-2076.568) [-2074.253] * [-2074.205] (-2081.342) (-2079.627) (-2088.302) -- 0:01:45
629400 -- (-2082.637) (-2082.428) (-2078.813) [-2076.579] * (-2078.847) [-2075.695] (-2082.430) (-2077.422) -- 0:01:45
629500 -- (-2083.606) (-2079.015) [-2070.951] (-2082.554) * (-2078.018) [-2075.288] (-2088.693) (-2078.088) -- 0:01:45
629600 -- (-2085.209) (-2076.742) [-2072.208] (-2076.262) * [-2078.281] (-2082.492) (-2093.701) (-2078.482) -- 0:01:45
629700 -- (-2090.544) [-2071.925] (-2074.134) (-2085.239) * (-2079.143) (-2079.527) (-2087.906) [-2078.410] -- 0:01:45
629800 -- (-2081.024) [-2073.577] (-2079.425) (-2087.764) * (-2081.498) [-2072.510] (-2079.494) (-2075.220) -- 0:01:45
629900 -- (-2081.486) (-2071.959) (-2078.241) [-2083.564] * (-2079.443) (-2071.218) [-2080.498] (-2084.827) -- 0:01:45
630000 -- (-2086.334) [-2076.193] (-2080.481) (-2083.896) * [-2081.761] (-2074.129) (-2078.721) (-2087.173) -- 0:01:45
Average standard deviation of split frequencies: 0.005899
630100 -- [-2075.412] (-2081.330) (-2094.987) (-2085.572) * (-2097.085) [-2072.120] (-2079.474) (-2095.059) -- 0:01:45
630200 -- (-2087.893) (-2083.629) [-2075.904] (-2103.092) * (-2086.152) [-2072.351] (-2078.688) (-2086.230) -- 0:01:45
630300 -- (-2079.616) (-2088.015) [-2082.756] (-2082.586) * (-2079.122) (-2071.114) [-2079.685] (-2084.487) -- 0:01:44
630400 -- (-2082.297) [-2078.632] (-2073.587) (-2086.971) * (-2085.816) [-2075.099] (-2078.246) (-2077.694) -- 0:01:44
630500 -- (-2078.201) (-2077.568) [-2071.050] (-2091.513) * (-2087.145) (-2071.269) (-2077.778) [-2074.412] -- 0:01:44
630600 -- (-2077.460) [-2075.724] (-2078.890) (-2089.843) * (-2087.119) (-2073.823) [-2074.128] (-2078.166) -- 0:01:44
630700 -- (-2079.367) [-2074.869] (-2078.870) (-2084.046) * (-2081.129) (-2077.651) (-2076.605) [-2072.211] -- 0:01:44
630800 -- [-2074.311] (-2081.857) (-2088.414) (-2081.670) * (-2079.975) [-2071.331] (-2079.060) (-2077.092) -- 0:01:44
630900 -- (-2078.306) (-2068.766) [-2078.249] (-2079.076) * (-2082.951) (-2074.835) (-2085.457) [-2073.350] -- 0:01:44
631000 -- (-2075.662) [-2073.300] (-2077.323) (-2091.846) * (-2088.438) (-2070.145) (-2083.439) [-2078.561] -- 0:01:44
Average standard deviation of split frequencies: 0.005697
631100 -- (-2076.894) (-2086.504) (-2069.373) [-2080.198] * (-2076.911) [-2077.173] (-2081.283) (-2084.585) -- 0:01:44
631200 -- (-2079.902) [-2075.206] (-2079.299) (-2093.165) * (-2078.949) [-2067.098] (-2088.836) (-2076.867) -- 0:01:44
631300 -- [-2078.974] (-2073.963) (-2078.006) (-2085.378) * (-2079.975) [-2070.753] (-2089.421) (-2080.591) -- 0:01:45
631400 -- (-2080.404) [-2070.947] (-2078.774) (-2081.392) * (-2091.016) [-2070.225] (-2089.933) (-2076.528) -- 0:01:45
631500 -- (-2078.833) [-2069.785] (-2073.717) (-2080.793) * (-2080.896) [-2073.411] (-2087.668) (-2077.937) -- 0:01:45
631600 -- (-2081.271) (-2074.232) (-2077.915) [-2072.590] * (-2077.578) (-2074.439) (-2088.986) [-2072.217] -- 0:01:44
631700 -- (-2085.162) [-2073.517] (-2072.913) (-2078.433) * (-2087.154) [-2075.247] (-2084.625) (-2073.596) -- 0:01:44
631800 -- (-2084.951) [-2075.364] (-2077.818) (-2083.980) * [-2079.182] (-2070.739) (-2082.448) (-2079.966) -- 0:01:44
631900 -- [-2075.147] (-2082.293) (-2077.624) (-2080.315) * (-2078.430) (-2070.963) (-2085.780) [-2072.621] -- 0:01:44
632000 -- (-2081.654) (-2082.173) [-2075.578] (-2085.489) * (-2078.949) (-2072.494) (-2088.516) [-2073.560] -- 0:01:44
Average standard deviation of split frequencies: 0.005604
632100 -- [-2073.952] (-2076.936) (-2070.719) (-2078.445) * (-2077.934) [-2071.865] (-2079.678) (-2072.300) -- 0:01:44
632200 -- (-2074.293) (-2073.221) [-2074.601] (-2081.974) * (-2080.543) [-2073.909] (-2088.080) (-2076.819) -- 0:01:44
632300 -- (-2072.056) [-2075.387] (-2074.249) (-2076.498) * (-2085.817) (-2080.223) (-2086.199) [-2073.755] -- 0:01:44
632400 -- [-2070.526] (-2082.497) (-2073.697) (-2081.585) * (-2082.667) (-2072.641) (-2092.842) [-2076.235] -- 0:01:44
632500 -- [-2072.493] (-2081.657) (-2080.079) (-2078.973) * (-2085.030) [-2078.562] (-2085.156) (-2070.862) -- 0:01:44
632600 -- (-2069.717) (-2094.640) [-2072.733] (-2075.514) * (-2087.338) [-2078.004] (-2080.077) (-2070.133) -- 0:01:44
632700 -- (-2077.172) (-2095.500) [-2077.395] (-2081.718) * (-2084.128) [-2076.256] (-2081.705) (-2070.427) -- 0:01:44
632800 -- (-2079.823) (-2076.830) [-2075.307] (-2081.639) * (-2095.303) [-2077.489] (-2079.653) (-2072.952) -- 0:01:44
632900 -- [-2077.197] (-2077.692) (-2078.885) (-2076.990) * (-2091.251) (-2072.445) (-2078.957) [-2070.465] -- 0:01:44
633000 -- (-2074.663) [-2074.416] (-2078.070) (-2080.880) * (-2100.851) [-2078.510] (-2080.601) (-2071.842) -- 0:01:44
Average standard deviation of split frequencies: 0.005743
633100 -- [-2076.151] (-2076.237) (-2075.021) (-2085.997) * (-2088.958) [-2073.416] (-2081.535) (-2074.045) -- 0:01:44
633200 -- (-2079.443) (-2079.893) [-2077.170] (-2084.164) * (-2081.431) [-2073.433] (-2083.001) (-2074.364) -- 0:01:44
633300 -- [-2072.936] (-2088.242) (-2072.519) (-2088.510) * (-2078.862) (-2074.536) (-2077.820) [-2071.360] -- 0:01:44
633400 -- [-2075.510] (-2080.514) (-2074.909) (-2098.135) * [-2080.250] (-2071.374) (-2084.218) (-2079.085) -- 0:01:44
633500 -- (-2075.427) (-2080.564) [-2076.688] (-2089.502) * (-2087.088) [-2073.885] (-2084.430) (-2076.992) -- 0:01:44
633600 -- [-2073.131] (-2073.770) (-2074.237) (-2080.732) * (-2078.934) [-2079.653] (-2085.003) (-2074.160) -- 0:01:44
633700 -- (-2075.706) [-2078.044] (-2073.936) (-2083.868) * (-2080.957) (-2078.811) (-2080.870) [-2069.740] -- 0:01:44
633800 -- (-2083.920) (-2082.177) [-2076.590] (-2082.876) * (-2075.439) [-2083.846] (-2084.277) (-2071.676) -- 0:01:44
633900 -- (-2079.078) (-2078.846) [-2074.483] (-2083.675) * (-2082.892) (-2080.647) (-2087.961) [-2075.426] -- 0:01:43
634000 -- (-2083.231) (-2068.265) [-2077.352] (-2084.390) * (-2086.723) (-2079.810) (-2082.075) [-2074.072] -- 0:01:43
Average standard deviation of split frequencies: 0.005692
634100 -- (-2081.657) (-2074.008) [-2077.981] (-2090.598) * (-2082.115) (-2073.271) (-2077.092) [-2070.643] -- 0:01:43
634200 -- (-2080.380) (-2069.908) (-2073.922) [-2082.469] * [-2078.878] (-2074.031) (-2076.058) (-2075.526) -- 0:01:43
634300 -- (-2080.012) [-2071.809] (-2074.671) (-2082.262) * (-2081.497) (-2077.653) (-2084.965) [-2071.280] -- 0:01:43
634400 -- (-2077.580) (-2073.119) [-2072.031] (-2083.203) * (-2073.720) [-2076.762] (-2096.459) (-2077.892) -- 0:01:43
634500 -- (-2080.625) [-2076.068] (-2077.128) (-2080.694) * (-2080.308) (-2073.821) (-2099.409) [-2074.171] -- 0:01:43
634600 -- [-2082.483] (-2076.323) (-2075.160) (-2084.913) * (-2086.675) (-2074.655) (-2087.484) [-2075.404] -- 0:01:43
634700 -- (-2076.007) [-2068.425] (-2072.893) (-2087.691) * (-2090.687) (-2073.598) (-2092.110) [-2073.483] -- 0:01:44
634800 -- (-2077.236) (-2072.803) [-2073.057] (-2077.277) * [-2076.540] (-2075.994) (-2086.817) (-2072.644) -- 0:01:44
634900 -- (-2081.595) [-2070.654] (-2075.377) (-2079.846) * (-2083.649) (-2082.952) (-2078.169) [-2076.829] -- 0:01:44
635000 -- (-2078.560) [-2068.978] (-2073.163) (-2080.798) * [-2075.169] (-2084.921) (-2081.133) (-2075.637) -- 0:01:44
Average standard deviation of split frequencies: 0.005492
635100 -- (-2087.263) (-2067.512) [-2075.526] (-2081.434) * [-2075.768] (-2074.075) (-2081.012) (-2078.526) -- 0:01:43
635200 -- (-2090.596) [-2068.562] (-2078.167) (-2083.296) * (-2083.524) [-2075.490] (-2081.346) (-2073.950) -- 0:01:43
635300 -- (-2077.965) [-2073.153] (-2084.380) (-2082.949) * (-2087.944) [-2077.213] (-2085.554) (-2078.180) -- 0:01:43
635400 -- (-2086.671) [-2072.401] (-2076.497) (-2080.559) * (-2089.874) (-2072.853) [-2085.470] (-2079.781) -- 0:01:43
635500 -- (-2089.254) (-2078.688) [-2077.276] (-2076.454) * (-2079.373) (-2073.433) (-2076.305) [-2074.396] -- 0:01:43
635600 -- (-2084.979) [-2075.827] (-2078.094) (-2091.987) * (-2087.521) (-2081.253) (-2085.400) [-2072.376] -- 0:01:43
635700 -- (-2088.888) (-2078.946) (-2075.793) [-2087.016] * (-2078.121) [-2079.581] (-2079.161) (-2088.690) -- 0:01:43
635800 -- (-2085.733) [-2076.048] (-2079.004) (-2084.833) * (-2079.321) (-2073.827) [-2075.854] (-2086.770) -- 0:01:43
635900 -- (-2082.657) (-2077.393) [-2074.727] (-2071.504) * (-2088.703) (-2084.251) [-2074.052] (-2084.172) -- 0:01:43
636000 -- (-2081.154) [-2080.181] (-2070.858) (-2074.739) * [-2080.874] (-2079.791) (-2073.744) (-2075.254) -- 0:01:43
Average standard deviation of split frequencies: 0.005590
636100 -- (-2083.398) (-2077.753) [-2069.042] (-2077.482) * (-2083.641) (-2079.812) (-2075.846) [-2076.243] -- 0:01:43
636200 -- (-2086.894) (-2073.751) (-2072.570) [-2079.223] * (-2083.346) (-2083.337) (-2077.556) [-2074.111] -- 0:01:43
636300 -- (-2086.172) [-2071.823] (-2076.214) (-2082.446) * (-2079.916) (-2078.175) [-2075.890] (-2076.889) -- 0:01:43
636400 -- (-2088.148) (-2076.261) [-2075.739] (-2082.483) * (-2079.678) [-2075.354] (-2084.095) (-2086.641) -- 0:01:43
636500 -- (-2079.450) [-2076.816] (-2071.376) (-2083.796) * (-2081.964) (-2075.651) (-2076.421) [-2084.169] -- 0:01:43
636600 -- (-2083.478) [-2078.274] (-2071.538) (-2093.435) * (-2087.181) (-2073.744) (-2081.056) [-2077.602] -- 0:01:43
636700 -- (-2089.964) [-2075.286] (-2068.949) (-2082.096) * (-2085.952) [-2073.585] (-2084.671) (-2074.922) -- 0:01:43
636800 -- (-2087.594) (-2080.225) [-2071.710] (-2089.870) * (-2081.050) (-2075.354) (-2081.753) [-2074.344] -- 0:01:43
636900 -- (-2076.238) (-2079.243) [-2074.338] (-2082.357) * (-2077.475) (-2078.432) (-2082.193) [-2074.043] -- 0:01:43
637000 -- (-2076.447) (-2085.715) [-2067.407] (-2076.501) * [-2076.547] (-2074.486) (-2082.361) (-2073.558) -- 0:01:43
Average standard deviation of split frequencies: 0.005623
637100 -- (-2074.076) [-2075.952] (-2073.469) (-2077.300) * (-2082.765) (-2081.021) (-2082.649) [-2075.378] -- 0:01:43
637200 -- (-2092.200) (-2084.038) (-2075.884) [-2073.150] * (-2084.083) (-2079.417) (-2089.309) [-2076.340] -- 0:01:43
637300 -- (-2081.767) (-2073.323) [-2071.909] (-2076.654) * [-2075.550] (-2079.731) (-2072.640) (-2079.979) -- 0:01:43
637400 -- (-2087.929) (-2082.183) [-2073.604] (-2082.667) * (-2082.170) (-2079.157) [-2076.620] (-2076.467) -- 0:01:42
637500 -- (-2081.929) (-2090.272) [-2075.672] (-2079.397) * (-2078.566) (-2072.603) [-2077.531] (-2075.235) -- 0:01:42
637600 -- (-2075.401) (-2075.748) [-2072.282] (-2076.401) * (-2083.390) [-2071.939] (-2081.396) (-2077.919) -- 0:01:42
637700 -- (-2070.961) (-2083.278) [-2076.817] (-2079.782) * (-2079.362) (-2080.555) (-2076.991) [-2070.325] -- 0:01:42
637800 -- (-2073.306) (-2089.044) [-2075.806] (-2075.873) * [-2075.105] (-2072.787) (-2078.845) (-2075.515) -- 0:01:42
637900 -- [-2067.545] (-2089.402) (-2076.371) (-2081.780) * (-2081.068) (-2085.831) [-2075.541] (-2076.693) -- 0:01:42
638000 -- (-2076.150) [-2075.823] (-2080.241) (-2080.776) * [-2074.757] (-2086.537) (-2074.296) (-2075.133) -- 0:01:42
Average standard deviation of split frequencies: 0.005678
638100 -- [-2078.255] (-2088.546) (-2079.208) (-2080.337) * (-2076.994) (-2083.177) (-2078.179) [-2067.857] -- 0:01:42
638200 -- (-2075.468) [-2077.432] (-2080.137) (-2078.703) * (-2085.088) (-2079.193) [-2072.300] (-2069.339) -- 0:01:43
638300 -- (-2078.270) (-2077.435) [-2076.466] (-2081.373) * (-2085.249) (-2075.406) (-2075.021) [-2076.766] -- 0:01:43
638400 -- (-2073.512) (-2081.423) [-2073.279] (-2079.214) * (-2093.915) (-2071.715) [-2072.372] (-2069.994) -- 0:01:43
638500 -- (-2076.905) (-2083.891) [-2075.355] (-2076.141) * (-2094.629) (-2071.218) (-2085.406) [-2070.028] -- 0:01:43
638600 -- [-2077.919] (-2084.108) (-2087.277) (-2078.061) * (-2099.180) (-2081.381) (-2080.915) [-2072.750] -- 0:01:42
638700 -- (-2077.989) (-2084.303) (-2084.158) [-2078.292] * (-2091.158) [-2073.537] (-2075.317) (-2075.222) -- 0:01:42
638800 -- (-2083.941) (-2084.094) [-2076.972] (-2081.430) * (-2085.514) [-2077.128] (-2075.000) (-2071.720) -- 0:01:42
638900 -- [-2078.288] (-2075.681) (-2089.512) (-2082.759) * (-2079.644) [-2077.647] (-2078.167) (-2073.015) -- 0:01:42
639000 -- [-2071.492] (-2077.651) (-2075.286) (-2077.139) * (-2086.920) [-2071.110] (-2083.119) (-2073.375) -- 0:01:42
Average standard deviation of split frequencies: 0.005774
639100 -- (-2068.475) [-2073.675] (-2073.796) (-2074.043) * (-2084.226) (-2074.151) (-2082.370) [-2074.383] -- 0:01:42
639200 -- [-2069.696] (-2084.757) (-2077.946) (-2077.261) * (-2084.889) [-2073.213] (-2078.238) (-2075.238) -- 0:01:42
639300 -- [-2076.641] (-2081.065) (-2078.036) (-2079.241) * (-2079.651) [-2070.589] (-2081.271) (-2074.649) -- 0:01:42
639400 -- (-2077.126) [-2077.056] (-2088.115) (-2081.366) * (-2076.354) [-2072.535] (-2078.065) (-2079.572) -- 0:01:42
639500 -- (-2079.613) (-2080.630) (-2079.674) [-2080.959] * (-2082.810) (-2070.395) (-2078.856) [-2073.606] -- 0:01:42
639600 -- [-2070.527] (-2083.782) (-2082.874) (-2085.981) * (-2083.810) [-2071.631] (-2075.441) (-2088.094) -- 0:01:42
639700 -- (-2075.185) (-2088.230) [-2074.274] (-2079.426) * (-2079.289) [-2071.496] (-2074.459) (-2091.432) -- 0:01:42
639800 -- [-2070.905] (-2083.708) (-2075.003) (-2076.740) * (-2083.457) [-2068.019] (-2080.444) (-2079.104) -- 0:01:42
639900 -- [-2071.745] (-2086.346) (-2075.423) (-2074.653) * (-2083.489) (-2073.627) (-2083.715) [-2073.030] -- 0:01:42
640000 -- [-2073.895] (-2084.387) (-2076.685) (-2078.244) * (-2074.199) [-2072.142] (-2080.065) (-2081.299) -- 0:01:42
Average standard deviation of split frequencies: 0.005744
640100 -- [-2070.456] (-2082.024) (-2071.525) (-2081.255) * [-2072.725] (-2072.921) (-2073.845) (-2074.202) -- 0:01:42
640200 -- [-2070.124] (-2085.501) (-2077.670) (-2090.317) * [-2072.636] (-2074.261) (-2079.806) (-2085.886) -- 0:01:42
640300 -- [-2070.517] (-2078.263) (-2072.728) (-2081.144) * (-2073.187) (-2084.651) (-2075.810) [-2076.395] -- 0:01:42
640400 -- [-2075.236] (-2079.171) (-2071.557) (-2077.215) * [-2074.358] (-2073.058) (-2079.922) (-2082.454) -- 0:01:42
640500 -- [-2077.022] (-2082.274) (-2071.482) (-2078.848) * (-2079.076) (-2076.041) [-2075.263] (-2073.513) -- 0:01:42
640600 -- (-2076.592) (-2077.860) (-2070.088) [-2074.038] * [-2073.646] (-2081.829) (-2080.751) (-2074.066) -- 0:01:42
640700 -- (-2080.880) (-2076.946) (-2071.689) [-2073.242] * (-2079.669) (-2088.793) (-2078.741) [-2072.781] -- 0:01:42
640800 -- (-2079.167) [-2073.018] (-2084.615) (-2078.811) * (-2084.326) (-2090.935) (-2080.741) [-2077.757] -- 0:01:42
640900 -- (-2078.871) (-2080.917) [-2075.117] (-2077.055) * (-2075.643) (-2081.815) (-2078.611) [-2076.468] -- 0:01:41
641000 -- (-2079.848) [-2074.932] (-2076.011) (-2079.237) * (-2080.047) (-2078.739) (-2078.143) [-2072.187] -- 0:01:41
Average standard deviation of split frequencies: 0.005587
641100 -- (-2071.912) [-2075.749] (-2079.832) (-2081.663) * (-2084.822) [-2079.161] (-2076.764) (-2074.432) -- 0:01:41
641200 -- [-2072.657] (-2080.101) (-2082.119) (-2084.595) * (-2076.189) (-2079.866) [-2070.976] (-2084.250) -- 0:01:41
641300 -- [-2071.578] (-2080.268) (-2080.201) (-2085.268) * (-2077.726) (-2078.197) [-2073.461] (-2084.425) -- 0:01:41
641400 -- (-2079.162) (-2080.164) [-2075.281] (-2074.574) * (-2077.444) [-2073.629] (-2080.975) (-2083.709) -- 0:01:41
641500 -- (-2071.670) [-2083.479] (-2074.135) (-2087.783) * (-2081.779) (-2073.329) [-2078.257] (-2079.727) -- 0:01:41
641600 -- [-2073.786] (-2086.282) (-2069.539) (-2080.261) * (-2083.632) (-2073.931) (-2091.903) [-2076.477] -- 0:01:42
641700 -- (-2085.395) (-2072.532) [-2073.211] (-2081.052) * (-2079.994) [-2072.333] (-2078.982) (-2075.565) -- 0:01:42
641800 -- [-2076.240] (-2080.291) (-2075.492) (-2078.644) * [-2074.928] (-2069.868) (-2081.902) (-2074.075) -- 0:01:42
641900 -- [-2075.998] (-2077.562) (-2085.633) (-2083.305) * (-2084.195) [-2074.138] (-2075.497) (-2072.771) -- 0:01:42
642000 -- [-2070.004] (-2075.347) (-2073.493) (-2080.462) * (-2098.531) [-2069.656] (-2076.348) (-2077.211) -- 0:01:42
Average standard deviation of split frequencies: 0.005684
642100 -- [-2072.837] (-2085.413) (-2072.588) (-2075.161) * (-2086.163) [-2078.743] (-2086.181) (-2081.961) -- 0:01:42
642200 -- (-2079.785) (-2081.952) [-2069.236] (-2086.343) * (-2078.473) [-2072.895] (-2084.222) (-2087.726) -- 0:01:41
642300 -- (-2078.495) (-2083.357) [-2072.527] (-2082.535) * (-2081.895) [-2071.619] (-2085.180) (-2087.471) -- 0:01:41
642400 -- (-2073.438) (-2084.073) [-2067.961] (-2078.069) * [-2078.891] (-2077.314) (-2083.410) (-2079.132) -- 0:01:41
642500 -- (-2081.355) (-2077.778) (-2066.467) [-2072.652] * (-2082.176) (-2073.568) (-2082.154) [-2074.595] -- 0:01:41
642600 -- (-2076.035) (-2077.718) (-2074.436) [-2074.444] * (-2087.379) (-2075.010) (-2087.855) [-2078.239] -- 0:01:41
642700 -- (-2080.385) (-2084.809) [-2074.996] (-2075.530) * (-2078.290) (-2074.690) (-2084.234) [-2069.487] -- 0:01:41
642800 -- (-2073.747) (-2079.521) [-2066.929] (-2079.746) * (-2080.318) (-2082.409) [-2072.706] (-2074.804) -- 0:01:41
642900 -- (-2080.361) [-2082.147] (-2072.156) (-2074.338) * (-2090.031) (-2083.823) (-2074.943) [-2073.252] -- 0:01:41
643000 -- (-2082.726) (-2077.317) [-2070.589] (-2073.527) * (-2088.333) (-2075.705) (-2079.997) [-2070.795] -- 0:01:41
Average standard deviation of split frequencies: 0.005633
643100 -- [-2079.725] (-2080.426) (-2072.004) (-2077.286) * (-2088.609) [-2078.190] (-2076.926) (-2073.271) -- 0:01:41
643200 -- (-2076.015) (-2077.318) [-2070.279] (-2082.149) * (-2082.292) (-2073.546) (-2085.113) [-2070.690] -- 0:01:41
643300 -- (-2076.028) (-2074.594) [-2069.598] (-2079.820) * (-2079.061) (-2072.990) (-2079.736) [-2072.986] -- 0:01:41
643400 -- (-2071.813) (-2078.706) [-2073.782] (-2076.581) * (-2085.796) (-2078.277) (-2082.497) [-2072.671] -- 0:01:41
643500 -- (-2071.698) (-2082.660) (-2072.934) [-2078.876] * (-2075.832) (-2078.488) (-2077.612) [-2075.260] -- 0:01:41
643600 -- [-2073.971] (-2079.234) (-2074.243) (-2081.909) * (-2077.159) [-2071.997] (-2077.894) (-2078.563) -- 0:01:41
643700 -- [-2068.267] (-2082.495) (-2068.996) (-2085.343) * (-2078.407) (-2073.480) (-2084.814) [-2074.240] -- 0:01:41
643800 -- [-2068.358] (-2073.399) (-2074.904) (-2084.884) * (-2074.583) (-2075.122) [-2077.675] (-2077.651) -- 0:01:41
643900 -- (-2073.658) [-2076.933] (-2079.134) (-2085.587) * [-2075.347] (-2076.538) (-2073.366) (-2084.468) -- 0:01:41
644000 -- [-2069.657] (-2079.673) (-2073.024) (-2085.270) * (-2082.363) (-2073.508) [-2072.179] (-2076.840) -- 0:01:41
Average standard deviation of split frequencies: 0.005541
644100 -- (-2074.427) (-2082.526) [-2070.654] (-2083.645) * [-2074.676] (-2071.502) (-2074.906) (-2078.820) -- 0:01:41
644200 -- [-2067.868] (-2076.027) (-2075.745) (-2085.535) * (-2079.818) (-2086.930) (-2075.251) [-2078.163] -- 0:01:41
644300 -- (-2072.208) (-2081.674) [-2074.832] (-2086.001) * (-2074.197) (-2090.460) [-2076.600] (-2077.502) -- 0:01:41
644400 -- (-2069.778) (-2077.637) [-2077.168] (-2087.814) * (-2080.355) (-2080.211) (-2077.086) [-2075.824] -- 0:01:40
644500 -- [-2069.761] (-2078.898) (-2071.192) (-2083.157) * (-2076.945) (-2076.890) (-2074.653) [-2075.742] -- 0:01:40
644600 -- [-2076.991] (-2072.700) (-2068.799) (-2080.555) * (-2081.340) (-2072.231) [-2073.381] (-2075.932) -- 0:01:40
644700 -- (-2075.214) (-2074.893) [-2071.609] (-2083.441) * (-2091.904) [-2071.532] (-2075.255) (-2074.007) -- 0:01:40
644800 -- [-2073.189] (-2074.661) (-2069.730) (-2084.431) * (-2084.556) [-2072.248] (-2075.809) (-2070.032) -- 0:01:40
644900 -- (-2079.812) (-2078.150) [-2071.999] (-2079.349) * (-2078.141) (-2071.480) (-2075.571) [-2074.737] -- 0:01:40
645000 -- [-2075.463] (-2073.661) (-2078.303) (-2078.056) * (-2077.299) (-2077.723) (-2082.051) [-2072.368] -- 0:01:40
Average standard deviation of split frequencies: 0.005615
645100 -- (-2075.361) (-2078.857) [-2078.941] (-2085.341) * [-2079.163] (-2082.340) (-2082.781) (-2074.525) -- 0:01:41
645200 -- [-2072.291] (-2077.771) (-2077.588) (-2081.003) * [-2077.030] (-2075.931) (-2077.860) (-2075.112) -- 0:01:41
645300 -- [-2071.745] (-2079.499) (-2075.663) (-2081.504) * (-2084.860) [-2077.684] (-2077.237) (-2077.896) -- 0:01:41
645400 -- (-2073.379) [-2074.181] (-2072.078) (-2079.314) * (-2078.063) (-2074.324) (-2082.784) [-2074.876] -- 0:01:41
645500 -- (-2075.519) [-2072.817] (-2079.516) (-2081.197) * (-2078.864) [-2077.733] (-2076.286) (-2077.186) -- 0:01:41
645600 -- [-2075.273] (-2081.502) (-2083.017) (-2086.755) * (-2078.644) [-2073.748] (-2077.326) (-2086.625) -- 0:01:41
645700 -- (-2073.292) (-2080.278) [-2074.049] (-2074.790) * [-2077.021] (-2071.980) (-2078.916) (-2081.850) -- 0:01:40
645800 -- (-2090.000) [-2080.367] (-2068.045) (-2077.674) * (-2086.037) [-2068.492] (-2078.530) (-2080.063) -- 0:01:40
645900 -- (-2089.314) (-2073.994) [-2074.526] (-2077.843) * (-2084.997) (-2071.471) (-2080.475) [-2074.191] -- 0:01:40
646000 -- (-2085.174) (-2076.776) (-2082.264) [-2074.127] * (-2089.189) [-2070.639] (-2078.090) (-2077.248) -- 0:01:40
Average standard deviation of split frequencies: 0.005753
646100 -- (-2084.044) [-2079.013] (-2073.635) (-2072.990) * (-2082.328) [-2071.729] (-2087.985) (-2077.940) -- 0:01:40
646200 -- (-2084.793) (-2083.232) (-2077.380) [-2074.442] * (-2088.785) [-2070.787] (-2078.183) (-2082.420) -- 0:01:40
646300 -- (-2081.076) (-2079.801) [-2075.172] (-2077.953) * (-2080.909) (-2082.732) [-2077.271] (-2089.991) -- 0:01:40
646400 -- (-2079.904) (-2078.457) [-2068.789] (-2073.384) * [-2077.925] (-2075.655) (-2078.745) (-2078.246) -- 0:01:40
646500 -- (-2083.933) (-2078.263) [-2072.480] (-2072.366) * (-2078.073) [-2074.886] (-2082.467) (-2077.967) -- 0:01:40
646600 -- (-2087.883) (-2075.609) [-2071.995] (-2079.983) * (-2079.553) [-2074.241] (-2084.929) (-2080.003) -- 0:01:40
646700 -- (-2086.368) [-2075.337] (-2072.695) (-2080.699) * (-2082.565) [-2082.167] (-2077.257) (-2078.490) -- 0:01:40
646800 -- (-2079.012) (-2076.294) [-2069.991] (-2078.061) * (-2087.630) (-2075.762) (-2073.037) [-2073.775] -- 0:01:40
646900 -- (-2070.767) (-2083.761) [-2069.262] (-2084.558) * (-2092.022) [-2072.792] (-2077.061) (-2076.881) -- 0:01:40
647000 -- (-2073.897) (-2079.262) [-2076.280] (-2081.366) * (-2088.272) [-2069.818] (-2075.044) (-2075.135) -- 0:01:40
Average standard deviation of split frequencies: 0.005869
647100 -- [-2068.286] (-2078.444) (-2082.376) (-2080.329) * (-2099.985) [-2070.749] (-2075.588) (-2077.734) -- 0:01:40
647200 -- (-2071.177) (-2083.056) [-2074.527] (-2082.547) * (-2086.094) (-2077.638) [-2079.984] (-2077.129) -- 0:01:40
647300 -- (-2076.304) (-2082.443) [-2073.522] (-2090.485) * (-2085.689) (-2077.753) (-2086.300) [-2077.171] -- 0:01:40
647400 -- (-2077.809) (-2078.649) (-2077.671) [-2081.528] * (-2085.511) (-2076.482) [-2078.893] (-2076.752) -- 0:01:40
647500 -- [-2075.126] (-2075.140) (-2075.176) (-2093.389) * (-2082.704) (-2068.535) (-2086.351) [-2073.647] -- 0:01:40
647600 -- (-2087.974) [-2073.351] (-2075.383) (-2081.483) * (-2078.148) (-2078.009) (-2079.142) [-2071.575] -- 0:01:40
647700 -- (-2077.330) [-2072.133] (-2071.569) (-2080.039) * (-2076.415) (-2081.389) [-2084.468] (-2073.078) -- 0:01:40
647800 -- (-2069.998) (-2079.601) [-2074.354] (-2090.940) * (-2086.618) [-2079.627] (-2079.598) (-2077.019) -- 0:01:40
647900 -- [-2069.354] (-2077.432) (-2074.283) (-2082.873) * (-2087.224) (-2079.645) (-2078.477) [-2072.348] -- 0:01:39
648000 -- [-2073.206] (-2083.593) (-2072.172) (-2090.665) * (-2090.345) (-2078.302) (-2079.328) [-2070.034] -- 0:01:39
Average standard deviation of split frequencies: 0.006026
648100 -- [-2075.528] (-2079.637) (-2077.813) (-2085.879) * (-2086.525) (-2084.737) (-2080.251) [-2069.958] -- 0:01:39
648200 -- (-2079.548) (-2079.092) [-2073.269] (-2085.480) * (-2078.725) (-2082.801) (-2074.448) [-2073.216] -- 0:01:39
648300 -- (-2076.023) (-2086.847) [-2075.479] (-2080.342) * (-2083.126) (-2083.379) [-2073.611] (-2074.515) -- 0:01:39
648400 -- [-2068.863] (-2080.867) (-2076.447) (-2081.386) * (-2080.900) (-2085.383) (-2080.183) [-2066.258] -- 0:01:39
648500 -- [-2069.295] (-2075.487) (-2078.905) (-2080.451) * (-2075.531) (-2078.846) (-2085.554) [-2073.517] -- 0:01:40
648600 -- (-2082.085) (-2078.970) (-2081.746) [-2077.055] * (-2079.122) (-2077.479) (-2077.964) [-2071.342] -- 0:01:40
648700 -- [-2071.744] (-2079.523) (-2077.605) (-2077.977) * (-2078.841) (-2081.158) (-2077.653) [-2070.283] -- 0:01:40
648800 -- (-2072.643) (-2086.497) [-2077.346] (-2088.498) * (-2087.382) (-2086.850) (-2085.451) [-2070.779] -- 0:01:40
648900 -- (-2076.170) (-2078.657) (-2083.284) [-2077.631] * (-2098.629) (-2082.011) (-2079.134) [-2072.913] -- 0:01:40
649000 -- (-2076.861) [-2074.481] (-2082.080) (-2082.705) * (-2087.295) [-2079.151] (-2074.113) (-2072.134) -- 0:01:40
Average standard deviation of split frequencies: 0.005934
649100 -- [-2069.681] (-2083.943) (-2081.206) (-2083.498) * (-2091.551) (-2081.974) (-2076.916) [-2068.617] -- 0:01:40
649200 -- [-2070.381] (-2076.772) (-2073.395) (-2079.908) * (-2096.729) (-2088.367) (-2080.715) [-2073.830] -- 0:01:39
649300 -- (-2067.522) (-2076.098) [-2068.261] (-2083.883) * (-2085.265) (-2085.780) [-2079.788] (-2071.701) -- 0:01:39
649400 -- [-2066.703] (-2075.805) (-2070.241) (-2089.520) * (-2092.587) (-2080.879) (-2078.476) [-2070.507] -- 0:01:39
649500 -- [-2069.408] (-2083.086) (-2072.991) (-2079.889) * (-2089.555) (-2087.323) (-2080.529) [-2072.759] -- 0:01:39
649600 -- [-2076.643] (-2074.464) (-2081.386) (-2085.899) * (-2085.594) (-2081.952) (-2080.866) [-2074.889] -- 0:01:39
649700 -- (-2074.019) [-2078.439] (-2077.581) (-2082.035) * (-2080.534) (-2079.442) [-2077.711] (-2075.092) -- 0:01:39
649800 -- [-2072.067] (-2083.866) (-2091.182) (-2086.115) * (-2083.782) [-2072.626] (-2082.470) (-2082.858) -- 0:01:39
649900 -- [-2073.320] (-2086.712) (-2088.228) (-2092.855) * (-2101.938) (-2075.744) (-2083.498) [-2069.264] -- 0:01:39
650000 -- [-2075.330] (-2090.701) (-2080.847) (-2090.626) * (-2093.044) (-2073.901) (-2085.405) [-2075.771] -- 0:01:39
Average standard deviation of split frequencies: 0.005801
650100 -- [-2071.682] (-2091.830) (-2077.620) (-2079.674) * (-2084.118) [-2071.652] (-2083.781) (-2084.635) -- 0:01:39
650200 -- (-2071.896) (-2086.485) (-2087.238) [-2074.393] * (-2086.345) [-2071.258] (-2082.647) (-2076.744) -- 0:01:39
650300 -- (-2076.423) (-2075.336) (-2080.795) [-2074.911] * (-2081.316) [-2073.727] (-2084.305) (-2077.498) -- 0:01:39
650400 -- [-2068.544] (-2075.949) (-2081.284) (-2078.806) * (-2077.340) [-2075.335] (-2101.989) (-2074.064) -- 0:01:39
650500 -- (-2074.024) [-2081.331] (-2077.374) (-2083.063) * (-2077.963) (-2083.993) (-2097.436) [-2074.228] -- 0:01:39
650600 -- (-2071.668) (-2079.392) [-2082.833] (-2078.118) * (-2078.399) (-2080.911) (-2092.841) [-2073.071] -- 0:01:39
650700 -- [-2073.049] (-2079.587) (-2081.813) (-2093.350) * [-2078.959] (-2083.623) (-2090.316) (-2074.999) -- 0:01:39
650800 -- [-2070.010] (-2086.375) (-2071.093) (-2095.617) * (-2074.823) (-2082.726) (-2094.920) [-2078.722] -- 0:01:39
650900 -- [-2067.299] (-2099.061) (-2076.371) (-2097.160) * (-2073.607) (-2088.092) (-2083.458) [-2077.777] -- 0:01:39
651000 -- [-2067.366] (-2089.191) (-2074.933) (-2086.667) * (-2079.349) (-2081.077) (-2082.178) [-2077.369] -- 0:01:39
Average standard deviation of split frequencies: 0.005771
651100 -- (-2069.763) (-2082.854) [-2069.657] (-2082.941) * [-2079.339] (-2084.230) (-2078.508) (-2073.469) -- 0:01:39
651200 -- (-2073.219) (-2077.299) [-2070.695] (-2086.653) * (-2079.452) (-2083.039) (-2078.344) [-2077.787] -- 0:01:39
651300 -- (-2071.125) (-2078.876) [-2077.155] (-2086.706) * (-2086.825) (-2083.885) (-2085.632) [-2071.847] -- 0:01:39
651400 -- (-2074.760) [-2080.328] (-2079.338) (-2094.390) * (-2080.105) (-2078.578) (-2082.137) [-2071.131] -- 0:01:39
651500 -- (-2073.086) [-2079.217] (-2080.566) (-2086.801) * (-2079.990) (-2087.441) [-2076.407] (-2078.887) -- 0:01:38
651600 -- (-2078.975) [-2083.596] (-2091.679) (-2077.852) * (-2079.933) (-2082.193) [-2075.549] (-2067.308) -- 0:01:38
651700 -- (-2078.660) (-2074.519) [-2076.643] (-2082.474) * (-2077.735) (-2080.487) (-2086.945) [-2072.852] -- 0:01:38
651800 -- (-2081.806) (-2076.197) [-2068.643] (-2082.846) * (-2079.345) [-2075.910] (-2085.663) (-2080.353) -- 0:01:38
651900 -- [-2079.489] (-2076.343) (-2070.485) (-2082.536) * (-2083.605) [-2081.588] (-2087.272) (-2078.049) -- 0:01:38
652000 -- [-2073.876] (-2086.752) (-2074.443) (-2084.338) * (-2084.630) (-2085.789) (-2083.536) [-2069.657] -- 0:01:39
Average standard deviation of split frequencies: 0.005783
652100 -- (-2077.871) (-2091.276) [-2075.418] (-2087.148) * [-2076.034] (-2084.645) (-2088.135) (-2077.631) -- 0:01:39
652200 -- (-2071.004) (-2092.383) [-2075.985] (-2084.676) * (-2079.385) (-2088.187) (-2077.885) [-2077.344] -- 0:01:39
652300 -- [-2073.902] (-2088.987) (-2076.197) (-2083.293) * [-2081.504] (-2081.487) (-2085.460) (-2082.841) -- 0:01:39
652400 -- [-2071.888] (-2082.901) (-2076.400) (-2083.898) * (-2082.286) (-2084.027) (-2073.352) [-2071.664] -- 0:01:39
652500 -- [-2069.973] (-2091.427) (-2082.074) (-2081.495) * (-2077.844) (-2088.070) (-2080.038) [-2073.586] -- 0:01:39
652600 -- [-2070.742] (-2077.588) (-2075.995) (-2090.836) * (-2077.786) (-2080.396) (-2085.088) [-2073.937] -- 0:01:39
652700 -- [-2075.129] (-2077.652) (-2079.648) (-2089.929) * (-2082.984) (-2073.545) (-2080.361) [-2070.267] -- 0:01:38
652800 -- [-2069.628] (-2078.256) (-2089.046) (-2088.998) * [-2075.515] (-2078.182) (-2078.389) (-2081.059) -- 0:01:38
652900 -- (-2072.785) (-2076.248) (-2081.199) [-2077.435] * [-2075.980] (-2072.038) (-2078.548) (-2072.172) -- 0:01:38
653000 -- [-2073.101] (-2076.075) (-2073.434) (-2087.829) * (-2080.508) (-2072.909) [-2078.366] (-2074.948) -- 0:01:38
Average standard deviation of split frequencies: 0.005938
653100 -- [-2072.213] (-2078.808) (-2078.826) (-2085.541) * (-2082.727) [-2068.722] (-2084.364) (-2074.463) -- 0:01:38
653200 -- (-2073.219) [-2075.850] (-2091.119) (-2076.064) * (-2078.272) (-2067.463) (-2087.256) [-2071.426] -- 0:01:38
653300 -- (-2074.725) (-2080.289) [-2077.221] (-2083.000) * (-2084.379) (-2073.526) (-2084.513) [-2070.909] -- 0:01:38
653400 -- [-2075.001] (-2080.819) (-2071.273) (-2082.943) * (-2071.613) (-2081.942) (-2076.641) [-2073.462] -- 0:01:38
653500 -- (-2072.161) (-2085.004) [-2076.885] (-2077.849) * (-2079.032) (-2072.283) (-2077.686) [-2069.797] -- 0:01:38
653600 -- (-2075.820) (-2081.990) [-2085.158] (-2094.095) * (-2079.958) (-2072.501) [-2075.367] (-2068.095) -- 0:01:38
653700 -- [-2074.192] (-2081.216) (-2074.530) (-2086.331) * [-2077.110] (-2078.919) (-2076.675) (-2072.476) -- 0:01:38
653800 -- (-2076.352) (-2086.581) [-2075.929] (-2086.665) * (-2077.871) (-2084.803) (-2084.611) [-2070.293] -- 0:01:38
653900 -- [-2068.674] (-2085.210) (-2080.742) (-2085.784) * (-2076.740) (-2074.047) (-2077.305) [-2073.528] -- 0:01:38
654000 -- (-2067.526) (-2084.366) (-2086.650) [-2085.035] * (-2081.236) [-2070.909] (-2075.106) (-2077.210) -- 0:01:38
Average standard deviation of split frequencies: 0.005539
654100 -- [-2067.360] (-2074.355) (-2079.871) (-2077.759) * (-2076.775) [-2073.693] (-2084.858) (-2076.901) -- 0:01:38
654200 -- (-2073.785) (-2074.540) [-2078.585] (-2083.348) * (-2075.816) [-2069.926] (-2075.062) (-2072.084) -- 0:01:38
654300 -- [-2070.164] (-2079.091) (-2079.553) (-2078.035) * (-2077.344) (-2076.756) (-2080.109) [-2075.608] -- 0:01:38
654400 -- [-2072.642] (-2086.075) (-2072.403) (-2073.820) * (-2083.916) (-2074.364) (-2078.841) [-2068.119] -- 0:01:38
654500 -- [-2074.563] (-2085.918) (-2084.960) (-2076.974) * (-2092.729) (-2071.544) (-2077.586) [-2066.623] -- 0:01:38
654600 -- (-2075.915) (-2080.704) (-2076.766) [-2071.642] * (-2089.011) (-2068.167) (-2083.285) [-2069.227] -- 0:01:38
654700 -- (-2081.244) (-2080.302) (-2073.858) [-2071.610] * (-2084.775) [-2068.127] (-2078.421) (-2069.040) -- 0:01:38
654800 -- (-2090.071) (-2079.112) (-2081.509) [-2071.707] * (-2082.894) [-2069.896] (-2081.078) (-2073.117) -- 0:01:38
654900 -- (-2082.155) (-2075.502) (-2080.039) [-2083.050] * (-2080.039) [-2072.772] (-2081.016) (-2076.762) -- 0:01:38
655000 -- (-2084.502) [-2077.892] (-2082.307) (-2080.909) * (-2078.141) [-2071.781] (-2082.606) (-2075.483) -- 0:01:37
Average standard deviation of split frequencies: 0.005386
655100 -- (-2079.361) [-2073.102] (-2084.556) (-2083.359) * (-2080.892) (-2072.461) (-2081.101) [-2072.902] -- 0:01:37
655200 -- [-2073.380] (-2074.946) (-2084.697) (-2080.394) * (-2080.081) (-2073.298) (-2083.950) [-2076.970] -- 0:01:37
655300 -- (-2074.982) [-2075.759] (-2086.361) (-2074.459) * [-2074.119] (-2075.084) (-2088.246) (-2084.246) -- 0:01:37
655400 -- [-2069.191] (-2087.811) (-2095.707) (-2075.627) * (-2074.602) [-2072.672] (-2088.519) (-2081.107) -- 0:01:38
655500 -- [-2074.008] (-2080.746) (-2093.210) (-2078.498) * [-2078.286] (-2080.620) (-2093.014) (-2075.795) -- 0:01:38
655600 -- [-2068.570] (-2078.792) (-2085.135) (-2087.217) * (-2077.344) (-2078.280) (-2098.712) [-2074.311] -- 0:01:38
655700 -- (-2068.508) (-2086.127) (-2079.322) [-2075.087] * (-2075.078) [-2078.366] (-2086.652) (-2074.231) -- 0:01:38
655800 -- [-2070.394] (-2083.202) (-2081.848) (-2086.868) * (-2091.063) (-2079.551) (-2087.952) [-2070.027] -- 0:01:38
655900 -- [-2073.549] (-2084.798) (-2083.468) (-2082.998) * (-2080.749) [-2075.927] (-2087.626) (-2078.613) -- 0:01:38
656000 -- [-2071.772] (-2076.812) (-2083.164) (-2100.089) * [-2077.807] (-2077.814) (-2083.497) (-2086.512) -- 0:01:38
Average standard deviation of split frequencies: 0.005358
656100 -- [-2072.188] (-2078.395) (-2084.161) (-2094.513) * [-2081.678] (-2081.257) (-2088.711) (-2081.318) -- 0:01:38
656200 -- [-2068.994] (-2087.593) (-2079.495) (-2085.488) * [-2078.681] (-2084.526) (-2081.338) (-2078.572) -- 0:01:37
656300 -- (-2067.144) (-2081.113) [-2074.003] (-2075.223) * [-2079.232] (-2080.755) (-2079.143) (-2080.422) -- 0:01:37
656400 -- (-2074.357) [-2081.661] (-2072.713) (-2074.964) * (-2082.578) (-2087.201) (-2075.218) [-2072.652] -- 0:01:37
656500 -- (-2076.038) (-2079.954) (-2071.770) [-2072.538] * (-2079.621) (-2089.004) (-2077.315) [-2071.550] -- 0:01:37
656600 -- [-2073.107] (-2080.812) (-2075.529) (-2075.162) * [-2077.918] (-2090.182) (-2077.876) (-2077.264) -- 0:01:37
656700 -- [-2074.145] (-2095.488) (-2074.930) (-2071.999) * (-2082.201) (-2083.142) (-2086.099) [-2077.195] -- 0:01:37
656800 -- (-2075.345) (-2074.806) [-2073.072] (-2079.752) * (-2079.640) (-2079.397) (-2094.409) [-2074.888] -- 0:01:37
656900 -- (-2081.134) (-2081.415) (-2074.136) [-2079.999] * (-2077.550) [-2074.603] (-2082.220) (-2074.839) -- 0:01:37
657000 -- (-2075.970) [-2074.675] (-2076.632) (-2079.367) * (-2077.440) [-2073.720] (-2079.227) (-2078.650) -- 0:01:37
Average standard deviation of split frequencies: 0.005349
657100 -- (-2075.521) (-2080.120) [-2079.500] (-2082.489) * (-2076.176) [-2076.952] (-2082.403) (-2073.061) -- 0:01:37
657200 -- (-2077.258) (-2078.658) (-2072.667) [-2073.195] * (-2074.366) [-2077.901] (-2078.410) (-2075.821) -- 0:01:37
657300 -- (-2074.878) (-2077.802) [-2079.314] (-2076.346) * (-2077.100) [-2072.951] (-2077.967) (-2070.883) -- 0:01:37
657400 -- [-2073.906] (-2078.469) (-2087.687) (-2081.485) * (-2086.651) [-2084.427] (-2079.796) (-2076.423) -- 0:01:37
657500 -- [-2077.107] (-2079.179) (-2072.136) (-2079.537) * [-2077.727] (-2078.904) (-2086.113) (-2081.222) -- 0:01:37
657600 -- (-2072.904) (-2083.008) (-2076.772) [-2071.358] * (-2080.634) (-2079.968) [-2080.312] (-2078.454) -- 0:01:37
657700 -- (-2072.542) (-2082.727) [-2073.406] (-2080.415) * [-2081.401] (-2079.846) (-2077.723) (-2078.609) -- 0:01:37
657800 -- (-2073.282) [-2077.090] (-2076.752) (-2078.722) * (-2080.927) (-2086.906) [-2076.300] (-2083.666) -- 0:01:37
657900 -- [-2067.541] (-2082.509) (-2074.684) (-2075.151) * (-2076.163) (-2083.700) [-2077.594] (-2085.692) -- 0:01:37
658000 -- [-2073.819] (-2084.184) (-2078.448) (-2069.185) * [-2079.407] (-2081.312) (-2075.971) (-2089.916) -- 0:01:37
Average standard deviation of split frequencies: 0.005485
658100 -- (-2073.978) (-2086.770) (-2079.947) [-2071.058] * (-2079.461) (-2086.920) [-2079.913] (-2086.343) -- 0:01:37
658200 -- (-2073.527) (-2085.739) (-2087.254) [-2068.892] * (-2075.873) [-2079.210] (-2078.317) (-2088.409) -- 0:01:37
658300 -- [-2076.531] (-2083.537) (-2081.043) (-2070.906) * (-2090.639) (-2080.389) (-2076.900) [-2079.015] -- 0:01:37
658400 -- (-2078.509) (-2078.288) [-2080.402] (-2073.827) * (-2087.632) (-2082.437) [-2077.965] (-2081.777) -- 0:01:37
658500 -- (-2079.878) [-2074.056] (-2078.161) (-2075.912) * (-2083.902) [-2079.902] (-2086.768) (-2078.035) -- 0:01:36
658600 -- (-2077.610) (-2077.943) [-2076.485] (-2072.564) * (-2081.768) [-2076.999] (-2077.520) (-2081.784) -- 0:01:36
658700 -- (-2079.224) (-2080.684) (-2081.795) [-2075.086] * (-2085.373) (-2083.844) (-2071.191) [-2076.147] -- 0:01:36
658800 -- (-2078.049) (-2085.257) [-2072.098] (-2082.263) * (-2086.479) (-2090.846) (-2079.364) [-2071.775] -- 0:01:36
658900 -- (-2080.920) (-2087.024) [-2070.569] (-2080.080) * (-2081.351) (-2083.789) (-2081.996) [-2075.991] -- 0:01:37
659000 -- (-2085.793) (-2083.468) [-2071.708] (-2081.479) * (-2081.343) (-2085.034) (-2076.114) [-2077.466] -- 0:01:37
Average standard deviation of split frequencies: 0.005394
659100 -- (-2080.808) (-2082.990) [-2075.292] (-2077.180) * [-2080.703] (-2086.313) (-2080.009) (-2075.350) -- 0:01:37
659200 -- [-2071.641] (-2088.726) (-2079.540) (-2078.197) * (-2075.349) (-2095.726) (-2086.019) [-2074.102] -- 0:01:37
659300 -- [-2074.200] (-2086.398) (-2078.018) (-2081.851) * (-2083.775) (-2084.346) (-2079.981) [-2080.893] -- 0:01:37
659400 -- (-2075.298) (-2086.137) [-2075.781] (-2078.686) * [-2074.162] (-2080.803) (-2081.069) (-2078.857) -- 0:01:37
659500 -- [-2070.177] (-2092.123) (-2082.263) (-2072.287) * [-2075.008] (-2079.989) (-2079.764) (-2078.743) -- 0:01:37
659600 -- [-2070.869] (-2077.368) (-2085.948) (-2080.410) * (-2082.244) [-2078.349] (-2083.969) (-2096.500) -- 0:01:37
659700 -- [-2071.130] (-2078.224) (-2088.460) (-2078.421) * (-2075.839) [-2076.558] (-2086.500) (-2083.603) -- 0:01:36
659800 -- [-2067.584] (-2073.590) (-2096.166) (-2076.102) * (-2092.810) (-2079.242) (-2084.646) [-2082.505] -- 0:01:36
659900 -- [-2073.367] (-2080.360) (-2078.591) (-2076.824) * (-2091.228) [-2081.501] (-2084.387) (-2082.917) -- 0:01:36
660000 -- [-2075.809] (-2075.689) (-2073.115) (-2079.309) * (-2095.281) [-2079.394] (-2080.536) (-2082.686) -- 0:01:36
Average standard deviation of split frequencies: 0.005386
660100 -- (-2079.244) (-2074.055) [-2076.569] (-2086.121) * (-2087.858) [-2074.638] (-2077.647) (-2089.646) -- 0:01:36
660200 -- [-2074.994] (-2085.357) (-2077.495) (-2085.808) * (-2081.345) (-2079.203) [-2076.712] (-2086.313) -- 0:01:36
660300 -- (-2076.146) (-2078.925) [-2073.042] (-2083.449) * [-2075.036] (-2085.779) (-2073.543) (-2080.498) -- 0:01:36
660400 -- (-2081.083) (-2076.483) [-2078.819] (-2089.055) * (-2078.977) (-2081.260) [-2074.328] (-2081.206) -- 0:01:36
660500 -- (-2079.265) [-2077.658] (-2078.913) (-2091.182) * (-2078.256) [-2080.252] (-2079.302) (-2081.744) -- 0:01:36
660600 -- (-2072.372) (-2080.651) [-2076.511] (-2086.227) * (-2085.347) (-2078.893) (-2075.078) [-2084.965] -- 0:01:36
660700 -- [-2070.833] (-2077.127) (-2076.639) (-2084.001) * (-2083.718) (-2088.018) [-2071.522] (-2084.930) -- 0:01:36
660800 -- (-2070.919) (-2075.890) [-2071.765] (-2083.621) * (-2081.217) (-2083.545) [-2073.345] (-2085.711) -- 0:01:36
660900 -- (-2078.910) (-2082.249) [-2070.812] (-2085.062) * [-2078.474] (-2083.071) (-2079.030) (-2090.401) -- 0:01:36
661000 -- [-2078.628] (-2078.493) (-2071.925) (-2089.509) * (-2078.633) (-2081.402) [-2079.837] (-2089.587) -- 0:01:36
Average standard deviation of split frequencies: 0.005378
661100 -- [-2071.193] (-2079.485) (-2082.677) (-2078.016) * (-2077.990) [-2080.499] (-2084.000) (-2083.770) -- 0:01:36
661200 -- (-2074.737) [-2079.189] (-2085.128) (-2078.849) * (-2084.078) [-2079.135] (-2088.093) (-2077.779) -- 0:01:36
661300 -- [-2070.877] (-2083.632) (-2082.318) (-2079.840) * [-2076.868] (-2081.068) (-2085.864) (-2077.910) -- 0:01:36
661400 -- [-2070.894] (-2085.139) (-2077.464) (-2078.930) * (-2076.341) [-2080.687] (-2080.339) (-2082.346) -- 0:01:36
661500 -- [-2073.934] (-2079.605) (-2072.849) (-2078.162) * [-2080.892] (-2079.743) (-2093.663) (-2081.446) -- 0:01:36
661600 -- (-2073.829) (-2086.229) (-2073.169) [-2073.362] * (-2077.597) (-2081.765) (-2084.735) [-2073.351] -- 0:01:36
661700 -- (-2073.783) [-2084.195] (-2083.630) (-2074.453) * (-2085.746) (-2077.405) (-2086.662) [-2078.043] -- 0:01:36
661800 -- (-2073.882) (-2078.483) [-2078.586] (-2080.368) * [-2073.883] (-2079.354) (-2074.641) (-2078.579) -- 0:01:36
661900 -- (-2084.280) (-2077.635) [-2069.954] (-2076.584) * (-2077.722) (-2084.921) (-2085.459) [-2081.184] -- 0:01:36
662000 -- [-2074.563] (-2080.140) (-2076.655) (-2079.723) * [-2077.183] (-2081.624) (-2083.093) (-2079.180) -- 0:01:35
Average standard deviation of split frequencies: 0.005411
662100 -- (-2077.236) (-2084.022) (-2075.162) [-2073.425] * (-2085.611) (-2073.139) (-2083.780) [-2076.162] -- 0:01:35
662200 -- [-2077.991] (-2085.214) (-2071.394) (-2073.021) * (-2083.286) [-2076.936] (-2081.723) (-2071.925) -- 0:01:35
662300 -- (-2081.502) (-2087.652) [-2074.164] (-2069.874) * (-2086.840) (-2079.502) [-2079.494] (-2083.776) -- 0:01:36
662400 -- [-2077.364] (-2084.930) (-2076.737) (-2069.415) * (-2093.080) (-2079.699) (-2083.607) [-2078.463] -- 0:01:36
662500 -- (-2077.544) (-2095.523) (-2073.522) [-2069.389] * [-2076.792] (-2073.875) (-2077.699) (-2084.256) -- 0:01:36
662600 -- (-2079.815) (-2089.896) [-2074.063] (-2074.284) * (-2075.432) (-2077.209) (-2076.748) [-2082.728] -- 0:01:36
662700 -- (-2073.908) (-2087.589) (-2072.262) [-2072.938] * (-2072.418) [-2073.942] (-2083.666) (-2085.217) -- 0:01:36
662800 -- [-2077.268] (-2095.532) (-2070.828) (-2084.076) * (-2087.514) [-2075.870] (-2080.166) (-2083.483) -- 0:01:36
662900 -- (-2076.579) (-2078.649) [-2074.419] (-2074.645) * (-2093.161) [-2080.133] (-2078.927) (-2081.205) -- 0:01:36
663000 -- (-2081.695) (-2083.504) (-2076.496) [-2075.045] * (-2077.397) (-2079.710) [-2074.776] (-2075.371) -- 0:01:36
Average standard deviation of split frequencies: 0.005504
663100 -- (-2082.700) (-2081.949) (-2075.668) [-2083.513] * (-2082.159) (-2075.730) (-2082.518) [-2075.129] -- 0:01:36
663200 -- [-2075.021] (-2086.501) (-2073.869) (-2087.988) * (-2078.238) (-2076.446) (-2078.179) [-2073.877] -- 0:01:35
663300 -- [-2083.681] (-2079.098) (-2072.965) (-2085.900) * (-2077.543) (-2075.258) (-2080.866) [-2074.684] -- 0:01:35
663400 -- (-2082.508) (-2092.021) [-2072.679] (-2072.219) * (-2082.059) (-2078.371) [-2072.096] (-2089.635) -- 0:01:35
663500 -- (-2082.347) (-2085.186) (-2072.367) [-2069.673] * (-2082.629) [-2076.724] (-2081.245) (-2083.785) -- 0:01:35
663600 -- (-2077.563) [-2077.061] (-2070.832) (-2073.224) * (-2082.647) (-2076.541) [-2076.524] (-2088.971) -- 0:01:35
663700 -- (-2078.520) [-2076.784] (-2071.601) (-2074.586) * (-2076.504) (-2075.697) [-2075.499] (-2087.325) -- 0:01:35
663800 -- [-2073.324] (-2082.641) (-2071.192) (-2074.850) * (-2094.195) (-2080.429) [-2083.713] (-2083.920) -- 0:01:35
663900 -- (-2080.085) [-2076.343] (-2071.735) (-2077.778) * (-2082.662) (-2075.173) [-2075.914] (-2087.249) -- 0:01:35
664000 -- (-2086.710) (-2080.263) [-2069.143] (-2073.638) * (-2084.310) [-2075.724] (-2081.936) (-2082.383) -- 0:01:35
Average standard deviation of split frequencies: 0.005334
664100 -- (-2074.452) (-2076.585) [-2067.321] (-2074.101) * (-2087.612) (-2074.625) [-2077.798] (-2085.448) -- 0:01:35
664200 -- [-2076.876] (-2085.259) (-2069.052) (-2077.599) * (-2083.391) (-2078.382) (-2079.284) [-2083.186] -- 0:01:35
664300 -- (-2084.621) (-2085.308) [-2070.763] (-2073.248) * (-2089.966) [-2076.636] (-2089.905) (-2085.074) -- 0:01:35
664400 -- (-2092.532) (-2083.911) [-2078.008] (-2079.445) * (-2089.619) (-2078.970) [-2082.635] (-2081.203) -- 0:01:35
664500 -- (-2089.158) [-2080.818] (-2077.358) (-2082.072) * (-2085.722) [-2077.638] (-2080.429) (-2083.900) -- 0:01:35
664600 -- (-2086.269) (-2077.574) [-2069.739] (-2074.574) * (-2083.895) (-2082.530) [-2083.523] (-2082.529) -- 0:01:35
664700 -- (-2083.007) (-2081.265) [-2076.672] (-2080.152) * (-2091.776) (-2082.872) [-2080.142] (-2079.352) -- 0:01:35
664800 -- (-2081.339) (-2079.708) [-2074.187] (-2077.333) * (-2084.993) [-2077.427] (-2077.569) (-2078.870) -- 0:01:35
664900 -- (-2084.691) (-2078.303) (-2071.684) [-2073.474] * (-2081.291) [-2080.207] (-2085.418) (-2080.467) -- 0:01:35
665000 -- (-2085.823) (-2079.484) (-2077.376) [-2079.214] * (-2080.276) (-2076.562) [-2082.846] (-2088.777) -- 0:01:35
Average standard deviation of split frequencies: 0.005507
665100 -- (-2084.740) (-2088.677) (-2074.557) [-2072.533] * (-2079.852) [-2079.496] (-2083.863) (-2085.275) -- 0:01:35
665200 -- (-2078.819) (-2082.226) (-2076.104) [-2068.927] * (-2082.947) (-2079.576) [-2083.935] (-2079.794) -- 0:01:35
665300 -- (-2079.988) (-2085.888) (-2071.130) [-2072.075] * (-2089.014) (-2079.429) [-2078.395] (-2082.215) -- 0:01:35
665400 -- (-2078.354) (-2085.191) [-2068.985] (-2088.508) * (-2085.169) [-2081.761] (-2080.201) (-2082.754) -- 0:01:35
665500 -- (-2077.859) (-2085.388) [-2076.223] (-2073.368) * (-2088.539) (-2079.381) (-2085.569) [-2076.824] -- 0:01:34
665600 -- (-2080.288) (-2082.245) [-2073.292] (-2072.252) * (-2092.432) (-2080.896) [-2077.101] (-2079.531) -- 0:01:34
665700 -- (-2073.606) (-2081.103) [-2074.796] (-2082.756) * (-2082.910) (-2076.855) [-2074.527] (-2078.032) -- 0:01:35
665800 -- [-2077.110] (-2084.950) (-2072.531) (-2078.134) * (-2090.491) (-2083.826) (-2071.684) [-2074.759] -- 0:01:35
665900 -- (-2084.339) (-2091.638) (-2078.408) [-2073.015] * (-2092.508) (-2086.621) [-2072.475] (-2085.409) -- 0:01:35
666000 -- (-2081.598) (-2086.939) (-2073.346) [-2077.500] * (-2083.959) (-2082.861) [-2072.472] (-2081.817) -- 0:01:35
Average standard deviation of split frequencies: 0.005500
666100 -- (-2078.971) [-2075.734] (-2078.836) (-2076.143) * (-2079.180) (-2088.856) (-2078.538) [-2076.950] -- 0:01:35
666200 -- (-2089.037) (-2081.419) [-2070.606] (-2086.063) * [-2077.674] (-2079.731) (-2076.779) (-2079.810) -- 0:01:35
666300 -- (-2077.466) (-2073.178) [-2068.092] (-2075.875) * (-2079.610) [-2079.062] (-2076.192) (-2079.605) -- 0:01:35
666400 -- (-2074.984) (-2079.372) (-2069.632) [-2069.086] * [-2079.350] (-2097.777) (-2080.732) (-2074.654) -- 0:01:35
666500 -- (-2080.618) (-2080.993) (-2075.526) [-2068.185] * (-2079.498) (-2081.906) (-2076.886) [-2073.459] -- 0:01:35
666600 -- [-2079.259] (-2079.439) (-2078.290) (-2068.058) * (-2079.393) (-2082.611) (-2076.385) [-2080.661] -- 0:01:35
666700 -- (-2075.591) (-2089.653) (-2074.213) [-2070.534] * (-2081.411) (-2087.572) (-2074.598) [-2079.455] -- 0:01:34
666800 -- (-2076.606) (-2083.767) (-2076.851) [-2070.204] * (-2076.639) (-2080.606) (-2087.999) [-2079.143] -- 0:01:34
666900 -- (-2078.185) (-2075.213) (-2072.103) [-2072.626] * (-2080.873) (-2078.734) (-2077.146) [-2078.004] -- 0:01:34
667000 -- (-2080.014) (-2073.652) [-2067.693] (-2070.528) * (-2085.141) (-2079.441) [-2082.081] (-2082.761) -- 0:01:34
Average standard deviation of split frequencies: 0.005511
667100 -- (-2086.655) (-2074.465) [-2070.012] (-2078.658) * [-2082.289] (-2077.603) (-2082.379) (-2082.464) -- 0:01:34
667200 -- (-2080.245) (-2076.544) [-2071.963] (-2081.990) * (-2076.586) [-2076.473] (-2078.604) (-2089.285) -- 0:01:34
667300 -- (-2085.902) (-2073.764) [-2073.380] (-2073.221) * [-2074.842] (-2082.915) (-2074.706) (-2085.933) -- 0:01:34
667400 -- (-2076.186) (-2074.909) [-2070.990] (-2074.244) * [-2071.726] (-2079.424) (-2077.842) (-2085.454) -- 0:01:34
667500 -- (-2080.983) (-2081.252) [-2069.018] (-2086.062) * [-2067.790] (-2086.548) (-2084.054) (-2086.786) -- 0:01:34
667600 -- (-2082.026) (-2083.675) [-2073.109] (-2083.340) * [-2073.993] (-2088.227) (-2082.928) (-2083.981) -- 0:01:34
667700 -- (-2076.704) (-2087.481) (-2069.095) [-2072.641] * (-2072.185) [-2082.737] (-2080.708) (-2085.804) -- 0:01:34
667800 -- (-2079.426) (-2091.328) (-2067.425) [-2071.958] * [-2073.485] (-2079.365) (-2087.124) (-2083.578) -- 0:01:34
667900 -- (-2080.839) (-2086.323) [-2069.292] (-2072.407) * (-2073.189) [-2073.579] (-2080.810) (-2075.391) -- 0:01:34
668000 -- [-2077.413] (-2087.131) (-2069.157) (-2069.168) * [-2070.966] (-2084.963) (-2084.535) (-2075.084) -- 0:01:34
Average standard deviation of split frequencies: 0.005362
668100 -- (-2082.760) (-2091.120) [-2072.623] (-2078.116) * [-2074.316] (-2078.655) (-2078.807) (-2077.838) -- 0:01:34
668200 -- (-2088.449) (-2074.419) [-2069.706] (-2075.478) * [-2070.991] (-2072.046) (-2080.945) (-2075.309) -- 0:01:34
668300 -- (-2077.182) (-2078.868) [-2073.720] (-2079.230) * [-2077.731] (-2075.390) (-2083.759) (-2075.073) -- 0:01:34
668400 -- (-2076.657) (-2080.112) [-2068.474] (-2080.660) * [-2078.239] (-2085.095) (-2087.290) (-2076.710) -- 0:01:34
668500 -- (-2074.700) [-2070.064] (-2070.753) (-2083.307) * [-2069.832] (-2082.911) (-2080.565) (-2078.422) -- 0:01:34
668600 -- (-2082.315) (-2076.206) [-2074.569] (-2078.616) * [-2072.273] (-2075.341) (-2094.232) (-2081.582) -- 0:01:34
668700 -- (-2082.290) [-2074.118] (-2077.601) (-2083.197) * (-2070.329) (-2076.758) (-2090.925) [-2076.215] -- 0:01:34
668800 -- (-2078.493) (-2073.478) (-2087.105) [-2078.021] * (-2067.141) (-2081.166) (-2090.527) [-2076.757] -- 0:01:34
668900 -- (-2073.795) [-2069.674] (-2085.385) (-2084.370) * [-2068.943] (-2088.700) (-2095.325) (-2078.444) -- 0:01:34
669000 -- (-2079.635) (-2078.706) (-2081.872) [-2068.532] * [-2068.504] (-2087.262) (-2091.541) (-2081.719) -- 0:01:34
Average standard deviation of split frequencies: 0.005474
669100 -- (-2081.655) (-2077.715) (-2085.902) [-2069.464] * (-2072.337) (-2088.806) [-2086.376] (-2080.137) -- 0:01:34
669200 -- (-2084.891) (-2076.112) (-2073.599) [-2075.505] * [-2073.309] (-2083.794) (-2079.611) (-2079.058) -- 0:01:34
669300 -- (-2087.296) (-2080.691) [-2073.573] (-2079.596) * (-2081.406) (-2082.223) [-2075.782] (-2085.603) -- 0:01:34
669400 -- (-2080.171) (-2078.796) [-2079.768] (-2085.786) * [-2073.170] (-2086.487) (-2078.132) (-2088.058) -- 0:01:34
669500 -- [-2074.663] (-2083.826) (-2079.516) (-2086.124) * (-2073.956) (-2086.951) [-2082.029] (-2083.917) -- 0:01:34
669600 -- [-2074.993] (-2079.482) (-2087.172) (-2078.151) * [-2066.939] (-2080.419) (-2082.676) (-2085.351) -- 0:01:34
669700 -- (-2077.986) (-2082.195) (-2092.339) [-2076.013] * [-2072.607] (-2079.714) (-2080.622) (-2082.393) -- 0:01:34
669800 -- [-2077.891] (-2080.276) (-2079.477) (-2078.693) * (-2073.279) (-2083.316) [-2077.950] (-2084.605) -- 0:01:34
669900 -- (-2079.655) (-2080.776) [-2080.007] (-2077.650) * [-2072.618] (-2082.530) (-2081.344) (-2079.278) -- 0:01:34
670000 -- [-2077.151] (-2078.591) (-2088.222) (-2078.310) * (-2071.339) (-2077.797) (-2076.503) [-2078.877] -- 0:01:34
Average standard deviation of split frequencies: 0.005668
670100 -- (-2079.319) (-2076.096) (-2084.788) [-2074.346] * [-2070.730] (-2084.031) (-2087.358) (-2079.319) -- 0:01:34
670200 -- (-2084.626) [-2069.309] (-2092.452) (-2071.368) * [-2067.648] (-2080.570) (-2096.278) (-2079.550) -- 0:01:33
670300 -- (-2075.593) [-2073.445] (-2075.830) (-2073.411) * [-2074.702] (-2086.989) (-2094.262) (-2079.951) -- 0:01:33
670400 -- (-2078.881) [-2078.213] (-2084.086) (-2081.050) * [-2071.141] (-2087.571) (-2080.434) (-2083.298) -- 0:01:33
670500 -- (-2081.421) (-2072.569) [-2073.096] (-2079.469) * [-2073.307] (-2098.771) (-2082.497) (-2076.838) -- 0:01:33
670600 -- (-2083.780) (-2078.656) [-2069.561] (-2079.047) * (-2076.375) (-2088.838) [-2080.107] (-2080.719) -- 0:01:33
670700 -- (-2085.946) (-2084.669) [-2069.497] (-2079.527) * [-2074.054] (-2087.164) (-2083.351) (-2081.162) -- 0:01:33
670800 -- [-2078.448] (-2078.515) (-2078.878) (-2080.232) * [-2074.477] (-2089.106) (-2076.650) (-2082.242) -- 0:01:33
670900 -- (-2081.103) [-2076.431] (-2074.895) (-2073.455) * (-2080.452) (-2085.684) [-2076.019] (-2085.763) -- 0:01:33
671000 -- (-2083.323) (-2079.168) [-2072.627] (-2077.944) * [-2073.092] (-2087.523) (-2081.304) (-2078.917) -- 0:01:33
Average standard deviation of split frequencies: 0.005478
671100 -- (-2079.350) [-2080.237] (-2074.542) (-2075.487) * [-2078.285] (-2080.587) (-2092.730) (-2080.242) -- 0:01:33
671200 -- (-2089.453) (-2079.029) (-2077.443) [-2075.147] * [-2073.261] (-2091.253) (-2080.293) (-2078.214) -- 0:01:33
671300 -- (-2079.010) [-2080.210] (-2075.621) (-2075.321) * [-2072.373] (-2087.715) (-2080.864) (-2082.120) -- 0:01:33
671400 -- (-2086.199) (-2081.747) (-2078.369) [-2075.281] * [-2072.503] (-2090.888) (-2079.054) (-2079.420) -- 0:01:33
671500 -- (-2079.076) (-2087.211) (-2081.493) [-2076.514] * [-2072.115] (-2083.759) (-2080.479) (-2085.031) -- 0:01:33
671600 -- (-2080.547) (-2091.229) [-2070.992] (-2079.023) * [-2072.020] (-2082.843) (-2075.733) (-2080.697) -- 0:01:33
671700 -- (-2077.947) (-2087.053) [-2074.484] (-2084.296) * [-2073.044] (-2084.044) (-2076.599) (-2079.909) -- 0:01:33
671800 -- (-2075.999) (-2080.220) [-2074.034] (-2079.728) * (-2075.027) (-2082.483) (-2076.370) [-2073.819] -- 0:01:33
671900 -- (-2075.821) (-2076.608) [-2072.731] (-2084.048) * [-2071.303] (-2077.164) (-2085.013) (-2076.766) -- 0:01:33
672000 -- (-2077.127) (-2078.117) [-2073.056] (-2082.718) * (-2074.045) (-2075.211) (-2089.703) [-2077.817] -- 0:01:33
Average standard deviation of split frequencies: 0.005551
672100 -- (-2076.989) (-2074.854) [-2077.975] (-2080.871) * [-2069.244] (-2091.903) (-2076.458) (-2074.476) -- 0:01:33
672200 -- (-2082.351) [-2079.524] (-2077.557) (-2079.674) * [-2070.281] (-2087.878) (-2076.387) (-2070.459) -- 0:01:33
672300 -- (-2079.708) (-2078.775) (-2080.702) [-2074.882] * [-2071.260] (-2086.499) (-2077.108) (-2076.803) -- 0:01:33
672400 -- [-2077.465] (-2074.575) (-2079.430) (-2074.322) * (-2073.792) [-2080.589] (-2077.380) (-2078.651) -- 0:01:33
672500 -- (-2092.863) (-2082.330) [-2074.442] (-2075.982) * (-2071.763) [-2074.020] (-2075.464) (-2079.592) -- 0:01:33
672600 -- (-2089.219) [-2078.419] (-2088.402) (-2092.373) * (-2073.547) [-2082.517] (-2079.922) (-2084.399) -- 0:01:33
672700 -- (-2083.060) (-2074.718) (-2089.168) [-2080.713] * [-2070.087] (-2096.056) (-2080.004) (-2077.666) -- 0:01:33
672800 -- (-2081.696) (-2071.885) (-2084.488) [-2082.238] * (-2081.699) [-2077.520] (-2083.553) (-2078.595) -- 0:01:33
672900 -- (-2079.555) [-2070.319] (-2075.138) (-2073.204) * [-2076.364] (-2082.202) (-2078.021) (-2077.719) -- 0:01:33
673000 -- (-2081.882) [-2070.816] (-2068.278) (-2076.598) * (-2075.272) (-2079.571) (-2080.032) [-2076.720] -- 0:01:33
Average standard deviation of split frequencies: 0.005402
673100 -- (-2079.343) [-2069.313] (-2073.519) (-2081.440) * [-2078.137] (-2078.908) (-2081.797) (-2078.737) -- 0:01:33
673200 -- (-2076.485) (-2072.585) [-2076.526] (-2073.447) * (-2074.870) (-2084.163) (-2083.426) [-2076.977] -- 0:01:33
673300 -- (-2082.107) (-2070.629) (-2076.459) [-2077.559] * (-2078.169) [-2076.513] (-2094.436) (-2083.295) -- 0:01:33
673400 -- (-2079.871) [-2068.749] (-2082.267) (-2069.907) * [-2075.966] (-2076.374) (-2082.338) (-2083.978) -- 0:01:33
673500 -- (-2079.964) [-2069.935] (-2085.455) (-2078.153) * (-2081.373) (-2084.709) (-2080.138) [-2078.985] -- 0:01:33
673600 -- (-2085.651) [-2069.300] (-2096.093) (-2073.015) * [-2080.093] (-2098.171) (-2080.143) (-2087.578) -- 0:01:33
673700 -- (-2071.578) (-2069.325) (-2075.297) [-2075.228] * [-2075.446] (-2080.849) (-2079.740) (-2073.055) -- 0:01:32
673800 -- (-2076.486) (-2080.936) (-2075.701) [-2072.353] * (-2078.967) (-2078.303) (-2089.721) [-2074.459] -- 0:01:32
673900 -- (-2076.029) (-2089.130) [-2070.422] (-2077.386) * (-2085.858) (-2083.361) [-2080.026] (-2081.616) -- 0:01:32
674000 -- (-2079.112) (-2091.279) [-2068.151] (-2071.633) * (-2076.556) [-2079.944] (-2079.123) (-2087.867) -- 0:01:32
Average standard deviation of split frequencies: 0.005354
674100 -- (-2081.896) (-2078.127) (-2078.721) [-2077.271] * [-2070.619] (-2079.656) (-2077.052) (-2081.880) -- 0:01:32
674200 -- (-2075.647) (-2074.717) (-2079.326) [-2073.644] * [-2078.072] (-2076.189) (-2093.473) (-2081.438) -- 0:01:32
674300 -- (-2082.042) [-2075.840] (-2073.559) (-2078.647) * (-2076.628) (-2077.470) [-2071.828] (-2085.355) -- 0:01:32
674400 -- (-2076.984) (-2072.454) (-2072.482) [-2076.128] * (-2080.215) (-2075.575) [-2073.293] (-2075.884) -- 0:01:32
674500 -- (-2085.040) [-2073.565] (-2074.398) (-2084.163) * (-2078.747) (-2078.434) (-2079.847) [-2081.635] -- 0:01:32
674600 -- (-2085.070) (-2072.651) [-2072.162] (-2073.135) * (-2079.806) (-2078.972) [-2074.828] (-2077.134) -- 0:01:32
674700 -- (-2080.486) (-2073.277) (-2075.768) [-2073.624] * (-2079.291) (-2087.073) [-2074.092] (-2078.029) -- 0:01:32
674800 -- (-2076.126) [-2070.985] (-2072.772) (-2075.863) * (-2083.847) (-2087.879) [-2071.165] (-2078.061) -- 0:01:32
674900 -- (-2086.693) (-2077.182) [-2076.462] (-2072.389) * (-2073.878) (-2088.425) (-2079.007) [-2077.159] -- 0:01:32
675000 -- (-2098.658) (-2076.953) (-2072.395) [-2068.813] * (-2077.503) [-2080.178] (-2078.148) (-2081.328) -- 0:01:32
Average standard deviation of split frequencies: 0.005386
675100 -- (-2095.475) (-2072.519) [-2071.188] (-2072.801) * (-2080.304) (-2079.455) [-2073.998] (-2084.480) -- 0:01:32
675200 -- (-2087.992) (-2078.368) [-2075.227] (-2079.299) * (-2084.148) (-2087.042) [-2069.425] (-2087.108) -- 0:01:32
675300 -- (-2086.858) (-2089.173) (-2079.193) [-2073.466] * (-2072.023) [-2081.652] (-2071.207) (-2096.523) -- 0:01:32
675400 -- (-2083.320) (-2084.205) (-2068.809) [-2072.837] * (-2075.436) (-2080.747) [-2075.161] (-2088.547) -- 0:01:32
675500 -- (-2081.195) (-2080.830) (-2073.141) [-2077.702] * (-2077.676) (-2080.105) [-2076.003] (-2079.227) -- 0:01:32
675600 -- (-2086.814) (-2080.584) (-2068.767) [-2070.316] * (-2086.460) (-2086.227) [-2070.395] (-2092.018) -- 0:01:32
675700 -- (-2079.974) (-2083.425) [-2074.437] (-2072.872) * (-2091.132) (-2083.585) [-2074.386] (-2093.292) -- 0:01:32
675800 -- (-2082.308) (-2076.058) (-2072.362) [-2073.488] * (-2083.154) (-2086.964) [-2075.186] (-2087.230) -- 0:01:32
675900 -- (-2080.698) (-2079.984) [-2072.034] (-2079.579) * (-2077.101) (-2094.783) [-2075.457] (-2096.133) -- 0:01:32
676000 -- (-2074.451) (-2068.672) (-2075.115) [-2078.183] * (-2077.040) (-2087.230) [-2073.196] (-2086.459) -- 0:01:32
Average standard deviation of split frequencies: 0.005239
676100 -- (-2075.346) [-2077.486] (-2071.829) (-2077.169) * [-2066.303] (-2084.206) (-2082.206) (-2079.840) -- 0:01:32
676200 -- [-2073.510] (-2074.182) (-2079.712) (-2074.487) * (-2070.608) (-2085.092) [-2072.591] (-2088.872) -- 0:01:32
676300 -- (-2071.397) (-2073.944) [-2075.694] (-2074.894) * (-2072.728) [-2079.144] (-2083.066) (-2088.336) -- 0:01:32
676400 -- (-2083.540) [-2068.306] (-2072.011) (-2089.420) * [-2073.062] (-2077.803) (-2069.721) (-2081.018) -- 0:01:32
676500 -- (-2078.235) (-2071.815) [-2070.880] (-2088.719) * (-2075.062) (-2075.980) [-2074.364] (-2084.657) -- 0:01:32
676600 -- (-2080.827) (-2077.962) [-2070.132] (-2104.515) * (-2080.863) (-2081.049) [-2072.129] (-2082.096) -- 0:01:32
676700 -- (-2084.070) (-2073.873) [-2068.169] (-2082.007) * (-2071.259) (-2079.440) [-2078.187] (-2083.831) -- 0:01:32
676800 -- (-2080.648) (-2073.741) [-2074.797] (-2090.274) * [-2069.902] (-2078.192) (-2079.996) (-2080.122) -- 0:01:32
676900 -- (-2085.452) (-2076.733) [-2074.169] (-2079.568) * (-2071.599) (-2091.659) (-2078.969) [-2078.739] -- 0:01:32
677000 -- (-2084.892) [-2070.561] (-2080.183) (-2087.086) * (-2074.689) (-2092.075) [-2067.471] (-2083.264) -- 0:01:32
Average standard deviation of split frequencies: 0.005271
677100 -- (-2078.994) (-2075.198) [-2076.945] (-2080.139) * (-2075.434) (-2095.039) [-2073.730] (-2082.198) -- 0:01:32
677200 -- (-2083.929) (-2078.570) (-2077.399) [-2075.007] * [-2073.178] (-2097.277) (-2072.138) (-2083.836) -- 0:01:31
677300 -- (-2075.698) (-2079.567) [-2073.775] (-2077.609) * [-2070.693] (-2083.625) (-2073.486) (-2077.166) -- 0:01:31
677400 -- (-2082.665) (-2076.905) [-2075.632] (-2085.388) * (-2073.470) (-2080.095) [-2073.254] (-2079.697) -- 0:01:31
677500 -- (-2081.103) (-2072.325) (-2075.219) [-2070.074] * [-2073.162] (-2079.490) (-2086.485) (-2074.727) -- 0:01:31
677600 -- (-2081.034) [-2070.345] (-2072.690) (-2072.117) * [-2073.794] (-2078.538) (-2081.955) (-2080.052) -- 0:01:31
677700 -- (-2079.959) [-2073.295] (-2078.927) (-2072.244) * (-2082.710) (-2074.832) [-2076.155] (-2078.852) -- 0:01:31
677800 -- (-2075.831) (-2071.238) [-2072.644] (-2074.912) * (-2080.154) (-2074.122) [-2079.103] (-2083.048) -- 0:01:31
677900 -- (-2074.172) (-2071.096) [-2074.804] (-2088.096) * (-2077.236) (-2079.931) (-2085.461) [-2076.671] -- 0:01:31
678000 -- [-2076.473] (-2078.894) (-2078.761) (-2079.372) * (-2077.514) [-2075.556] (-2076.614) (-2077.137) -- 0:01:31
Average standard deviation of split frequencies: 0.005263
678100 -- (-2073.709) (-2076.341) (-2077.433) [-2074.296] * (-2075.535) (-2073.820) [-2071.961] (-2075.322) -- 0:01:31
678200 -- (-2072.270) (-2078.610) [-2077.068] (-2074.511) * (-2073.195) [-2073.939] (-2069.462) (-2080.090) -- 0:01:31
678300 -- (-2076.197) [-2078.659] (-2075.251) (-2071.521) * [-2073.031] (-2080.144) (-2070.619) (-2084.648) -- 0:01:31
678400 -- [-2081.120] (-2074.049) (-2075.222) (-2078.474) * (-2074.796) (-2080.814) [-2073.877] (-2087.391) -- 0:01:31
678500 -- (-2084.612) [-2069.827] (-2086.125) (-2071.165) * (-2075.958) [-2076.487] (-2072.864) (-2088.761) -- 0:01:31
678600 -- (-2082.043) (-2071.206) (-2078.904) [-2078.781] * (-2078.758) (-2077.446) [-2076.372] (-2079.145) -- 0:01:31
678700 -- (-2093.737) [-2067.830] (-2078.978) (-2071.197) * (-2069.858) (-2075.366) [-2069.801] (-2079.779) -- 0:01:31
678800 -- (-2075.626) [-2069.072] (-2080.624) (-2076.890) * (-2075.926) (-2079.270) [-2070.843] (-2078.264) -- 0:01:31
678900 -- [-2070.912] (-2081.887) (-2082.929) (-2075.710) * (-2071.278) (-2079.978) [-2074.042] (-2083.726) -- 0:01:31
679000 -- [-2071.753] (-2079.903) (-2087.085) (-2075.725) * (-2073.032) (-2074.602) (-2070.516) [-2078.794] -- 0:01:31
Average standard deviation of split frequencies: 0.005255
679100 -- (-2071.995) (-2076.914) (-2091.434) [-2070.584] * (-2070.707) (-2078.670) [-2069.991] (-2075.586) -- 0:01:31
679200 -- [-2075.465] (-2074.693) (-2082.040) (-2079.782) * (-2075.653) (-2083.054) [-2071.241] (-2091.133) -- 0:01:31
679300 -- (-2076.022) (-2077.275) (-2082.191) [-2073.972] * [-2073.730] (-2082.026) (-2078.056) (-2080.524) -- 0:01:31
679400 -- [-2078.685] (-2077.091) (-2087.976) (-2071.448) * (-2070.802) (-2086.559) (-2071.777) [-2078.459] -- 0:01:31
679500 -- (-2073.759) (-2075.531) (-2087.393) [-2074.433] * [-2069.481] (-2078.955) (-2068.591) (-2090.647) -- 0:01:31
679600 -- (-2076.029) (-2075.103) (-2089.613) [-2072.552] * (-2072.817) (-2079.605) [-2070.695] (-2083.529) -- 0:01:31
679700 -- (-2077.648) [-2071.631] (-2088.369) (-2077.700) * (-2076.144) (-2077.879) [-2070.542] (-2079.785) -- 0:01:31
679800 -- (-2081.740) (-2074.488) (-2086.479) [-2075.883] * (-2080.719) (-2078.802) [-2068.550] (-2077.861) -- 0:01:31
679900 -- (-2077.679) [-2073.097] (-2079.835) (-2078.276) * (-2080.135) (-2078.718) (-2070.247) [-2077.742] -- 0:01:31
680000 -- (-2085.267) [-2073.632] (-2081.583) (-2072.361) * [-2074.074] (-2085.693) (-2070.395) (-2082.061) -- 0:01:31
Average standard deviation of split frequencies: 0.005208
680100 -- (-2077.088) (-2071.109) (-2082.772) [-2072.653] * (-2080.368) [-2079.939] (-2072.637) (-2084.300) -- 0:01:31
680200 -- (-2088.293) (-2079.973) (-2081.844) [-2071.227] * (-2076.206) [-2075.996] (-2074.258) (-2077.217) -- 0:01:31
680300 -- (-2071.893) [-2071.354] (-2084.560) (-2073.270) * (-2077.905) [-2078.108] (-2076.875) (-2079.577) -- 0:01:31
680400 -- (-2069.329) (-2069.811) (-2081.655) [-2070.827] * (-2084.630) (-2074.634) [-2081.011] (-2081.983) -- 0:01:31
680500 -- (-2074.071) [-2072.421] (-2078.419) (-2071.292) * [-2080.547] (-2079.808) (-2080.376) (-2088.994) -- 0:01:31
680600 -- [-2073.006] (-2076.687) (-2082.026) (-2070.660) * (-2082.199) [-2076.587] (-2080.877) (-2077.521) -- 0:01:31
680700 -- (-2079.204) (-2076.461) (-2085.042) [-2069.504] * (-2083.066) [-2077.093] (-2081.665) (-2089.417) -- 0:01:31
680800 -- (-2075.225) [-2077.200] (-2082.494) (-2072.777) * (-2077.572) (-2079.616) [-2081.144] (-2085.502) -- 0:01:30
680900 -- (-2080.920) [-2074.574] (-2086.594) (-2075.811) * [-2070.558] (-2078.777) (-2075.723) (-2085.320) -- 0:01:30
681000 -- (-2069.730) (-2071.455) (-2085.168) [-2071.645] * [-2074.442] (-2083.453) (-2073.152) (-2078.114) -- 0:01:30
Average standard deviation of split frequencies: 0.005081
681100 -- (-2070.453) (-2081.936) (-2083.791) [-2074.710] * (-2080.768) (-2080.986) [-2075.670] (-2083.338) -- 0:01:30
681200 -- [-2069.697] (-2083.694) (-2082.546) (-2068.832) * (-2078.512) (-2079.507) [-2076.079] (-2084.759) -- 0:01:30
681300 -- (-2077.303) (-2073.476) (-2083.111) [-2067.140] * (-2078.550) [-2079.177] (-2073.175) (-2091.452) -- 0:01:30
681400 -- (-2075.507) [-2073.618] (-2087.028) (-2074.532) * (-2075.656) [-2076.229] (-2073.245) (-2083.644) -- 0:01:30
681500 -- (-2084.916) [-2076.235] (-2077.397) (-2076.512) * [-2070.340] (-2076.364) (-2071.024) (-2086.001) -- 0:01:30
681600 -- (-2083.768) [-2074.194] (-2084.470) (-2079.818) * [-2072.980] (-2081.550) (-2072.854) (-2100.490) -- 0:01:30
681700 -- (-2074.794) (-2080.926) (-2091.478) [-2071.480] * (-2077.971) (-2078.665) [-2074.871] (-2092.293) -- 0:01:30
681800 -- (-2074.051) [-2075.249] (-2081.394) (-2076.175) * (-2072.414) [-2078.092] (-2078.329) (-2085.558) -- 0:01:30
681900 -- [-2072.686] (-2087.990) (-2089.139) (-2083.044) * [-2074.944] (-2079.637) (-2084.582) (-2096.288) -- 0:01:30
682000 -- [-2068.830] (-2084.608) (-2079.958) (-2085.577) * [-2073.167] (-2084.689) (-2079.304) (-2095.154) -- 0:01:30
Average standard deviation of split frequencies: 0.005153
682100 -- [-2073.104] (-2081.495) (-2081.456) (-2081.209) * [-2077.504] (-2081.653) (-2078.072) (-2084.437) -- 0:01:30
682200 -- (-2073.168) (-2082.058) [-2074.926] (-2083.400) * [-2072.411] (-2074.744) (-2082.265) (-2080.080) -- 0:01:30
682300 -- (-2072.068) (-2098.926) [-2083.760] (-2079.232) * [-2072.957] (-2078.300) (-2080.926) (-2081.367) -- 0:01:30
682400 -- (-2075.395) [-2078.532] (-2076.892) (-2076.436) * [-2069.353] (-2078.323) (-2082.565) (-2079.156) -- 0:01:30
682500 -- [-2066.136] (-2083.147) (-2078.628) (-2081.121) * (-2076.402) (-2076.864) [-2072.320] (-2079.063) -- 0:01:30
682600 -- [-2072.157] (-2083.645) (-2078.912) (-2081.404) * [-2072.408] (-2078.186) (-2079.415) (-2078.934) -- 0:01:30
682700 -- (-2069.894) (-2080.501) [-2074.771] (-2093.981) * (-2071.007) (-2085.134) [-2074.888] (-2076.802) -- 0:01:30
682800 -- [-2076.109] (-2078.780) (-2074.486) (-2097.812) * (-2085.042) [-2072.895] (-2079.651) (-2081.693) -- 0:01:30
682900 -- (-2072.090) (-2074.409) [-2074.295] (-2088.456) * (-2079.780) (-2077.468) [-2078.580] (-2078.299) -- 0:01:30
683000 -- [-2068.083] (-2074.423) (-2080.486) (-2089.974) * [-2074.039] (-2079.255) (-2074.793) (-2080.153) -- 0:01:30
Average standard deviation of split frequencies: 0.005283
683100 -- (-2071.649) [-2072.391] (-2077.220) (-2091.740) * (-2084.259) (-2078.139) [-2075.088] (-2079.318) -- 0:01:30
683200 -- [-2072.747] (-2076.381) (-2085.293) (-2075.106) * (-2079.948) [-2078.488] (-2077.796) (-2082.263) -- 0:01:30
683300 -- (-2078.861) [-2074.224] (-2083.267) (-2089.629) * [-2073.627] (-2084.575) (-2070.838) (-2077.406) -- 0:01:30
683400 -- [-2073.294] (-2078.839) (-2078.542) (-2089.604) * [-2070.135] (-2079.727) (-2074.931) (-2090.058) -- 0:01:30
683500 -- [-2067.570] (-2079.526) (-2082.838) (-2083.761) * (-2072.945) [-2074.963] (-2079.692) (-2087.147) -- 0:01:30
683600 -- [-2069.697] (-2088.725) (-2079.178) (-2077.201) * [-2077.132] (-2075.421) (-2083.313) (-2085.945) -- 0:01:30
683700 -- (-2071.659) (-2074.788) [-2078.576] (-2083.227) * [-2073.861] (-2077.891) (-2082.209) (-2090.342) -- 0:01:30
683800 -- [-2069.295] (-2079.933) (-2079.319) (-2081.116) * [-2077.040] (-2073.760) (-2075.911) (-2084.851) -- 0:01:30
683900 -- [-2068.757] (-2077.129) (-2080.293) (-2081.775) * [-2073.567] (-2072.604) (-2085.756) (-2087.980) -- 0:01:30
684000 -- [-2069.554] (-2078.096) (-2085.831) (-2081.902) * (-2081.282) [-2078.196] (-2082.271) (-2079.822) -- 0:01:30
Average standard deviation of split frequencies: 0.005158
684100 -- [-2073.379] (-2081.149) (-2090.441) (-2090.111) * [-2075.583] (-2081.836) (-2094.235) (-2084.544) -- 0:01:30
684200 -- [-2075.243] (-2079.938) (-2083.720) (-2083.080) * [-2070.403] (-2088.158) (-2102.976) (-2081.863) -- 0:01:30
684300 -- (-2076.582) (-2077.159) (-2086.485) [-2075.890] * (-2071.037) (-2085.515) (-2094.074) [-2079.925] -- 0:01:29
684400 -- (-2081.490) (-2082.401) [-2087.263] (-2073.474) * [-2072.353] (-2084.151) (-2091.355) (-2079.298) -- 0:01:29
684500 -- (-2072.164) (-2081.508) (-2085.604) [-2073.481] * [-2073.032] (-2090.223) (-2084.607) (-2084.937) -- 0:01:29
684600 -- (-2074.445) (-2082.284) (-2091.696) [-2075.986] * [-2072.522] (-2084.767) (-2083.470) (-2079.374) -- 0:01:29
684700 -- (-2079.391) (-2084.316) (-2085.340) [-2077.388] * [-2078.754] (-2087.088) (-2076.226) (-2084.677) -- 0:01:29
684800 -- [-2074.675] (-2078.250) (-2084.890) (-2076.847) * (-2073.865) (-2087.832) [-2075.927] (-2086.404) -- 0:01:29
684900 -- (-2080.066) (-2077.817) (-2083.481) [-2077.758] * [-2087.289] (-2083.028) (-2082.910) (-2082.174) -- 0:01:29
685000 -- (-2090.539) (-2075.517) (-2079.744) [-2076.597] * (-2085.510) [-2078.912] (-2080.993) (-2079.144) -- 0:01:29
Average standard deviation of split frequencies: 0.005307
685100 -- (-2078.990) [-2073.896] (-2080.520) (-2082.611) * (-2083.301) [-2076.394] (-2078.148) (-2092.754) -- 0:01:29
685200 -- (-2084.655) (-2074.885) [-2082.834] (-2086.005) * (-2075.976) (-2075.877) (-2081.171) [-2079.947] -- 0:01:29
685300 -- [-2076.363] (-2071.616) (-2100.465) (-2079.017) * [-2072.361] (-2082.482) (-2081.767) (-2090.060) -- 0:01:29
685400 -- (-2075.815) (-2080.841) (-2086.488) [-2069.976] * (-2075.030) [-2079.325] (-2078.016) (-2081.482) -- 0:01:29
685500 -- [-2072.096] (-2080.989) (-2082.330) (-2077.763) * [-2077.417] (-2081.402) (-2090.666) (-2082.517) -- 0:01:29
685600 -- [-2076.926] (-2077.872) (-2083.950) (-2088.507) * [-2074.664] (-2085.366) (-2083.048) (-2079.150) -- 0:01:29
685700 -- (-2080.076) (-2078.603) (-2086.343) [-2078.691] * (-2078.349) (-2081.476) [-2073.842] (-2079.428) -- 0:01:29
685800 -- (-2078.164) [-2077.745] (-2074.819) (-2074.720) * (-2073.744) (-2073.930) [-2076.610] (-2078.555) -- 0:01:29
685900 -- (-2079.813) (-2076.724) [-2079.177] (-2068.241) * (-2075.078) (-2072.500) (-2080.759) [-2075.105] -- 0:01:29
686000 -- [-2072.705] (-2081.051) (-2084.084) (-2069.757) * [-2075.056] (-2084.531) (-2077.258) (-2081.847) -- 0:01:29
Average standard deviation of split frequencies: 0.005182
686100 -- (-2074.943) (-2069.131) (-2080.834) [-2066.683] * [-2073.487] (-2079.698) (-2073.194) (-2077.448) -- 0:01:29
686200 -- (-2077.095) [-2073.274] (-2085.878) (-2073.479) * [-2066.799] (-2077.951) (-2076.932) (-2077.634) -- 0:01:29
686300 -- (-2076.143) (-2074.697) (-2086.587) [-2068.652] * [-2067.388] (-2084.171) (-2073.959) (-2079.524) -- 0:01:29
686400 -- [-2071.565] (-2078.241) (-2080.737) (-2077.544) * [-2070.082] (-2080.913) (-2077.808) (-2082.248) -- 0:01:29
686500 -- (-2071.967) (-2073.165) (-2075.670) [-2075.430] * [-2071.788] (-2083.587) (-2077.218) (-2095.965) -- 0:01:29
686600 -- [-2071.407] (-2068.189) (-2074.640) (-2078.862) * (-2074.889) [-2087.443] (-2079.619) (-2082.419) -- 0:01:29
686700 -- [-2067.580] (-2077.626) (-2083.083) (-2075.746) * [-2072.182] (-2084.639) (-2079.779) (-2076.805) -- 0:01:29
686800 -- [-2069.057] (-2080.473) (-2083.313) (-2069.611) * [-2070.788] (-2085.516) (-2078.788) (-2077.495) -- 0:01:29
686900 -- [-2068.556] (-2074.619) (-2092.564) (-2078.518) * (-2075.262) (-2078.251) (-2077.001) [-2079.201] -- 0:01:29
687000 -- [-2069.361] (-2080.374) (-2087.622) (-2075.096) * (-2088.312) [-2078.319] (-2077.707) (-2080.996) -- 0:01:29
Average standard deviation of split frequencies: 0.005292
687100 -- (-2074.209) (-2078.700) (-2084.733) [-2070.665] * (-2074.538) (-2079.293) [-2072.880] (-2089.476) -- 0:01:29
687200 -- (-2076.173) (-2074.653) [-2080.283] (-2073.773) * (-2073.856) (-2090.618) (-2071.652) [-2079.938] -- 0:01:29
687300 -- (-2078.974) (-2078.089) (-2081.262) [-2073.094] * [-2074.680] (-2077.424) (-2073.038) (-2081.848) -- 0:01:29
687400 -- (-2073.207) [-2072.370] (-2079.167) (-2076.408) * (-2069.786) (-2076.534) [-2075.041] (-2079.511) -- 0:01:29
687500 -- [-2079.102] (-2073.888) (-2085.149) (-2078.894) * [-2069.077] (-2082.470) (-2076.420) (-2080.246) -- 0:01:29
687600 -- (-2079.361) [-2075.319] (-2075.786) (-2076.850) * [-2070.313] (-2076.279) (-2079.400) (-2079.251) -- 0:01:29
687700 -- (-2078.046) (-2078.538) [-2072.489] (-2074.819) * [-2074.759] (-2088.298) (-2074.575) (-2076.046) -- 0:01:29
687800 -- (-2078.614) [-2073.276] (-2076.529) (-2083.221) * (-2071.276) (-2080.638) [-2070.001] (-2080.214) -- 0:01:28
687900 -- [-2076.992] (-2071.891) (-2083.039) (-2078.832) * (-2070.388) (-2085.168) [-2071.307] (-2080.658) -- 0:01:28
688000 -- (-2079.226) [-2073.741] (-2078.240) (-2072.506) * (-2075.235) [-2075.472] (-2074.042) (-2079.614) -- 0:01:28
Average standard deviation of split frequencies: 0.005226
688100 -- (-2080.657) [-2075.669] (-2081.937) (-2077.535) * (-2080.602) [-2073.425] (-2074.582) (-2087.628) -- 0:01:28
688200 -- [-2072.473] (-2073.139) (-2083.138) (-2077.942) * [-2077.179] (-2076.158) (-2074.773) (-2084.779) -- 0:01:28
688300 -- (-2072.162) [-2080.778] (-2080.143) (-2074.389) * (-2077.759) [-2072.477] (-2083.731) (-2089.007) -- 0:01:28
688400 -- (-2083.377) [-2081.846] (-2077.293) (-2075.710) * [-2079.184] (-2069.682) (-2081.418) (-2091.367) -- 0:01:28
688500 -- (-2081.608) (-2077.308) [-2082.640] (-2078.808) * (-2078.070) (-2079.037) [-2081.340] (-2082.366) -- 0:01:28
688600 -- [-2078.043] (-2077.045) (-2090.837) (-2080.385) * (-2079.804) (-2071.532) [-2078.662] (-2081.574) -- 0:01:28
688700 -- (-2076.352) [-2075.607] (-2087.900) (-2076.735) * (-2075.225) [-2072.505] (-2079.072) (-2080.959) -- 0:01:28
688800 -- (-2081.658) [-2075.452] (-2083.847) (-2074.469) * (-2077.405) (-2079.767) [-2071.883] (-2093.273) -- 0:01:28
688900 -- (-2076.311) [-2073.721] (-2083.981) (-2077.214) * [-2073.077] (-2087.283) (-2070.934) (-2085.907) -- 0:01:28
689000 -- (-2077.608) (-2073.057) (-2080.311) [-2069.403] * (-2077.693) (-2093.490) [-2072.035] (-2080.963) -- 0:01:28
Average standard deviation of split frequencies: 0.005355
689100 -- (-2079.879) (-2075.120) (-2085.167) [-2077.561] * (-2081.687) [-2072.061] (-2077.693) (-2090.113) -- 0:01:28
689200 -- (-2083.862) [-2077.771] (-2088.662) (-2078.253) * (-2074.193) [-2071.785] (-2074.712) (-2084.673) -- 0:01:28
689300 -- (-2084.286) (-2077.202) (-2082.167) [-2072.835] * [-2073.394] (-2074.552) (-2073.089) (-2090.762) -- 0:01:28
689400 -- (-2082.745) [-2074.892] (-2081.866) (-2074.171) * (-2076.584) (-2072.199) [-2072.070] (-2085.806) -- 0:01:28
689500 -- (-2082.921) [-2075.234] (-2076.943) (-2079.648) * [-2072.130] (-2072.189) (-2071.402) (-2083.492) -- 0:01:28
689600 -- (-2081.140) (-2068.905) (-2079.144) [-2080.531] * [-2070.782] (-2075.052) (-2077.318) (-2085.381) -- 0:01:28
689700 -- (-2073.417) [-2067.017] (-2080.040) (-2073.419) * [-2073.302] (-2074.306) (-2079.344) (-2089.948) -- 0:01:28
689800 -- [-2069.207] (-2072.051) (-2074.687) (-2078.546) * (-2077.991) [-2071.871] (-2070.850) (-2080.306) -- 0:01:28
689900 -- [-2075.023] (-2073.316) (-2081.621) (-2085.294) * (-2081.501) (-2071.274) [-2074.886] (-2082.088) -- 0:01:28
690000 -- (-2074.491) [-2070.523] (-2090.103) (-2080.906) * (-2083.635) (-2074.247) [-2075.270] (-2083.248) -- 0:01:28
Average standard deviation of split frequencies: 0.005211
690100 -- [-2068.892] (-2073.552) (-2080.034) (-2082.550) * [-2077.640] (-2072.702) (-2085.499) (-2080.219) -- 0:01:28
690200 -- (-2078.983) [-2068.056] (-2078.154) (-2084.491) * (-2077.582) (-2072.531) [-2079.899] (-2082.252) -- 0:01:28
690300 -- (-2078.079) (-2080.797) (-2081.545) [-2078.539] * (-2075.207) (-2076.608) [-2067.855] (-2076.390) -- 0:01:28
690400 -- [-2076.400] (-2074.942) (-2076.495) (-2077.547) * (-2081.530) (-2074.490) [-2071.059] (-2083.382) -- 0:01:28
690500 -- [-2075.218] (-2073.997) (-2078.133) (-2081.526) * (-2079.147) (-2082.054) [-2074.116] (-2092.710) -- 0:01:28
690600 -- [-2071.648] (-2084.015) (-2080.107) (-2080.947) * (-2072.952) (-2076.281) [-2077.685] (-2081.005) -- 0:01:28
690700 -- (-2070.139) (-2078.090) (-2082.668) [-2078.897] * (-2081.562) (-2080.660) (-2075.130) [-2076.652] -- 0:01:28
690800 -- [-2071.782] (-2076.947) (-2081.566) (-2085.007) * (-2075.078) (-2075.411) [-2075.342] (-2085.082) -- 0:01:28
690900 -- (-2074.888) (-2076.675) (-2075.417) [-2081.396] * [-2071.985] (-2079.231) (-2078.066) (-2076.465) -- 0:01:28
691000 -- (-2071.312) (-2085.035) (-2075.188) [-2070.931] * (-2077.390) [-2078.796] (-2082.188) (-2077.020) -- 0:01:28
Average standard deviation of split frequencies: 0.005242
691100 -- [-2074.128] (-2080.593) (-2088.576) (-2080.671) * [-2074.880] (-2074.311) (-2081.555) (-2078.486) -- 0:01:28
691200 -- [-2073.380] (-2075.559) (-2077.607) (-2081.996) * [-2075.000] (-2078.932) (-2069.346) (-2085.572) -- 0:01:28
691300 -- [-2073.445] (-2078.719) (-2081.982) (-2089.129) * [-2070.747] (-2076.594) (-2073.138) (-2083.968) -- 0:01:27
691400 -- [-2073.868] (-2073.420) (-2078.142) (-2080.625) * [-2070.840] (-2078.383) (-2069.779) (-2075.168) -- 0:01:27
691500 -- (-2078.113) (-2072.493) (-2085.896) [-2067.477] * (-2075.728) (-2086.769) [-2073.947] (-2080.994) -- 0:01:27
691600 -- (-2076.622) [-2072.454] (-2081.375) (-2072.746) * (-2071.360) (-2084.920) [-2076.435] (-2084.942) -- 0:01:27
691700 -- (-2078.777) (-2077.577) (-2079.084) [-2072.430] * [-2068.841] (-2072.248) (-2084.017) (-2087.435) -- 0:01:27
691800 -- (-2075.043) (-2076.100) (-2077.517) [-2073.516] * (-2077.691) (-2081.311) (-2072.358) [-2076.938] -- 0:01:27
691900 -- [-2069.745] (-2076.968) (-2080.178) (-2076.235) * [-2069.923] (-2082.546) (-2071.158) (-2086.307) -- 0:01:27
692000 -- [-2072.354] (-2076.420) (-2085.170) (-2076.246) * [-2073.173] (-2077.118) (-2078.909) (-2086.809) -- 0:01:27
Average standard deviation of split frequencies: 0.005176
692100 -- [-2072.333] (-2070.977) (-2083.173) (-2073.309) * (-2078.236) (-2077.658) (-2075.825) [-2080.951] -- 0:01:27
692200 -- [-2073.748] (-2072.136) (-2091.667) (-2072.959) * (-2077.943) (-2079.089) [-2076.831] (-2082.625) -- 0:01:27
692300 -- [-2072.950] (-2076.300) (-2087.394) (-2076.730) * [-2072.967] (-2069.808) (-2095.159) (-2078.411) -- 0:01:27
692400 -- [-2075.612] (-2081.997) (-2087.522) (-2076.737) * (-2078.651) (-2077.704) (-2091.915) [-2083.110] -- 0:01:27
692500 -- (-2076.137) [-2070.822] (-2077.370) (-2077.536) * (-2076.010) [-2069.482] (-2072.963) (-2089.383) -- 0:01:27
692600 -- (-2070.368) [-2073.577] (-2085.125) (-2076.839) * (-2073.977) (-2074.058) [-2068.709] (-2096.965) -- 0:01:27
692700 -- (-2073.407) [-2070.100] (-2087.492) (-2077.233) * [-2074.343] (-2077.764) (-2073.630) (-2080.437) -- 0:01:27
692800 -- [-2073.702] (-2072.332) (-2083.368) (-2083.773) * (-2081.039) (-2081.114) [-2073.289] (-2086.423) -- 0:01:27
692900 -- [-2068.058] (-2077.294) (-2086.697) (-2075.730) * (-2068.085) (-2076.628) [-2072.610] (-2080.497) -- 0:01:27
693000 -- [-2077.160] (-2082.262) (-2084.482) (-2073.062) * (-2073.902) (-2079.064) [-2069.350] (-2077.588) -- 0:01:27
Average standard deviation of split frequencies: 0.005071
693100 -- [-2074.237] (-2084.641) (-2087.964) (-2075.914) * (-2082.020) (-2075.907) [-2068.986] (-2080.784) -- 0:01:27
693200 -- [-2069.162] (-2091.135) (-2083.224) (-2073.321) * (-2073.352) (-2071.265) [-2072.368] (-2081.928) -- 0:01:27
693300 -- (-2068.472) (-2082.363) [-2076.485] (-2074.169) * (-2074.293) (-2072.419) [-2072.604] (-2083.098) -- 0:01:27
693400 -- (-2070.478) [-2077.622] (-2083.268) (-2077.684) * (-2073.502) [-2082.470] (-2076.490) (-2083.716) -- 0:01:27
693500 -- (-2077.937) [-2071.963] (-2087.976) (-2074.622) * (-2068.608) (-2074.123) [-2070.795] (-2084.630) -- 0:01:27
693600 -- (-2083.907) [-2079.964] (-2083.182) (-2076.364) * (-2069.611) (-2077.826) [-2071.168] (-2080.275) -- 0:01:27
693700 -- [-2071.161] (-2075.007) (-2078.507) (-2075.911) * (-2077.445) [-2071.779] (-2070.412) (-2086.570) -- 0:01:27
693800 -- (-2076.091) (-2077.405) (-2080.908) [-2081.296] * (-2073.305) [-2069.890] (-2081.934) (-2077.983) -- 0:01:27
693900 -- (-2072.951) (-2077.553) (-2073.857) [-2072.392] * [-2075.524] (-2073.737) (-2076.607) (-2085.213) -- 0:01:27
694000 -- [-2071.088] (-2084.212) (-2089.805) (-2074.859) * [-2076.539] (-2089.886) (-2082.173) (-2082.867) -- 0:01:27
Average standard deviation of split frequencies: 0.005045
694100 -- (-2071.808) (-2078.080) (-2081.038) [-2072.517] * [-2077.101] (-2080.527) (-2080.428) (-2082.250) -- 0:01:27
694200 -- (-2075.073) (-2090.036) (-2077.320) [-2073.173] * (-2076.600) [-2075.221] (-2080.550) (-2078.506) -- 0:01:27
694300 -- (-2074.500) (-2087.469) (-2082.767) [-2074.325] * (-2073.331) (-2075.824) [-2074.025] (-2075.828) -- 0:01:27
694400 -- (-2075.499) (-2084.051) (-2081.949) [-2070.915] * [-2073.292] (-2069.488) (-2075.892) (-2076.581) -- 0:01:27
694500 -- [-2074.929] (-2085.777) (-2095.362) (-2078.961) * (-2073.207) [-2076.009] (-2074.903) (-2079.075) -- 0:01:27
694600 -- [-2072.138] (-2078.166) (-2084.050) (-2071.399) * [-2075.951] (-2081.167) (-2076.196) (-2078.595) -- 0:01:27
694700 -- [-2071.729] (-2082.855) (-2082.578) (-2079.318) * [-2069.901] (-2081.142) (-2071.899) (-2075.464) -- 0:01:27
694800 -- [-2069.939] (-2082.889) (-2077.810) (-2073.774) * [-2069.676] (-2077.238) (-2085.496) (-2070.995) -- 0:01:26
694900 -- (-2074.570) (-2082.698) (-2082.713) [-2073.240] * (-2072.317) (-2072.064) (-2077.213) [-2068.384] -- 0:01:26
695000 -- (-2072.302) (-2075.638) (-2080.148) [-2073.319] * (-2081.438) [-2072.663] (-2076.565) (-2071.096) -- 0:01:26
Average standard deviation of split frequencies: 0.005037
695100 -- (-2072.167) (-2078.651) (-2074.935) [-2075.121] * (-2084.992) [-2068.963] (-2076.888) (-2070.395) -- 0:01:26
695200 -- (-2073.885) (-2075.371) (-2074.880) [-2075.984] * (-2080.388) (-2080.332) (-2075.751) [-2071.390] -- 0:01:26
695300 -- [-2073.692] (-2081.467) (-2082.505) (-2080.260) * (-2076.686) [-2073.046] (-2070.795) (-2075.995) -- 0:01:26
695400 -- [-2078.487] (-2070.281) (-2080.772) (-2081.798) * [-2078.650] (-2075.096) (-2078.977) (-2074.327) -- 0:01:26
695500 -- (-2078.251) (-2085.910) [-2074.496] (-2084.841) * (-2080.253) (-2071.792) (-2078.272) [-2072.890] -- 0:01:26
695600 -- (-2075.522) (-2098.144) [-2073.166] (-2089.137) * (-2077.105) [-2071.824] (-2072.404) (-2078.790) -- 0:01:26
695700 -- (-2071.400) (-2078.139) (-2083.393) [-2078.562] * (-2078.119) (-2071.395) [-2075.026] (-2074.750) -- 0:01:26
695800 -- (-2078.423) (-2074.083) [-2081.618] (-2076.103) * (-2076.956) [-2070.404] (-2076.720) (-2081.838) -- 0:01:26
695900 -- (-2072.894) (-2075.092) (-2080.234) [-2087.055] * (-2074.809) (-2074.805) (-2070.813) [-2071.952] -- 0:01:26
696000 -- (-2074.813) (-2080.152) (-2075.038) [-2073.345] * [-2076.009] (-2070.616) (-2079.152) (-2074.845) -- 0:01:26
Average standard deviation of split frequencies: 0.004953
696100 -- [-2074.414] (-2076.876) (-2081.542) (-2079.664) * (-2074.819) [-2070.109] (-2076.119) (-2077.439) -- 0:01:26
696200 -- [-2069.925] (-2073.943) (-2081.284) (-2082.425) * [-2072.314] (-2080.551) (-2071.331) (-2073.782) -- 0:01:26
696300 -- (-2073.960) [-2074.615] (-2080.961) (-2076.150) * (-2074.995) [-2074.533] (-2072.052) (-2067.849) -- 0:01:26
696400 -- (-2075.877) [-2073.739] (-2086.809) (-2083.088) * (-2078.236) (-2073.659) [-2070.193] (-2072.603) -- 0:01:26
696500 -- [-2071.194] (-2078.075) (-2076.488) (-2075.428) * [-2075.817] (-2075.750) (-2069.717) (-2071.927) -- 0:01:26
696600 -- (-2072.319) (-2078.035) (-2078.581) [-2070.360] * [-2071.862] (-2069.242) (-2076.424) (-2074.647) -- 0:01:26
696700 -- (-2080.418) (-2080.728) (-2081.432) [-2080.245] * (-2084.086) [-2068.929] (-2082.220) (-2074.178) -- 0:01:26
696800 -- (-2076.718) [-2073.090] (-2079.529) (-2074.244) * (-2086.406) (-2072.623) [-2069.542] (-2073.161) -- 0:01:26
696900 -- (-2080.490) (-2077.282) [-2081.265] (-2081.393) * (-2086.258) (-2073.640) [-2073.595] (-2078.315) -- 0:01:26
697000 -- (-2076.903) (-2080.553) [-2078.050] (-2086.445) * (-2072.904) [-2076.325] (-2071.580) (-2080.614) -- 0:01:26
Average standard deviation of split frequencies: 0.004965
697100 -- (-2084.356) (-2077.268) [-2079.649] (-2081.182) * (-2079.644) (-2077.619) (-2071.219) [-2070.396] -- 0:01:26
697200 -- [-2075.020] (-2085.662) (-2081.972) (-2081.137) * [-2075.001] (-2078.068) (-2073.851) (-2083.103) -- 0:01:26
697300 -- [-2074.218] (-2083.049) (-2080.857) (-2079.899) * (-2079.255) (-2074.592) [-2076.380] (-2077.260) -- 0:01:26
697400 -- (-2072.316) (-2085.018) (-2084.792) [-2079.179] * (-2076.800) (-2073.030) (-2078.962) [-2069.360] -- 0:01:26
697500 -- [-2073.562] (-2079.184) (-2084.768) (-2071.667) * (-2067.826) (-2077.372) (-2080.070) [-2074.853] -- 0:01:26
697600 -- [-2072.982] (-2073.003) (-2084.943) (-2081.170) * [-2068.085] (-2078.801) (-2080.014) (-2072.987) -- 0:01:26
697700 -- (-2077.968) [-2071.541] (-2088.100) (-2085.880) * [-2070.322] (-2086.154) (-2076.161) (-2080.984) -- 0:01:26
697800 -- (-2093.945) [-2071.104] (-2076.438) (-2088.796) * [-2071.748] (-2081.383) (-2076.999) (-2076.991) -- 0:01:26
697900 -- (-2086.243) [-2071.008] (-2076.074) (-2090.930) * (-2074.661) (-2075.811) [-2075.235] (-2073.557) -- 0:01:26
698000 -- (-2083.965) [-2070.269] (-2078.594) (-2082.715) * (-2071.061) (-2068.468) [-2072.554] (-2071.555) -- 0:01:26
Average standard deviation of split frequencies: 0.004746
698100 -- (-2082.773) [-2071.349] (-2079.893) (-2089.699) * (-2069.301) (-2070.881) (-2080.772) [-2075.998] -- 0:01:26
698200 -- (-2079.401) [-2071.495] (-2081.316) (-2083.596) * (-2075.058) [-2066.517] (-2082.605) (-2071.140) -- 0:01:26
698300 -- (-2072.935) (-2086.995) (-2083.513) [-2080.053] * (-2071.211) [-2069.909] (-2081.455) (-2072.578) -- 0:01:25
698400 -- (-2075.016) (-2072.344) (-2087.627) [-2077.430] * [-2073.806] (-2073.920) (-2074.462) (-2069.431) -- 0:01:25
698500 -- (-2077.562) [-2071.671] (-2082.395) (-2080.676) * (-2070.927) (-2078.971) [-2075.015] (-2072.393) -- 0:01:25
698600 -- (-2076.124) [-2078.129] (-2087.139) (-2095.652) * (-2074.398) (-2083.282) [-2069.495] (-2067.525) -- 0:01:25
698700 -- (-2074.297) (-2074.144) [-2082.232] (-2076.886) * (-2080.244) [-2078.958] (-2076.666) (-2068.997) -- 0:01:25
698800 -- (-2079.259) [-2074.427] (-2088.263) (-2076.833) * [-2077.550] (-2073.380) (-2072.914) (-2072.087) -- 0:01:25
698900 -- (-2072.473) [-2071.865] (-2078.712) (-2079.685) * (-2077.682) [-2073.928] (-2077.945) (-2073.149) -- 0:01:25
699000 -- [-2072.329] (-2076.804) (-2082.042) (-2069.340) * [-2074.484] (-2075.545) (-2078.572) (-2078.669) -- 0:01:25
Average standard deviation of split frequencies: 0.004700
699100 -- (-2072.398) (-2084.619) [-2077.263] (-2075.660) * (-2073.127) (-2079.186) (-2070.146) [-2071.468] -- 0:01:25
699200 -- [-2072.541] (-2076.020) (-2080.063) (-2085.855) * (-2073.576) (-2074.123) (-2078.768) [-2074.659] -- 0:01:25
699300 -- [-2068.887] (-2088.397) (-2076.921) (-2074.829) * [-2071.219] (-2077.321) (-2081.195) (-2075.853) -- 0:01:25
699400 -- [-2077.734] (-2083.203) (-2075.945) (-2078.264) * (-2075.539) (-2079.517) [-2080.789] (-2073.502) -- 0:01:25
699500 -- [-2069.164] (-2078.632) (-2079.197) (-2075.609) * [-2073.097] (-2093.244) (-2077.587) (-2079.532) -- 0:01:25
699600 -- [-2069.535] (-2078.973) (-2084.535) (-2072.241) * [-2070.463] (-2077.587) (-2074.386) (-2078.981) -- 0:01:25
699700 -- [-2068.789] (-2078.938) (-2081.935) (-2074.238) * [-2080.717] (-2077.430) (-2078.354) (-2076.401) -- 0:01:25
699800 -- (-2073.681) (-2078.570) (-2078.577) [-2072.761] * [-2072.861] (-2078.448) (-2077.579) (-2084.143) -- 0:01:25
699900 -- (-2079.915) (-2071.942) (-2086.392) [-2072.858] * (-2073.049) (-2085.264) (-2080.390) [-2076.569] -- 0:01:25
700000 -- [-2075.259] (-2079.912) (-2084.987) (-2068.863) * (-2070.555) (-2084.528) [-2079.358] (-2078.661) -- 0:01:25
Average standard deviation of split frequencies: 0.004463
700100 -- (-2071.433) (-2083.155) (-2077.968) [-2070.232] * (-2080.414) (-2087.547) [-2077.535] (-2078.219) -- 0:01:25
700200 -- [-2070.230] (-2092.688) (-2079.767) (-2073.141) * (-2076.914) (-2078.941) [-2073.998] (-2084.727) -- 0:01:25
700300 -- (-2075.535) (-2084.567) [-2079.416] (-2073.854) * [-2073.331] (-2076.256) (-2075.769) (-2080.544) -- 0:01:25
700400 -- [-2074.359] (-2075.600) (-2074.214) (-2072.578) * [-2073.118] (-2073.275) (-2082.829) (-2076.845) -- 0:01:25
700500 -- [-2080.721] (-2076.155) (-2074.123) (-2081.867) * [-2077.366] (-2073.673) (-2089.002) (-2083.489) -- 0:01:25
700600 -- (-2078.423) (-2072.284) (-2076.851) [-2076.021] * (-2076.351) [-2071.534] (-2080.669) (-2083.000) -- 0:01:25
700700 -- (-2075.320) (-2075.001) [-2075.399] (-2083.574) * (-2075.664) (-2073.374) (-2079.628) [-2073.407] -- 0:01:25
700800 -- [-2072.860] (-2071.959) (-2082.917) (-2080.455) * (-2072.245) (-2077.515) [-2077.583] (-2076.564) -- 0:01:25
700900 -- [-2072.399] (-2077.041) (-2080.878) (-2080.519) * [-2072.583] (-2077.684) (-2082.088) (-2088.213) -- 0:01:25
701000 -- (-2079.880) (-2078.677) (-2072.519) [-2070.738] * [-2072.541] (-2078.157) (-2080.223) (-2084.314) -- 0:01:25
Average standard deviation of split frequencies: 0.004437
701100 -- [-2075.226] (-2082.553) (-2076.951) (-2080.180) * (-2073.487) (-2079.364) (-2076.160) [-2069.870] -- 0:01:25
701200 -- [-2074.278] (-2076.927) (-2075.934) (-2075.205) * [-2068.106] (-2074.906) (-2077.341) (-2072.386) -- 0:01:25
701300 -- (-2077.175) (-2076.767) [-2074.288] (-2079.614) * (-2080.865) (-2075.473) (-2082.420) [-2070.939] -- 0:01:25
701400 -- (-2069.762) (-2078.986) [-2077.262] (-2085.548) * (-2072.038) [-2074.669] (-2082.567) (-2072.535) -- 0:01:25
701500 -- (-2066.527) (-2078.963) (-2084.753) [-2080.467] * (-2075.689) [-2071.831] (-2080.899) (-2076.448) -- 0:01:25
701600 -- (-2068.641) (-2079.473) [-2075.033] (-2078.557) * (-2082.145) [-2071.353] (-2087.755) (-2074.494) -- 0:01:25
701700 -- [-2075.999] (-2082.107) (-2076.892) (-2083.434) * (-2073.129) [-2068.638] (-2081.535) (-2075.615) -- 0:01:25
701800 -- (-2079.213) [-2077.130] (-2078.237) (-2093.266) * (-2072.406) (-2074.364) (-2089.139) [-2073.399] -- 0:01:24
701900 -- (-2075.240) (-2076.332) [-2077.278] (-2077.719) * [-2070.911] (-2072.562) (-2088.019) (-2076.632) -- 0:01:24
702000 -- [-2076.933] (-2077.192) (-2075.077) (-2078.066) * (-2074.102) (-2078.639) (-2085.952) [-2072.867] -- 0:01:24
Average standard deviation of split frequencies: 0.004182
702100 -- [-2070.590] (-2074.346) (-2084.055) (-2077.149) * [-2074.225] (-2075.625) (-2086.154) (-2077.062) -- 0:01:24
702200 -- (-2079.716) (-2075.273) (-2093.792) [-2076.787] * [-2068.825] (-2072.430) (-2089.570) (-2073.132) -- 0:01:24
702300 -- (-2082.737) (-2075.218) (-2079.340) [-2071.159] * (-2066.620) [-2071.183] (-2085.965) (-2079.082) -- 0:01:24
702400 -- (-2081.527) [-2075.898] (-2080.594) (-2077.094) * (-2069.062) [-2075.255] (-2074.612) (-2076.446) -- 0:01:24
702500 -- (-2084.512) [-2078.349] (-2084.952) (-2075.713) * (-2077.517) (-2073.879) [-2072.083] (-2080.372) -- 0:01:24
702600 -- [-2075.266] (-2069.954) (-2084.098) (-2072.455) * (-2079.253) (-2075.344) [-2069.049] (-2077.796) -- 0:01:24
702700 -- (-2085.042) [-2070.653] (-2087.236) (-2072.774) * (-2084.997) (-2073.502) [-2080.195] (-2079.022) -- 0:01:24
702800 -- (-2088.425) [-2068.318] (-2089.609) (-2078.523) * [-2074.634] (-2079.308) (-2073.755) (-2073.078) -- 0:01:24
702900 -- (-2083.265) [-2079.941] (-2088.004) (-2074.009) * [-2071.334] (-2078.786) (-2072.938) (-2076.475) -- 0:01:24
703000 -- (-2085.652) [-2077.465] (-2086.340) (-2074.789) * [-2068.301] (-2080.629) (-2076.634) (-2079.942) -- 0:01:24
Average standard deviation of split frequencies: 0.004099
703100 -- [-2081.087] (-2079.028) (-2088.796) (-2075.541) * (-2077.905) (-2086.741) (-2076.166) [-2071.860] -- 0:01:24
703200 -- (-2083.168) [-2069.593] (-2092.313) (-2074.057) * [-2069.409] (-2082.167) (-2074.719) (-2077.615) -- 0:01:24
703300 -- (-2084.610) [-2071.533] (-2087.110) (-2072.377) * (-2073.510) [-2076.184] (-2070.017) (-2078.221) -- 0:01:24
703400 -- (-2080.200) (-2077.812) (-2093.423) [-2069.565] * (-2075.878) [-2073.699] (-2078.762) (-2076.282) -- 0:01:24
703500 -- (-2080.026) [-2078.497] (-2085.005) (-2080.023) * (-2073.260) [-2071.642] (-2081.903) (-2073.285) -- 0:01:24
703600 -- (-2084.858) (-2074.742) (-2086.636) [-2071.138] * (-2076.277) (-2071.065) [-2078.199] (-2078.097) -- 0:01:24
703700 -- (-2074.847) (-2074.651) (-2082.525) [-2073.396] * (-2079.706) (-2073.560) [-2072.979] (-2075.991) -- 0:01:24
703800 -- [-2074.034] (-2070.205) (-2081.833) (-2081.500) * (-2078.236) (-2071.438) [-2070.217] (-2074.344) -- 0:01:24
703900 -- [-2082.245] (-2070.022) (-2090.752) (-2080.171) * [-2072.553] (-2079.862) (-2070.991) (-2073.778) -- 0:01:24
704000 -- [-2070.867] (-2074.612) (-2089.221) (-2079.005) * (-2075.566) (-2080.796) (-2070.744) [-2069.336] -- 0:01:24
Average standard deviation of split frequencies: 0.004113
704100 -- [-2077.490] (-2083.700) (-2086.664) (-2079.308) * (-2068.554) (-2079.337) (-2075.906) [-2071.326] -- 0:01:24
704200 -- [-2074.684] (-2085.610) (-2089.137) (-2080.245) * [-2069.162] (-2079.159) (-2079.092) (-2078.964) -- 0:01:24
704300 -- (-2069.836) (-2084.753) (-2079.272) [-2073.661] * [-2071.893] (-2076.123) (-2079.773) (-2077.546) -- 0:01:24
704400 -- (-2072.805) [-2078.143] (-2079.349) (-2075.268) * [-2069.701] (-2074.186) (-2071.440) (-2080.818) -- 0:01:24
704500 -- [-2073.882] (-2081.860) (-2078.715) (-2083.240) * [-2070.105] (-2080.334) (-2077.652) (-2068.934) -- 0:01:24
704600 -- (-2081.906) (-2079.107) [-2074.470] (-2078.802) * [-2071.738] (-2102.205) (-2074.474) (-2078.911) -- 0:01:24
704700 -- (-2072.871) (-2079.204) [-2073.025] (-2085.731) * [-2075.032] (-2083.999) (-2077.840) (-2077.749) -- 0:01:24
704800 -- (-2076.059) (-2091.019) [-2075.547] (-2082.021) * (-2074.647) (-2088.723) (-2074.606) [-2073.754] -- 0:01:24
704900 -- (-2070.663) (-2081.376) [-2077.831] (-2088.568) * (-2083.713) [-2083.753] (-2069.136) (-2075.152) -- 0:01:24
705000 -- [-2072.827] (-2084.959) (-2079.993) (-2076.584) * (-2076.060) (-2078.594) [-2069.815] (-2074.226) -- 0:01:24
Average standard deviation of split frequencies: 0.004202
705100 -- (-2075.428) (-2080.289) (-2075.153) [-2078.226] * (-2073.121) (-2083.156) [-2071.097] (-2082.639) -- 0:01:24
705200 -- (-2068.346) (-2076.577) (-2074.612) [-2073.089] * (-2074.393) (-2081.523) [-2075.368] (-2078.688) -- 0:01:24
705300 -- (-2077.299) (-2075.750) (-2083.395) [-2076.840] * [-2075.621] (-2089.957) (-2075.324) (-2083.435) -- 0:01:23
705400 -- [-2073.257] (-2080.532) (-2075.400) (-2080.143) * [-2076.784] (-2088.996) (-2076.353) (-2085.816) -- 0:01:23
705500 -- (-2070.914) [-2075.546] (-2072.798) (-2082.969) * (-2082.794) (-2083.236) [-2078.212] (-2080.315) -- 0:01:23
705600 -- (-2073.908) (-2076.346) [-2075.159] (-2076.715) * (-2081.115) [-2076.148] (-2081.522) (-2073.182) -- 0:01:23
705700 -- (-2075.770) (-2082.341) [-2076.825] (-2079.301) * (-2080.301) (-2072.212) (-2073.428) [-2077.295] -- 0:01:23
705800 -- [-2074.164] (-2078.159) (-2082.239) (-2088.405) * (-2090.901) [-2079.496] (-2077.448) (-2077.664) -- 0:01:23
705900 -- [-2072.714] (-2082.516) (-2075.348) (-2074.983) * (-2082.955) (-2077.429) [-2072.176] (-2074.044) -- 0:01:23
706000 -- [-2068.810] (-2088.720) (-2087.933) (-2075.548) * (-2076.040) (-2073.557) [-2071.590] (-2075.498) -- 0:01:23
Average standard deviation of split frequencies: 0.004158
706100 -- (-2072.515) (-2090.057) [-2079.614] (-2070.288) * (-2076.138) (-2075.151) [-2070.603] (-2072.886) -- 0:01:23
706200 -- [-2077.770] (-2080.536) (-2083.697) (-2072.882) * (-2084.932) (-2077.208) [-2069.581] (-2083.905) -- 0:01:23
706300 -- (-2074.015) (-2090.375) (-2081.494) [-2073.297] * [-2074.343] (-2073.370) (-2067.139) (-2096.527) -- 0:01:23
706400 -- (-2077.229) (-2090.533) [-2076.979] (-2080.179) * (-2076.769) (-2070.787) [-2071.661] (-2077.401) -- 0:01:23
706500 -- [-2077.567] (-2081.555) (-2083.147) (-2079.544) * (-2081.865) (-2075.587) (-2072.370) [-2074.758] -- 0:01:23
706600 -- (-2076.802) (-2085.157) (-2072.363) [-2070.426] * (-2076.052) (-2076.687) [-2077.650] (-2082.733) -- 0:01:23
706700 -- (-2073.977) (-2080.129) [-2073.314] (-2076.402) * [-2073.952] (-2077.989) (-2082.630) (-2083.895) -- 0:01:23
706800 -- [-2074.772] (-2081.436) (-2081.287) (-2076.370) * (-2077.102) (-2081.539) (-2075.965) [-2075.914] -- 0:01:23
706900 -- (-2072.669) (-2074.427) (-2083.495) [-2069.670] * (-2075.906) (-2079.665) [-2077.068] (-2075.542) -- 0:01:23
707000 -- (-2076.763) (-2087.223) [-2075.909] (-2083.968) * [-2073.675] (-2083.113) (-2075.639) (-2082.626) -- 0:01:23
Average standard deviation of split frequencies: 0.004190
707100 -- [-2072.891] (-2096.410) (-2075.978) (-2074.852) * [-2077.479] (-2081.794) (-2082.103) (-2079.364) -- 0:01:23
707200 -- [-2072.788] (-2087.734) (-2078.226) (-2076.940) * [-2084.235] (-2076.700) (-2075.197) (-2088.853) -- 0:01:23
707300 -- [-2067.211] (-2081.365) (-2082.414) (-2073.570) * (-2078.115) (-2082.746) [-2068.887] (-2082.576) -- 0:01:23
707400 -- (-2072.279) (-2083.805) [-2075.545] (-2076.956) * [-2078.623] (-2075.057) (-2077.915) (-2085.505) -- 0:01:23
707500 -- [-2069.615] (-2089.308) (-2082.209) (-2078.802) * (-2072.472) (-2074.483) [-2081.739] (-2086.918) -- 0:01:23
707600 -- (-2072.967) (-2085.262) (-2081.883) [-2073.916] * (-2073.916) [-2073.180] (-2084.303) (-2084.354) -- 0:01:23
707700 -- [-2073.661] (-2086.225) (-2076.470) (-2075.202) * [-2080.013] (-2078.705) (-2083.455) (-2089.590) -- 0:01:23
707800 -- [-2071.050] (-2085.763) (-2079.388) (-2075.551) * [-2074.783] (-2083.366) (-2073.916) (-2077.348) -- 0:01:23
707900 -- (-2075.951) (-2074.878) (-2076.663) [-2076.491] * (-2076.682) [-2080.792] (-2081.360) (-2080.476) -- 0:01:23
708000 -- (-2076.952) (-2086.096) (-2079.104) [-2068.504] * (-2074.334) [-2071.409] (-2079.153) (-2079.383) -- 0:01:23
Average standard deviation of split frequencies: 0.004260
708100 -- (-2079.497) (-2074.433) (-2074.325) [-2075.579] * (-2078.501) [-2071.578] (-2093.289) (-2081.157) -- 0:01:23
708200 -- (-2077.499) (-2075.133) [-2079.769] (-2069.701) * (-2081.882) [-2073.878] (-2087.485) (-2088.816) -- 0:01:23
708300 -- (-2075.757) (-2080.405) (-2079.520) [-2068.483] * (-2080.142) (-2076.164) (-2087.895) [-2084.041] -- 0:01:23
708400 -- (-2077.581) (-2073.299) (-2080.531) [-2076.971] * (-2074.800) [-2074.895] (-2092.974) (-2092.908) -- 0:01:23
708500 -- (-2078.981) [-2071.996] (-2083.057) (-2072.518) * [-2072.541] (-2074.156) (-2100.602) (-2090.419) -- 0:01:23
708600 -- (-2073.959) [-2068.779] (-2085.300) (-2072.018) * (-2075.913) [-2067.892] (-2097.766) (-2085.251) -- 0:01:23
708700 -- (-2074.526) (-2069.702) [-2086.394] (-2070.921) * (-2075.352) [-2069.375] (-2108.247) (-2082.507) -- 0:01:23
708800 -- (-2079.297) (-2077.900) (-2078.837) [-2069.890] * (-2080.563) [-2069.131] (-2095.766) (-2079.403) -- 0:01:22
708900 -- (-2078.808) (-2071.009) (-2076.961) [-2066.650] * (-2093.220) [-2073.679] (-2092.852) (-2077.297) -- 0:01:22
709000 -- (-2082.932) (-2067.166) (-2078.277) [-2069.365] * (-2093.980) [-2069.255] (-2093.228) (-2088.822) -- 0:01:22
Average standard deviation of split frequencies: 0.004273
709100 -- [-2071.906] (-2072.432) (-2083.797) (-2069.033) * (-2087.577) [-2076.299] (-2090.301) (-2082.331) -- 0:01:22
709200 -- (-2076.689) (-2071.103) (-2076.993) [-2081.796] * (-2086.305) (-2072.050) (-2083.170) [-2084.118] -- 0:01:22
709300 -- (-2078.705) [-2067.978] (-2074.553) (-2084.088) * (-2087.395) (-2078.047) (-2076.709) [-2078.105] -- 0:01:22
709400 -- [-2074.843] (-2073.464) (-2080.347) (-2073.898) * (-2087.960) [-2068.689] (-2079.696) (-2075.737) -- 0:01:22
709500 -- [-2069.239] (-2081.134) (-2076.998) (-2073.199) * (-2084.625) [-2070.475] (-2076.806) (-2081.865) -- 0:01:22
709600 -- (-2079.320) (-2082.725) (-2082.251) [-2070.238] * (-2083.904) [-2072.098] (-2078.157) (-2075.996) -- 0:01:22
709700 -- (-2075.470) (-2083.442) (-2078.462) [-2070.338] * [-2081.745] (-2070.671) (-2075.022) (-2086.598) -- 0:01:22
709800 -- [-2076.325] (-2072.401) (-2080.525) (-2075.446) * (-2078.591) [-2071.071] (-2083.209) (-2087.834) -- 0:01:22
709900 -- [-2071.460] (-2077.370) (-2080.664) (-2075.512) * (-2083.467) [-2068.869] (-2080.986) (-2079.465) -- 0:01:22
710000 -- (-2076.281) (-2073.745) (-2082.218) [-2071.749] * (-2080.868) [-2067.801] (-2091.540) (-2082.729) -- 0:01:22
Average standard deviation of split frequencies: 0.004040
710100 -- (-2078.958) (-2073.527) [-2075.934] (-2076.522) * (-2079.254) [-2068.119] (-2087.008) (-2080.770) -- 0:01:22
710200 -- (-2078.089) [-2069.506] (-2081.613) (-2078.753) * (-2078.494) (-2072.091) (-2095.994) [-2080.494] -- 0:01:22
710300 -- (-2081.471) (-2081.928) (-2078.309) [-2072.725] * (-2079.219) [-2071.892] (-2086.807) (-2083.544) -- 0:01:22
710400 -- (-2085.329) (-2070.711) (-2076.394) [-2068.139] * (-2081.639) [-2069.331] (-2086.877) (-2086.849) -- 0:01:22
710500 -- (-2090.109) (-2075.411) (-2082.804) [-2069.415] * (-2094.347) [-2072.428] (-2078.145) (-2089.606) -- 0:01:22
710600 -- (-2085.674) (-2074.877) [-2071.149] (-2072.362) * (-2091.422) (-2077.512) [-2076.060] (-2080.716) -- 0:01:22
710700 -- (-2083.242) (-2074.173) [-2075.495] (-2075.279) * (-2082.206) (-2075.693) [-2078.191] (-2087.454) -- 0:01:22
710800 -- (-2082.958) (-2076.311) [-2080.124] (-2075.887) * (-2083.841) (-2074.816) [-2073.480] (-2087.353) -- 0:01:22
710900 -- (-2075.381) (-2083.686) (-2087.795) [-2074.487] * (-2081.748) (-2078.740) [-2085.412] (-2090.554) -- 0:01:22
711000 -- (-2076.196) (-2095.949) (-2081.227) [-2072.036] * (-2079.355) (-2083.792) (-2087.207) [-2084.310] -- 0:01:22
Average standard deviation of split frequencies: 0.003977
711100 -- (-2072.723) [-2073.402] (-2083.913) (-2072.754) * [-2076.443] (-2077.346) (-2084.783) (-2085.775) -- 0:01:22
711200 -- (-2072.777) [-2076.372] (-2094.762) (-2073.475) * [-2081.584] (-2078.016) (-2087.893) (-2088.259) -- 0:01:22
711300 -- [-2074.457] (-2079.295) (-2079.783) (-2078.915) * [-2076.449] (-2082.689) (-2082.262) (-2083.891) -- 0:01:22
711400 -- (-2080.544) (-2075.277) (-2073.784) [-2071.034] * (-2080.591) [-2075.529] (-2082.210) (-2092.672) -- 0:01:22
711500 -- (-2078.867) [-2072.869] (-2076.063) (-2074.895) * [-2079.545] (-2076.386) (-2077.400) (-2089.228) -- 0:01:22
711600 -- [-2074.674] (-2075.410) (-2074.657) (-2070.652) * (-2088.549) [-2073.489] (-2088.519) (-2084.198) -- 0:01:22
711700 -- (-2075.377) [-2073.474] (-2080.352) (-2073.580) * (-2091.988) (-2079.406) [-2078.195] (-2078.206) -- 0:01:22
711800 -- (-2078.830) [-2076.928] (-2081.613) (-2077.066) * (-2086.200) (-2076.207) (-2078.908) [-2079.137] -- 0:01:22
711900 -- (-2075.546) (-2077.162) (-2081.467) [-2075.434] * (-2085.760) [-2068.845] (-2079.087) (-2078.715) -- 0:01:22
712000 -- (-2079.299) (-2080.119) [-2075.963] (-2069.505) * (-2081.383) (-2065.032) (-2083.216) [-2076.910] -- 0:01:22
Average standard deviation of split frequencies: 0.003877
712100 -- (-2092.574) [-2077.135] (-2080.133) (-2074.145) * (-2075.799) [-2069.136] (-2077.098) (-2078.135) -- 0:01:22
712200 -- (-2092.479) (-2069.380) (-2074.958) [-2071.943] * (-2079.878) (-2071.053) [-2082.757] (-2081.685) -- 0:01:22
712300 -- (-2080.660) [-2069.265] (-2079.603) (-2075.218) * (-2088.935) (-2072.537) (-2086.806) [-2075.713] -- 0:01:21
712400 -- (-2081.300) (-2069.025) [-2073.926] (-2071.754) * (-2093.320) [-2073.457] (-2083.060) (-2078.950) -- 0:01:21
712500 -- (-2080.615) (-2076.182) (-2083.244) [-2069.204] * (-2097.543) (-2075.857) (-2085.242) [-2075.600] -- 0:01:21
712600 -- (-2081.865) (-2071.993) (-2086.236) [-2073.608] * (-2079.447) (-2077.499) (-2083.988) [-2076.211] -- 0:01:21
712700 -- (-2078.161) (-2074.370) (-2079.950) [-2071.684] * (-2078.480) (-2086.052) (-2076.545) [-2073.037] -- 0:01:21
712800 -- (-2075.911) [-2072.445] (-2095.010) (-2080.425) * (-2078.780) (-2080.329) [-2074.429] (-2074.877) -- 0:01:21
712900 -- (-2079.689) [-2068.051] (-2077.230) (-2079.958) * (-2081.115) [-2076.947] (-2077.912) (-2078.260) -- 0:01:21
713000 -- (-2083.129) [-2071.496] (-2078.628) (-2073.886) * (-2082.916) (-2078.744) (-2080.030) [-2078.683] -- 0:01:21
Average standard deviation of split frequencies: 0.003947
713100 -- (-2079.978) [-2069.738] (-2084.952) (-2077.420) * (-2073.740) (-2081.516) [-2076.889] (-2079.726) -- 0:01:21
713200 -- [-2085.533] (-2084.254) (-2093.591) (-2074.602) * [-2080.724] (-2072.566) (-2078.445) (-2084.123) -- 0:01:21
713300 -- (-2089.499) [-2075.293] (-2098.094) (-2073.605) * (-2086.713) (-2075.441) (-2076.581) [-2077.239] -- 0:01:21
713400 -- (-2083.533) (-2069.193) (-2090.841) [-2073.364] * (-2077.776) [-2072.986] (-2082.295) (-2076.049) -- 0:01:21
713500 -- (-2078.473) [-2069.133] (-2084.597) (-2068.287) * (-2078.001) (-2074.949) [-2075.097] (-2077.970) -- 0:01:21
713600 -- (-2077.842) (-2073.509) (-2095.972) [-2069.896] * (-2082.761) [-2071.241] (-2078.223) (-2078.868) -- 0:01:21
713700 -- (-2087.236) [-2067.541] (-2088.626) (-2080.971) * (-2082.673) [-2076.124] (-2089.741) (-2079.892) -- 0:01:21
713800 -- (-2094.729) (-2079.051) (-2084.817) [-2078.041] * [-2075.487] (-2085.964) (-2083.620) (-2085.321) -- 0:01:21
713900 -- (-2098.241) [-2077.701] (-2085.710) (-2075.108) * [-2077.874] (-2074.692) (-2080.486) (-2083.188) -- 0:01:21
714000 -- (-2087.344) (-2078.216) (-2086.196) [-2070.205] * (-2088.200) [-2076.632] (-2081.228) (-2090.830) -- 0:01:21
Average standard deviation of split frequencies: 0.003980
714100 -- (-2091.226) (-2077.695) (-2085.492) [-2077.852] * (-2083.966) (-2082.353) (-2077.303) [-2078.715] -- 0:01:21
714200 -- (-2095.116) (-2076.447) (-2090.412) [-2074.867] * [-2073.940] (-2079.471) (-2078.693) (-2080.057) -- 0:01:21
714300 -- (-2093.211) (-2078.780) (-2088.163) [-2073.542] * [-2073.501] (-2080.630) (-2084.708) (-2078.861) -- 0:01:21
714400 -- (-2095.586) (-2080.797) (-2084.319) [-2074.899] * [-2074.174] (-2080.989) (-2083.320) (-2081.673) -- 0:01:21
714500 -- (-2098.395) (-2082.632) (-2082.282) [-2075.763] * [-2074.826] (-2085.741) (-2078.442) (-2076.193) -- 0:01:21
714600 -- (-2089.204) (-2078.150) (-2089.588) [-2076.253] * [-2078.561] (-2078.418) (-2082.305) (-2075.860) -- 0:01:21
714700 -- (-2085.470) (-2074.656) (-2086.227) [-2071.748] * (-2076.886) [-2083.665] (-2094.831) (-2077.701) -- 0:01:21
714800 -- (-2091.686) (-2075.673) (-2085.526) [-2070.676] * (-2077.040) (-2082.951) (-2086.178) [-2077.274] -- 0:01:21
714900 -- (-2087.135) (-2072.871) (-2095.154) [-2069.786] * (-2078.588) (-2081.921) (-2085.740) [-2075.171] -- 0:01:21
715000 -- (-2094.773) (-2072.315) (-2078.167) [-2072.113] * (-2090.119) [-2073.715] (-2082.608) (-2077.224) -- 0:01:21
Average standard deviation of split frequencies: 0.004087
715100 -- (-2096.076) (-2082.135) (-2087.135) [-2073.968] * (-2089.750) [-2073.778] (-2085.824) (-2091.729) -- 0:01:21
715200 -- (-2095.190) (-2080.788) (-2091.571) [-2072.041] * (-2092.677) [-2074.579] (-2082.467) (-2081.025) -- 0:01:21
715300 -- (-2087.897) (-2078.176) (-2083.081) [-2070.387] * (-2089.584) [-2085.978] (-2086.095) (-2083.377) -- 0:01:21
715400 -- (-2083.120) (-2077.483) (-2079.054) [-2069.073] * (-2086.522) (-2073.424) [-2085.017] (-2084.050) -- 0:01:21
715500 -- [-2081.348] (-2077.070) (-2077.726) (-2070.833) * (-2094.156) [-2069.774] (-2091.029) (-2084.795) -- 0:01:21
715600 -- (-2082.008) (-2084.184) (-2074.683) [-2071.888] * (-2092.244) [-2070.477] (-2080.111) (-2084.141) -- 0:01:21
715700 -- (-2076.167) (-2088.782) (-2077.897) [-2073.766] * (-2092.001) [-2070.383] (-2084.743) (-2085.982) -- 0:01:21
715800 -- (-2083.597) (-2076.203) (-2078.109) [-2070.005] * (-2088.739) (-2069.322) (-2097.915) [-2086.234] -- 0:01:20
715900 -- (-2095.478) [-2076.616] (-2078.897) (-2069.984) * (-2083.729) [-2070.163] (-2087.386) (-2079.819) -- 0:01:20
716000 -- (-2091.465) (-2077.435) (-2077.924) [-2068.772] * [-2076.614] (-2075.546) (-2082.725) (-2086.726) -- 0:01:20
Average standard deviation of split frequencies: 0.004251
716100 -- (-2082.020) (-2069.210) [-2076.430] (-2070.007) * (-2077.014) (-2073.030) (-2083.971) [-2077.775] -- 0:01:20
716200 -- (-2082.111) [-2072.409] (-2087.234) (-2071.277) * [-2076.555] (-2075.043) (-2087.909) (-2080.018) -- 0:01:20
716300 -- (-2079.189) [-2072.798] (-2090.781) (-2069.558) * (-2081.707) [-2072.999] (-2089.957) (-2071.735) -- 0:01:20
716400 -- (-2076.521) (-2080.067) (-2086.148) [-2071.359] * (-2076.752) [-2069.467] (-2093.751) (-2076.391) -- 0:01:20
716500 -- (-2080.988) (-2076.339) (-2093.676) [-2069.217] * (-2076.374) [-2075.131] (-2083.762) (-2086.589) -- 0:01:20
716600 -- (-2078.777) [-2072.385] (-2093.984) (-2072.231) * (-2076.531) (-2071.980) [-2079.170] (-2080.768) -- 0:01:20
716700 -- (-2079.758) (-2075.229) (-2078.311) [-2066.666] * (-2078.547) [-2075.627] (-2089.084) (-2084.813) -- 0:01:20
716800 -- (-2077.842) (-2078.834) (-2085.628) [-2073.412] * [-2078.753] (-2078.049) (-2077.608) (-2085.863) -- 0:01:20
716900 -- (-2080.251) [-2071.690] (-2085.853) (-2073.579) * [-2075.392] (-2076.796) (-2076.740) (-2076.576) -- 0:01:20
717000 -- (-2086.128) (-2076.370) (-2086.621) [-2076.642] * (-2080.720) [-2071.121] (-2084.107) (-2088.945) -- 0:01:20
Average standard deviation of split frequencies: 0.004376
717100 -- (-2089.815) [-2074.605] (-2085.504) (-2077.567) * (-2074.974) [-2068.232] (-2078.596) (-2088.545) -- 0:01:20
717200 -- (-2092.392) [-2077.464] (-2098.737) (-2075.141) * (-2087.759) [-2074.348] (-2081.491) (-2080.293) -- 0:01:20
717300 -- (-2096.494) [-2081.314] (-2083.558) (-2075.303) * (-2077.187) (-2085.247) [-2076.308] (-2077.495) -- 0:01:20
717400 -- (-2078.342) (-2081.256) (-2085.133) [-2072.533] * (-2088.711) (-2082.449) [-2073.414] (-2075.253) -- 0:01:20
717500 -- [-2075.887] (-2084.983) (-2084.076) (-2072.870) * (-2084.611) (-2080.944) (-2075.097) [-2077.320] -- 0:01:20
717600 -- (-2078.029) (-2078.690) (-2082.630) [-2081.626] * [-2078.290] (-2078.431) (-2075.604) (-2076.239) -- 0:01:20
717700 -- (-2075.530) [-2074.059] (-2084.811) (-2071.894) * (-2082.963) [-2076.126] (-2075.370) (-2077.343) -- 0:01:20
717800 -- (-2078.284) (-2084.876) (-2086.212) [-2078.185] * [-2081.390] (-2071.023) (-2082.167) (-2081.307) -- 0:01:20
717900 -- [-2073.194] (-2081.471) (-2087.797) (-2071.643) * (-2083.697) (-2077.568) [-2078.936] (-2088.294) -- 0:01:20
718000 -- (-2086.370) (-2076.260) (-2086.142) [-2069.270] * (-2075.121) (-2077.378) (-2100.625) [-2086.769] -- 0:01:20
Average standard deviation of split frequencies: 0.004107
718100 -- (-2083.807) (-2082.716) (-2080.083) [-2069.291] * (-2079.404) [-2072.701] (-2090.178) (-2087.161) -- 0:01:20
718200 -- (-2080.890) (-2087.305) (-2084.690) [-2069.656] * (-2083.125) [-2075.945] (-2096.161) (-2080.252) -- 0:01:20
718300 -- (-2083.999) (-2080.842) (-2076.154) [-2075.356] * (-2083.711) [-2072.032] (-2087.336) (-2081.911) -- 0:01:20
718400 -- (-2087.426) (-2074.982) (-2080.670) [-2071.008] * (-2079.646) [-2075.747] (-2091.739) (-2084.204) -- 0:01:20
718500 -- (-2082.535) (-2076.550) (-2086.905) [-2073.803] * [-2082.640] (-2070.904) (-2082.725) (-2086.840) -- 0:01:20
718600 -- (-2079.930) [-2073.314] (-2084.892) (-2075.976) * (-2087.749) (-2075.906) [-2073.342] (-2090.924) -- 0:01:20
718700 -- (-2074.935) [-2072.704] (-2087.051) (-2070.678) * (-2085.903) [-2075.020] (-2081.009) (-2074.083) -- 0:01:20
718800 -- (-2086.706) (-2070.117) (-2085.764) [-2071.941] * (-2081.269) [-2073.001] (-2088.197) (-2083.834) -- 0:01:20
718900 -- (-2085.590) [-2074.432] (-2084.129) (-2076.068) * (-2075.366) [-2074.109] (-2074.660) (-2083.996) -- 0:01:20
719000 -- (-2085.941) (-2071.920) (-2085.290) [-2076.141] * (-2077.030) [-2068.611] (-2082.483) (-2080.407) -- 0:01:20
Average standard deviation of split frequencies: 0.003970
719100 -- (-2090.979) [-2069.263] (-2083.802) (-2076.965) * [-2079.684] (-2074.900) (-2084.604) (-2088.017) -- 0:01:20
719200 -- (-2086.087) [-2075.546] (-2086.606) (-2071.432) * [-2074.419] (-2067.644) (-2076.112) (-2084.631) -- 0:01:20
719300 -- (-2082.364) [-2070.091] (-2080.625) (-2076.833) * (-2083.866) (-2071.487) [-2074.035] (-2082.714) -- 0:01:19
719400 -- (-2084.897) (-2074.683) [-2079.101] (-2079.051) * [-2077.948] (-2073.086) (-2082.712) (-2083.146) -- 0:01:19
719500 -- (-2077.741) (-2079.374) (-2078.384) [-2072.989] * (-2080.318) (-2073.952) (-2085.004) [-2076.362] -- 0:01:19
719600 -- [-2080.117] (-2076.051) (-2081.524) (-2075.075) * [-2079.073] (-2074.592) (-2089.906) (-2076.450) -- 0:01:19
719700 -- (-2079.832) (-2075.057) (-2100.578) [-2075.379] * (-2076.204) (-2077.006) [-2080.752] (-2080.988) -- 0:01:19
719800 -- [-2077.326] (-2081.165) (-2085.366) (-2075.733) * [-2074.697] (-2076.368) (-2073.986) (-2083.154) -- 0:01:19
719900 -- (-2077.403) [-2076.140] (-2078.343) (-2069.480) * (-2078.536) (-2084.656) [-2072.680] (-2083.802) -- 0:01:19
720000 -- (-2078.017) (-2077.708) (-2088.564) [-2069.451] * (-2079.828) (-2083.816) (-2081.673) [-2078.278] -- 0:01:19
Average standard deviation of split frequencies: 0.004133
720100 -- [-2073.671] (-2077.144) (-2082.833) (-2073.881) * (-2078.911) (-2082.060) [-2077.140] (-2086.550) -- 0:01:19
720200 -- (-2082.876) (-2071.978) (-2085.934) [-2067.596] * [-2074.228] (-2083.244) (-2086.414) (-2077.939) -- 0:01:20
720300 -- (-2083.479) [-2072.881] (-2083.410) (-2079.219) * [-2072.429] (-2086.049) (-2073.150) (-2076.749) -- 0:01:19
720400 -- (-2083.168) [-2077.402] (-2088.819) (-2075.608) * (-2072.104) (-2080.554) (-2073.682) [-2077.497] -- 0:01:19
720500 -- (-2087.795) (-2074.220) [-2076.400] (-2074.908) * [-2073.733] (-2081.922) (-2078.387) (-2073.411) -- 0:01:19
720600 -- (-2086.880) [-2071.797] (-2086.420) (-2074.253) * (-2077.782) [-2082.084] (-2080.676) (-2074.897) -- 0:01:19
720700 -- (-2101.647) [-2070.742] (-2088.405) (-2076.085) * (-2083.344) [-2070.259] (-2084.032) (-2074.135) -- 0:01:19
720800 -- (-2097.240) [-2069.151] (-2077.242) (-2072.984) * (-2079.773) (-2075.133) [-2078.316] (-2078.548) -- 0:01:19
720900 -- (-2100.481) (-2074.939) (-2074.975) [-2070.798] * [-2073.086] (-2069.624) (-2088.064) (-2079.351) -- 0:01:19
721000 -- (-2095.051) [-2068.220] (-2077.630) (-2070.626) * (-2082.840) [-2074.217] (-2079.351) (-2083.647) -- 0:01:19
Average standard deviation of split frequencies: 0.004183
721100 -- (-2090.567) (-2070.593) [-2082.522] (-2074.659) * [-2078.637] (-2072.468) (-2081.100) (-2085.641) -- 0:01:19
721200 -- (-2089.665) [-2073.190] (-2076.884) (-2073.100) * [-2078.430] (-2071.797) (-2082.757) (-2085.317) -- 0:01:19
721300 -- (-2080.361) (-2083.565) [-2073.088] (-2078.768) * [-2072.236] (-2076.038) (-2085.012) (-2077.775) -- 0:01:19
721400 -- (-2082.013) [-2076.595] (-2076.238) (-2077.768) * (-2074.695) [-2079.006] (-2091.467) (-2079.295) -- 0:01:19
721500 -- (-2079.155) [-2074.769] (-2078.723) (-2073.089) * (-2075.251) (-2074.805) (-2082.669) [-2076.482] -- 0:01:19
721600 -- (-2080.991) [-2072.021] (-2081.603) (-2077.598) * (-2081.577) (-2074.296) (-2073.063) [-2076.512] -- 0:01:19
721700 -- (-2077.637) [-2072.618] (-2079.368) (-2079.127) * (-2082.692) (-2077.729) [-2076.992] (-2072.741) -- 0:01:19
721800 -- (-2086.243) [-2072.214] (-2080.721) (-2076.668) * (-2079.199) (-2073.576) [-2080.063] (-2072.703) -- 0:01:19
721900 -- (-2081.054) [-2070.841] (-2076.144) (-2076.624) * (-2074.425) [-2071.385] (-2081.529) (-2080.602) -- 0:01:19
722000 -- (-2083.721) (-2073.496) [-2078.208] (-2074.092) * [-2070.546] (-2073.045) (-2085.729) (-2080.625) -- 0:01:19
Average standard deviation of split frequencies: 0.004234
722100 -- (-2077.752) [-2074.467] (-2084.206) (-2078.838) * (-2072.160) (-2069.823) (-2084.008) [-2077.088] -- 0:01:19
722200 -- (-2085.897) (-2072.989) (-2088.989) [-2074.962] * (-2074.571) [-2073.723] (-2085.672) (-2075.715) -- 0:01:19
722300 -- (-2090.849) [-2074.180] (-2088.837) (-2076.517) * [-2072.427] (-2069.556) (-2087.218) (-2085.702) -- 0:01:19
722400 -- (-2090.817) [-2071.470] (-2089.581) (-2080.083) * [-2069.194] (-2076.380) (-2082.676) (-2080.050) -- 0:01:19
722500 -- (-2080.982) (-2076.190) [-2077.493] (-2076.566) * (-2072.547) (-2071.948) [-2077.664] (-2080.289) -- 0:01:19
722600 -- (-2082.846) [-2077.213] (-2079.673) (-2074.563) * (-2075.325) [-2076.422] (-2082.964) (-2082.716) -- 0:01:19
722700 -- (-2081.867) (-2071.419) [-2074.545] (-2083.407) * (-2073.688) (-2077.371) (-2084.706) [-2077.867] -- 0:01:19
722800 -- [-2079.128] (-2066.493) (-2080.648) (-2086.757) * (-2071.826) [-2069.618] (-2092.522) (-2081.958) -- 0:01:19
722900 -- (-2076.613) [-2070.954] (-2083.025) (-2085.569) * (-2072.510) [-2072.167] (-2086.021) (-2084.821) -- 0:01:18
723000 -- (-2072.459) (-2080.019) (-2075.757) [-2078.360] * [-2075.767] (-2081.550) (-2076.027) (-2084.887) -- 0:01:18
Average standard deviation of split frequencies: 0.004209
723100 -- (-2081.081) (-2081.668) (-2076.419) [-2074.673] * [-2069.545] (-2073.553) (-2077.263) (-2089.876) -- 0:01:18
723200 -- (-2083.123) (-2083.465) [-2082.199] (-2085.368) * [-2070.508] (-2071.705) (-2079.380) (-2079.150) -- 0:01:18
723300 -- (-2085.083) (-2080.223) [-2078.876] (-2081.875) * [-2075.401] (-2071.181) (-2078.416) (-2077.051) -- 0:01:18
723400 -- (-2081.238) (-2089.761) [-2075.554] (-2089.080) * (-2080.889) [-2069.004] (-2077.473) (-2077.597) -- 0:01:18
723500 -- (-2078.884) (-2081.042) (-2076.998) [-2072.327] * [-2075.426] (-2079.623) (-2083.240) (-2085.511) -- 0:01:18
723600 -- (-2079.008) (-2074.036) (-2082.061) [-2073.543] * (-2072.097) (-2069.423) (-2084.750) [-2078.415] -- 0:01:18
723700 -- (-2081.160) (-2079.783) (-2076.901) [-2073.324] * (-2078.861) [-2070.982] (-2081.661) (-2077.365) -- 0:01:19
723800 -- (-2087.325) (-2071.211) (-2078.750) [-2076.853] * [-2076.120] (-2075.999) (-2080.230) (-2081.890) -- 0:01:18
723900 -- (-2084.017) (-2076.365) (-2080.551) [-2077.912] * (-2079.603) [-2074.147] (-2076.224) (-2074.742) -- 0:01:18
724000 -- (-2092.890) (-2074.735) (-2079.199) [-2071.725] * (-2073.755) (-2076.020) [-2075.193] (-2079.771) -- 0:01:18
Average standard deviation of split frequencies: 0.004241
724100 -- (-2082.805) (-2072.077) (-2078.465) [-2073.108] * (-2072.835) [-2072.492] (-2073.722) (-2081.435) -- 0:01:18
724200 -- (-2079.507) [-2075.353] (-2078.751) (-2069.374) * [-2069.567] (-2078.308) (-2073.715) (-2081.871) -- 0:01:18
724300 -- (-2086.552) [-2072.799] (-2088.109) (-2069.839) * [-2071.876] (-2080.126) (-2073.016) (-2092.703) -- 0:01:18
724400 -- (-2078.460) [-2072.938] (-2105.906) (-2072.573) * [-2072.001] (-2075.852) (-2075.615) (-2087.012) -- 0:01:18
724500 -- (-2083.600) [-2071.580] (-2092.140) (-2070.999) * (-2068.960) (-2072.463) [-2073.909] (-2084.538) -- 0:01:18
724600 -- (-2077.685) [-2068.683] (-2092.937) (-2073.497) * (-2075.110) [-2069.697] (-2083.631) (-2076.778) -- 0:01:18
724700 -- (-2076.762) [-2073.636] (-2089.609) (-2071.935) * [-2068.643] (-2070.022) (-2079.308) (-2082.489) -- 0:01:18
724800 -- (-2079.005) [-2077.000] (-2083.861) (-2069.806) * (-2069.723) (-2078.361) [-2079.861] (-2075.753) -- 0:01:18
724900 -- (-2079.267) (-2078.411) (-2089.543) [-2070.173] * (-2070.770) [-2078.402] (-2081.409) (-2086.131) -- 0:01:18
725000 -- (-2078.958) (-2073.579) (-2084.230) [-2067.310] * (-2070.183) (-2079.556) (-2089.070) [-2082.065] -- 0:01:18
Average standard deviation of split frequencies: 0.004216
725100 -- (-2074.163) [-2077.775] (-2084.418) (-2071.611) * [-2068.488] (-2070.284) (-2078.867) (-2085.158) -- 0:01:18
725200 -- (-2076.855) (-2081.902) (-2082.700) [-2072.487] * (-2076.563) (-2074.201) [-2081.103] (-2092.686) -- 0:01:18
725300 -- (-2075.369) (-2080.337) (-2084.809) [-2071.384] * [-2069.290] (-2076.252) (-2088.356) (-2078.373) -- 0:01:18
725400 -- (-2077.750) (-2078.839) [-2078.662] (-2073.774) * (-2073.287) [-2070.797] (-2087.655) (-2081.538) -- 0:01:18
725500 -- (-2084.759) [-2075.510] (-2081.586) (-2072.864) * (-2070.920) [-2071.718] (-2080.677) (-2086.083) -- 0:01:18
725600 -- (-2091.462) (-2074.004) (-2082.050) [-2076.674] * (-2070.017) [-2071.147] (-2086.697) (-2081.069) -- 0:01:18
725700 -- (-2078.277) [-2068.583] (-2089.577) (-2068.967) * (-2076.099) [-2068.036] (-2089.007) (-2082.160) -- 0:01:18
725800 -- [-2085.671] (-2070.855) (-2079.700) (-2079.539) * (-2077.187) [-2072.300] (-2078.747) (-2080.466) -- 0:01:18
725900 -- (-2084.321) (-2072.076) (-2079.293) [-2070.316] * (-2075.339) [-2072.984] (-2091.108) (-2085.772) -- 0:01:18
726000 -- (-2081.454) [-2072.651] (-2078.077) (-2075.991) * [-2071.143] (-2071.077) (-2087.334) (-2084.524) -- 0:01:18
Average standard deviation of split frequencies: 0.004062
726100 -- (-2080.603) (-2073.504) (-2081.132) [-2074.168] * [-2070.687] (-2077.184) (-2083.811) (-2077.578) -- 0:01:18
726200 -- (-2080.141) (-2084.960) [-2072.119] (-2076.950) * [-2072.198] (-2080.646) (-2082.740) (-2089.106) -- 0:01:18
726300 -- (-2075.032) [-2081.952] (-2082.241) (-2078.870) * (-2078.024) (-2073.140) [-2074.840] (-2088.479) -- 0:01:18
726400 -- (-2080.317) (-2084.543) [-2072.672] (-2081.440) * (-2070.668) (-2073.175) [-2080.590] (-2077.945) -- 0:01:17
726500 -- (-2077.602) [-2067.932] (-2077.119) (-2078.973) * [-2070.239] (-2076.613) (-2080.873) (-2080.927) -- 0:01:17
726600 -- [-2081.150] (-2074.583) (-2079.697) (-2082.839) * (-2082.741) [-2073.461] (-2076.403) (-2089.333) -- 0:01:17
726700 -- (-2082.741) [-2072.907] (-2080.664) (-2091.838) * (-2077.699) (-2076.309) [-2072.406] (-2086.130) -- 0:01:17
726800 -- [-2079.978] (-2076.864) (-2081.917) (-2083.957) * [-2076.528] (-2081.538) (-2087.928) (-2083.554) -- 0:01:17
726900 -- (-2081.027) [-2069.516] (-2086.713) (-2073.148) * [-2069.894] (-2082.163) (-2083.174) (-2085.033) -- 0:01:17
727000 -- (-2076.733) [-2070.645] (-2080.254) (-2074.446) * [-2071.941] (-2072.715) (-2075.818) (-2090.615) -- 0:01:17
Average standard deviation of split frequencies: 0.004390
727100 -- (-2079.750) (-2072.326) (-2079.947) [-2067.814] * [-2074.948] (-2075.721) (-2074.112) (-2086.611) -- 0:01:18
727200 -- (-2096.715) (-2080.869) (-2076.935) [-2074.531] * [-2070.641] (-2080.446) (-2076.988) (-2089.689) -- 0:01:18
727300 -- (-2093.688) [-2075.572] (-2080.299) (-2069.993) * (-2078.793) (-2081.853) (-2083.028) [-2085.560] -- 0:01:17
727400 -- (-2079.277) [-2073.199] (-2078.450) (-2072.197) * (-2078.157) [-2074.547] (-2087.779) (-2084.108) -- 0:01:17
727500 -- (-2081.495) (-2074.595) (-2088.325) [-2070.688] * [-2076.238] (-2076.340) (-2080.975) (-2077.624) -- 0:01:17
727600 -- (-2078.283) (-2084.717) (-2081.135) [-2078.206] * (-2083.959) (-2073.630) [-2083.457] (-2080.348) -- 0:01:17
727700 -- (-2076.377) (-2093.345) (-2081.585) [-2074.579] * (-2088.845) (-2076.227) [-2077.413] (-2081.469) -- 0:01:17
727800 -- (-2084.464) (-2082.113) (-2086.553) [-2073.506] * (-2092.686) [-2073.147] (-2081.027) (-2084.636) -- 0:01:17
727900 -- (-2085.350) [-2077.875] (-2095.681) (-2075.491) * (-2091.026) [-2069.466] (-2083.225) (-2086.190) -- 0:01:17
728000 -- (-2082.829) (-2073.465) (-2101.029) [-2069.998] * [-2074.334] (-2068.847) (-2086.232) (-2082.957) -- 0:01:17
Average standard deviation of split frequencies: 0.004587
728100 -- (-2085.910) [-2070.842] (-2086.795) (-2068.508) * [-2070.851] (-2071.483) (-2080.102) (-2088.666) -- 0:01:17
728200 -- (-2080.718) (-2086.228) (-2082.855) [-2073.671] * [-2075.098] (-2067.641) (-2084.504) (-2091.007) -- 0:01:17
728300 -- (-2080.765) (-2084.005) (-2081.845) [-2069.416] * [-2068.708] (-2074.103) (-2080.969) (-2088.307) -- 0:01:17
728400 -- [-2083.613] (-2083.824) (-2083.407) (-2076.245) * [-2071.606] (-2073.270) (-2080.139) (-2088.768) -- 0:01:17
728500 -- (-2085.191) (-2079.256) (-2087.422) [-2072.000] * [-2069.154] (-2072.653) (-2083.281) (-2093.197) -- 0:01:17
728600 -- (-2080.897) (-2075.348) (-2085.220) [-2070.282] * [-2075.006] (-2069.296) (-2075.326) (-2094.565) -- 0:01:17
728700 -- (-2074.004) (-2073.046) (-2079.930) [-2072.203] * (-2069.459) [-2070.842] (-2074.532) (-2085.418) -- 0:01:17
728800 -- (-2089.689) (-2075.784) (-2085.945) [-2071.104] * (-2075.192) [-2069.368] (-2073.847) (-2077.574) -- 0:01:17
728900 -- (-2078.528) [-2072.559] (-2081.038) (-2073.887) * [-2072.028] (-2073.179) (-2079.138) (-2078.823) -- 0:01:17
729000 -- [-2073.948] (-2078.584) (-2078.683) (-2068.254) * (-2069.161) (-2074.291) [-2076.790] (-2074.220) -- 0:01:17
Average standard deviation of split frequencies: 0.004544
729100 -- (-2081.532) (-2076.360) [-2079.894] (-2069.717) * [-2069.970] (-2076.128) (-2075.866) (-2081.684) -- 0:01:17
729200 -- (-2086.880) [-2074.311] (-2085.886) (-2071.593) * [-2073.187] (-2073.912) (-2078.278) (-2075.016) -- 0:01:17
729300 -- [-2076.404] (-2082.299) (-2081.071) (-2084.794) * (-2069.372) (-2075.552) (-2078.094) [-2074.394] -- 0:01:17
729400 -- (-2078.767) (-2076.496) [-2073.301] (-2079.714) * (-2070.822) (-2081.057) (-2078.638) [-2073.582] -- 0:01:17
729500 -- (-2080.143) [-2073.189] (-2080.253) (-2085.511) * [-2071.279] (-2077.518) (-2086.249) (-2074.755) -- 0:01:17
729600 -- [-2076.346] (-2078.212) (-2076.917) (-2093.689) * (-2071.401) [-2071.472] (-2079.847) (-2084.036) -- 0:01:17
729700 -- (-2082.201) (-2075.305) [-2082.604] (-2091.724) * (-2076.359) (-2069.600) (-2087.898) [-2077.450] -- 0:01:17
729800 -- (-2091.112) (-2080.482) [-2080.191] (-2085.303) * (-2073.691) (-2078.171) (-2085.206) [-2068.610] -- 0:01:17
729900 -- (-2090.160) [-2075.773] (-2081.367) (-2083.351) * (-2084.784) (-2073.651) [-2080.184] (-2074.026) -- 0:01:16
730000 -- [-2088.340] (-2079.099) (-2080.294) (-2080.903) * (-2092.550) [-2074.425] (-2081.216) (-2072.431) -- 0:01:16
Average standard deviation of split frequencies: 0.004593
730100 -- (-2081.350) [-2071.239] (-2080.030) (-2079.552) * (-2084.330) [-2074.572] (-2081.239) (-2073.679) -- 0:01:16
730200 -- (-2079.628) (-2072.465) (-2079.173) [-2075.918] * (-2083.151) (-2073.864) [-2079.400] (-2071.479) -- 0:01:16
730300 -- (-2073.560) (-2077.494) (-2085.544) [-2077.187] * (-2079.589) (-2069.138) (-2078.557) [-2070.608] -- 0:01:16
730400 -- (-2072.967) (-2073.873) (-2078.781) [-2077.917] * (-2072.953) (-2068.499) (-2076.966) [-2069.467] -- 0:01:16
730500 -- (-2075.136) (-2075.269) (-2084.587) [-2075.586] * (-2079.058) (-2077.517) (-2081.985) [-2069.798] -- 0:01:17
730600 -- (-2080.120) [-2076.363] (-2083.997) (-2080.822) * (-2075.479) [-2074.137] (-2077.330) (-2071.106) -- 0:01:17
730700 -- (-2077.037) [-2069.231] (-2084.578) (-2077.419) * (-2080.591) [-2074.496] (-2084.624) (-2073.574) -- 0:01:17
730800 -- (-2075.178) [-2068.045] (-2075.723) (-2082.491) * (-2074.600) (-2084.997) (-2073.755) [-2080.343] -- 0:01:16
730900 -- (-2078.417) (-2072.755) [-2079.717] (-2078.522) * (-2076.055) (-2080.570) (-2076.370) [-2079.236] -- 0:01:16
731000 -- (-2077.096) [-2071.575] (-2082.815) (-2090.509) * (-2073.131) (-2082.381) (-2075.539) [-2077.054] -- 0:01:16
Average standard deviation of split frequencies: 0.004421
731100 -- (-2082.751) [-2069.816] (-2083.902) (-2093.813) * (-2078.281) [-2075.737] (-2084.084) (-2080.410) -- 0:01:16
731200 -- (-2079.521) [-2071.049] (-2079.152) (-2087.603) * [-2074.026] (-2083.139) (-2073.687) (-2074.968) -- 0:01:16
731300 -- [-2075.751] (-2074.980) (-2082.486) (-2079.300) * [-2077.495] (-2086.085) (-2074.351) (-2078.443) -- 0:01:16
731400 -- (-2074.991) [-2076.813] (-2084.652) (-2088.327) * [-2072.711] (-2074.379) (-2075.526) (-2081.609) -- 0:01:16
731500 -- [-2074.430] (-2073.256) (-2079.653) (-2082.091) * (-2076.716) [-2070.162] (-2080.137) (-2078.109) -- 0:01:16
731600 -- (-2077.720) [-2073.209] (-2082.379) (-2088.697) * (-2079.175) (-2077.617) (-2081.323) [-2068.012] -- 0:01:16
731700 -- (-2082.739) [-2070.580] (-2082.140) (-2091.502) * [-2077.603] (-2077.326) (-2086.676) (-2074.536) -- 0:01:16
731800 -- [-2074.919] (-2074.499) (-2084.968) (-2102.328) * (-2071.015) [-2073.857] (-2082.808) (-2077.879) -- 0:01:16
731900 -- [-2076.848] (-2076.611) (-2087.240) (-2097.044) * [-2073.697] (-2078.978) (-2091.350) (-2079.907) -- 0:01:16
732000 -- (-2079.128) [-2073.547] (-2083.308) (-2082.182) * [-2069.421] (-2072.171) (-2075.865) (-2086.080) -- 0:01:16
Average standard deviation of split frequencies: 0.004397
732100 -- (-2080.835) [-2070.838] (-2085.196) (-2093.240) * (-2073.751) (-2075.914) [-2081.208] (-2082.461) -- 0:01:16
732200 -- (-2083.195) [-2076.883] (-2089.525) (-2085.227) * (-2081.142) [-2070.907] (-2075.725) (-2078.002) -- 0:01:16
732300 -- (-2076.054) [-2069.031] (-2086.133) (-2087.777) * (-2081.631) [-2069.167] (-2083.962) (-2083.488) -- 0:01:16
732400 -- (-2088.426) [-2070.481] (-2080.606) (-2086.225) * (-2079.806) [-2077.055] (-2082.617) (-2081.794) -- 0:01:16
732500 -- (-2084.383) (-2073.292) (-2078.061) [-2083.577] * [-2074.860] (-2073.468) (-2089.673) (-2080.442) -- 0:01:16
732600 -- (-2087.460) (-2069.974) [-2076.507] (-2079.187) * (-2080.174) (-2081.861) (-2076.414) [-2077.364] -- 0:01:16
732700 -- (-2083.811) [-2073.684] (-2077.834) (-2076.260) * (-2076.544) (-2078.330) (-2078.271) [-2069.648] -- 0:01:16
732800 -- [-2076.236] (-2071.971) (-2078.954) (-2076.461) * [-2073.874] (-2076.094) (-2083.209) (-2077.701) -- 0:01:16
732900 -- (-2080.386) (-2068.764) (-2076.343) [-2073.341] * (-2080.180) (-2079.494) (-2081.599) [-2077.034] -- 0:01:16
733000 -- (-2079.330) [-2067.290] (-2091.526) (-2080.140) * (-2078.565) (-2078.470) (-2076.160) [-2072.341] -- 0:01:16
Average standard deviation of split frequencies: 0.004280
733100 -- (-2075.040) [-2075.383] (-2086.187) (-2083.630) * (-2086.258) (-2082.266) (-2076.156) [-2072.345] -- 0:01:16
733200 -- (-2077.231) (-2077.926) (-2079.621) [-2082.081] * (-2082.515) (-2079.240) (-2074.743) [-2070.116] -- 0:01:16
733300 -- (-2085.334) [-2076.018] (-2077.803) (-2079.015) * (-2085.645) (-2079.497) (-2080.741) [-2069.849] -- 0:01:16
733400 -- (-2092.599) (-2081.763) [-2079.252] (-2079.206) * (-2074.264) (-2077.890) [-2079.655] (-2076.769) -- 0:01:15
733500 -- (-2081.794) (-2077.930) [-2081.013] (-2078.850) * (-2077.369) (-2078.005) [-2075.679] (-2079.442) -- 0:01:15
733600 -- (-2081.383) (-2079.854) (-2076.441) [-2074.788] * (-2079.891) (-2079.546) (-2087.610) [-2073.871] -- 0:01:15
733700 -- (-2082.306) (-2071.103) [-2078.539] (-2081.048) * [-2070.216] (-2079.847) (-2075.052) (-2078.360) -- 0:01:15
733800 -- (-2077.377) (-2086.438) [-2075.602] (-2077.145) * [-2076.756] (-2076.123) (-2082.087) (-2076.626) -- 0:01:15
733900 -- (-2078.683) (-2080.160) (-2079.903) [-2073.003] * [-2070.554] (-2079.118) (-2081.457) (-2075.609) -- 0:01:16
734000 -- (-2076.525) (-2075.716) (-2073.323) [-2070.730] * [-2068.931] (-2085.386) (-2082.849) (-2077.270) -- 0:01:16
Average standard deviation of split frequencies: 0.004091
734100 -- (-2093.609) (-2072.343) (-2084.031) [-2076.415] * (-2074.124) (-2081.646) (-2079.542) [-2072.769] -- 0:01:16
734200 -- (-2083.930) (-2072.177) (-2075.105) [-2068.640] * (-2069.528) [-2079.448] (-2083.496) (-2073.330) -- 0:01:16
734300 -- (-2089.865) [-2078.572] (-2076.849) (-2075.416) * [-2069.908] (-2078.962) (-2081.945) (-2075.664) -- 0:01:15
734400 -- (-2092.389) (-2085.266) (-2080.252) [-2074.335] * (-2072.516) (-2080.915) (-2087.434) [-2068.649] -- 0:01:15
734500 -- (-2094.152) (-2077.333) (-2084.854) [-2075.066] * [-2071.772] (-2079.927) (-2079.917) (-2076.692) -- 0:01:15
734600 -- (-2101.585) (-2079.167) (-2081.751) [-2070.694] * (-2071.826) (-2074.538) [-2073.641] (-2078.373) -- 0:01:15
734700 -- (-2088.736) (-2075.959) [-2072.789] (-2073.689) * (-2075.437) (-2083.922) [-2078.148] (-2073.774) -- 0:01:15
734800 -- (-2090.789) (-2078.507) [-2079.727] (-2075.349) * [-2067.647] (-2078.924) (-2077.342) (-2075.478) -- 0:01:15
734900 -- (-2089.729) (-2071.741) (-2096.974) [-2068.656] * (-2074.237) [-2077.229] (-2084.942) (-2080.913) -- 0:01:15
735000 -- (-2091.445) (-2074.233) (-2086.947) [-2070.499] * [-2074.390] (-2079.352) (-2076.607) (-2081.885) -- 0:01:15
Average standard deviation of split frequencies: 0.004214
735100 -- (-2097.201) (-2076.748) (-2092.936) [-2075.428] * (-2076.775) (-2082.500) (-2085.482) [-2076.881] -- 0:01:15
735200 -- (-2089.839) (-2070.933) (-2088.776) [-2070.667] * [-2077.135] (-2076.121) (-2086.959) (-2083.419) -- 0:01:15
735300 -- (-2081.920) (-2074.210) (-2082.895) [-2074.879] * (-2072.514) (-2082.047) [-2075.491] (-2077.977) -- 0:01:15
735400 -- (-2088.793) (-2079.598) (-2086.192) [-2083.958] * [-2069.063] (-2090.726) (-2075.615) (-2084.224) -- 0:01:15
735500 -- (-2085.499) (-2078.558) (-2083.949) [-2071.394] * [-2075.525] (-2081.004) (-2077.864) (-2078.734) -- 0:01:15
735600 -- (-2080.005) [-2083.946] (-2094.264) (-2080.091) * (-2080.582) (-2076.305) (-2078.344) [-2074.172] -- 0:01:15
735700 -- (-2080.635) (-2074.438) (-2084.115) [-2076.527] * (-2088.277) (-2077.229) (-2076.815) [-2073.283] -- 0:01:15
735800 -- (-2083.690) [-2076.988] (-2073.547) (-2071.532) * (-2085.958) (-2078.717) (-2076.915) [-2068.747] -- 0:01:15
735900 -- (-2086.932) [-2076.585] (-2074.779) (-2073.332) * (-2092.882) [-2074.878] (-2076.279) (-2077.339) -- 0:01:15
736000 -- (-2082.342) [-2077.603] (-2080.770) (-2071.889) * (-2083.949) (-2076.004) [-2077.979] (-2071.157) -- 0:01:15
Average standard deviation of split frequencies: 0.004336
736100 -- (-2085.997) (-2079.489) (-2081.277) [-2074.912] * [-2078.932] (-2083.546) (-2081.846) (-2074.594) -- 0:01:15
736200 -- (-2088.266) (-2087.020) (-2077.404) [-2071.756] * (-2085.647) (-2084.919) (-2079.400) [-2080.122] -- 0:01:15
736300 -- (-2081.487) (-2089.849) (-2077.820) [-2073.588] * (-2082.357) (-2074.704) (-2097.244) [-2073.348] -- 0:01:15
736400 -- (-2083.633) (-2085.835) (-2081.833) [-2071.575] * (-2080.589) (-2081.898) (-2097.937) [-2078.226] -- 0:01:15
736500 -- (-2079.751) (-2081.967) (-2092.488) [-2072.393] * (-2090.805) (-2078.636) (-2073.744) [-2073.836] -- 0:01:15
736600 -- (-2079.918) [-2076.618] (-2084.568) (-2071.929) * (-2084.634) (-2077.701) [-2073.029] (-2073.521) -- 0:01:15
736700 -- (-2079.391) (-2094.273) [-2075.523] (-2070.348) * (-2079.971) (-2081.247) (-2090.986) [-2075.154] -- 0:01:15
736800 -- (-2079.359) [-2082.400] (-2075.498) (-2072.837) * (-2080.710) (-2080.937) [-2078.711] (-2076.544) -- 0:01:15
736900 -- (-2081.530) (-2079.582) [-2075.854] (-2072.766) * [-2080.045] (-2081.588) (-2085.160) (-2085.264) -- 0:01:14
737000 -- (-2086.226) (-2078.832) (-2075.921) [-2073.512] * (-2079.192) [-2084.197] (-2078.195) (-2082.821) -- 0:01:14
Average standard deviation of split frequencies: 0.004202
737100 -- (-2085.976) [-2073.649] (-2075.187) (-2079.323) * [-2076.807] (-2083.956) (-2090.956) (-2090.661) -- 0:01:14
737200 -- (-2088.996) (-2081.374) (-2080.765) [-2074.220] * [-2073.364] (-2077.547) (-2091.223) (-2076.306) -- 0:01:14
737300 -- (-2081.900) (-2080.230) [-2081.128] (-2069.127) * [-2080.944] (-2079.087) (-2080.290) (-2078.122) -- 0:01:15
737400 -- (-2082.538) (-2078.079) (-2076.948) [-2074.114] * (-2075.806) (-2084.896) (-2076.725) [-2075.187] -- 0:01:15
737500 -- (-2080.364) (-2083.418) (-2090.192) [-2070.226] * (-2076.608) (-2091.475) [-2070.478] (-2081.005) -- 0:01:15
737600 -- [-2077.725] (-2089.868) (-2076.475) (-2073.633) * [-2072.180] (-2081.881) (-2077.337) (-2078.151) -- 0:01:15
737700 -- (-2080.461) (-2096.009) [-2072.622] (-2071.947) * (-2073.861) (-2081.584) [-2079.302] (-2081.817) -- 0:01:15
737800 -- (-2086.212) (-2091.744) [-2077.337] (-2074.548) * (-2075.452) (-2082.726) [-2079.012] (-2077.427) -- 0:01:14
737900 -- (-2079.051) (-2074.991) [-2075.470] (-2075.381) * (-2072.054) [-2077.500] (-2082.240) (-2074.383) -- 0:01:14
738000 -- (-2077.600) [-2076.257] (-2077.495) (-2082.671) * [-2071.032] (-2077.941) (-2080.364) (-2073.705) -- 0:01:14
Average standard deviation of split frequencies: 0.004416
738100 -- (-2078.079) (-2080.227) [-2074.108] (-2079.320) * [-2073.493] (-2081.058) (-2076.364) (-2078.860) -- 0:01:14
738200 -- (-2082.181) (-2085.869) [-2074.145] (-2086.045) * [-2071.102] (-2081.683) (-2075.210) (-2083.547) -- 0:01:14
738300 -- (-2076.910) (-2085.683) [-2080.096] (-2085.940) * (-2069.297) (-2090.783) [-2081.696] (-2086.431) -- 0:01:14
738400 -- [-2083.671] (-2085.050) (-2078.139) (-2092.580) * [-2071.085] (-2094.418) (-2077.614) (-2080.600) -- 0:01:14
738500 -- (-2078.038) (-2086.914) [-2077.688] (-2091.352) * (-2070.876) [-2084.988] (-2080.035) (-2070.376) -- 0:01:14
738600 -- [-2074.881] (-2088.133) (-2079.924) (-2077.366) * [-2071.996] (-2085.989) (-2082.722) (-2082.058) -- 0:01:14
738700 -- [-2076.448] (-2086.758) (-2079.452) (-2077.620) * [-2067.709] (-2087.918) (-2083.441) (-2079.729) -- 0:01:14
738800 -- (-2079.787) (-2093.973) (-2077.470) [-2075.390] * (-2074.928) (-2089.062) (-2080.433) [-2074.711] -- 0:01:14
738900 -- (-2082.444) (-2098.799) (-2084.228) [-2072.559] * [-2071.806] (-2082.595) (-2078.377) (-2082.029) -- 0:01:14
739000 -- (-2072.130) (-2094.664) (-2083.598) [-2076.891] * (-2082.792) (-2085.326) (-2083.991) [-2078.528] -- 0:01:14
Average standard deviation of split frequencies: 0.004373
739100 -- (-2074.763) (-2084.108) (-2087.212) [-2069.976] * [-2073.997] (-2082.732) (-2084.364) (-2083.475) -- 0:01:14
739200 -- (-2086.094) (-2085.597) (-2086.715) [-2074.515] * (-2074.387) (-2079.766) (-2081.485) [-2081.567] -- 0:01:14
739300 -- (-2085.214) (-2085.862) [-2084.451] (-2076.186) * [-2071.085] (-2084.321) (-2085.472) (-2075.576) -- 0:01:14
739400 -- (-2081.030) (-2080.327) (-2078.369) [-2071.265] * (-2081.158) [-2078.312] (-2094.228) (-2077.946) -- 0:01:14
739500 -- (-2080.189) (-2078.805) (-2078.121) [-2072.105] * (-2077.250) (-2075.832) (-2089.014) [-2085.764] -- 0:01:14
739600 -- (-2073.993) (-2080.105) (-2079.577) [-2073.002] * [-2076.575] (-2081.929) (-2092.326) (-2081.973) -- 0:01:14
739700 -- (-2081.301) (-2083.166) (-2083.933) [-2068.996] * (-2076.008) (-2080.081) (-2092.558) [-2079.868] -- 0:01:14
739800 -- (-2076.289) (-2091.320) (-2084.600) [-2070.992] * [-2076.813] (-2079.729) (-2101.457) (-2084.370) -- 0:01:14
739900 -- (-2073.466) (-2097.961) [-2078.712] (-2072.857) * [-2072.258] (-2075.270) (-2105.013) (-2080.101) -- 0:01:14
740000 -- [-2074.862] (-2089.094) (-2080.899) (-2074.876) * [-2074.163] (-2078.624) (-2083.737) (-2085.451) -- 0:01:14
Average standard deviation of split frequencies: 0.004568
740100 -- (-2074.560) (-2089.014) (-2095.848) [-2071.547] * [-2074.347] (-2082.550) (-2083.065) (-2085.291) -- 0:01:14
740200 -- (-2076.399) (-2084.188) (-2084.702) [-2069.599] * (-2069.029) [-2076.666] (-2086.164) (-2084.470) -- 0:01:14
740300 -- (-2080.377) (-2085.435) (-2076.104) [-2069.415] * (-2072.338) [-2078.873] (-2075.587) (-2086.722) -- 0:01:14
740400 -- (-2073.640) (-2083.362) (-2082.538) [-2066.397] * [-2076.150] (-2080.741) (-2076.463) (-2083.828) -- 0:01:13
740500 -- (-2082.165) (-2079.183) (-2076.907) [-2072.333] * (-2085.292) (-2079.178) [-2073.242] (-2079.082) -- 0:01:13
740600 -- (-2081.085) [-2081.580] (-2071.955) (-2072.977) * (-2078.476) [-2081.163] (-2075.619) (-2079.586) -- 0:01:13
740700 -- (-2077.414) (-2087.489) [-2077.081] (-2074.017) * [-2074.326] (-2084.358) (-2076.195) (-2075.982) -- 0:01:13
740800 -- (-2091.760) [-2079.035] (-2078.923) (-2070.120) * [-2075.968] (-2080.411) (-2081.387) (-2080.743) -- 0:01:14
740900 -- (-2101.479) (-2078.830) (-2079.126) [-2074.378] * (-2072.938) [-2078.031] (-2084.153) (-2076.049) -- 0:01:14
741000 -- (-2091.157) (-2092.907) (-2079.822) [-2068.182] * [-2068.467] (-2084.899) (-2082.900) (-2079.184) -- 0:01:14
Average standard deviation of split frequencies: 0.004597
741100 -- (-2088.731) (-2103.241) (-2077.782) [-2072.346] * [-2070.138] (-2090.897) (-2081.453) (-2083.442) -- 0:01:14
741200 -- (-2084.751) (-2084.170) (-2079.382) [-2068.768] * [-2065.854] (-2086.029) (-2087.706) (-2075.599) -- 0:01:14
741300 -- (-2082.368) (-2086.510) (-2080.190) [-2069.349] * (-2069.984) (-2084.086) (-2080.998) [-2076.202] -- 0:01:13
741400 -- (-2080.051) (-2085.603) (-2077.196) [-2073.702] * [-2072.488] (-2081.540) (-2083.707) (-2074.296) -- 0:01:13
741500 -- (-2082.490) [-2078.013] (-2076.018) (-2074.223) * (-2081.868) [-2074.749] (-2084.734) (-2080.430) -- 0:01:13
741600 -- [-2077.850] (-2079.288) (-2086.084) (-2077.507) * (-2087.737) (-2081.101) (-2089.869) [-2078.117] -- 0:01:13
741700 -- [-2076.133] (-2082.191) (-2079.199) (-2077.895) * (-2077.518) [-2079.383] (-2088.964) (-2076.670) -- 0:01:13
741800 -- (-2083.819) (-2085.191) (-2078.418) [-2071.810] * (-2083.564) (-2080.328) [-2080.414] (-2079.017) -- 0:01:13
741900 -- (-2078.840) (-2095.519) (-2076.265) [-2071.255] * [-2074.572] (-2079.220) (-2088.960) (-2075.766) -- 0:01:13
742000 -- (-2079.140) (-2081.087) (-2075.218) [-2071.792] * [-2071.722] (-2083.677) (-2087.729) (-2076.483) -- 0:01:13
Average standard deviation of split frequencies: 0.004864
742100 -- (-2074.890) (-2075.285) (-2077.708) [-2077.529] * (-2074.753) (-2083.357) (-2077.262) [-2074.525] -- 0:01:13
742200 -- (-2087.977) [-2076.558] (-2081.437) (-2078.900) * [-2072.394] (-2078.402) (-2073.699) (-2074.643) -- 0:01:13
742300 -- [-2079.747] (-2073.149) (-2076.164) (-2075.500) * (-2070.386) (-2080.344) [-2072.715] (-2075.568) -- 0:01:13
742400 -- (-2083.862) (-2082.889) (-2077.681) [-2081.532] * (-2069.623) [-2077.993] (-2079.655) (-2079.773) -- 0:01:13
742500 -- (-2079.375) (-2079.149) [-2074.448] (-2084.996) * [-2066.589] (-2085.489) (-2077.412) (-2083.251) -- 0:01:13
742600 -- (-2075.190) (-2083.548) [-2077.724] (-2084.584) * [-2069.245] (-2085.620) (-2091.540) (-2080.100) -- 0:01:13
742700 -- [-2077.832] (-2078.674) (-2077.556) (-2075.338) * [-2074.542] (-2090.694) (-2082.986) (-2080.361) -- 0:01:13
742800 -- (-2080.499) (-2078.280) (-2075.245) [-2069.005] * [-2070.470] (-2090.104) (-2076.373) (-2083.156) -- 0:01:13
742900 -- (-2076.623) (-2076.683) (-2074.968) [-2071.410] * (-2069.785) (-2086.222) (-2073.612) [-2076.009] -- 0:01:13
743000 -- (-2080.614) (-2078.781) [-2075.620] (-2074.876) * (-2081.017) (-2082.881) (-2079.773) [-2074.582] -- 0:01:13
Average standard deviation of split frequencies: 0.004947
743100 -- (-2080.596) [-2081.149] (-2082.029) (-2085.288) * (-2071.895) (-2083.309) [-2078.006] (-2073.002) -- 0:01:13
743200 -- (-2079.341) [-2080.130] (-2079.783) (-2082.186) * [-2068.587] (-2078.944) (-2081.913) (-2080.189) -- 0:01:13
743300 -- (-2077.810) (-2078.669) (-2071.681) [-2070.287] * [-2068.814] (-2076.926) (-2084.426) (-2076.575) -- 0:01:13
743400 -- (-2082.726) (-2081.186) [-2078.318] (-2067.570) * [-2071.644] (-2073.395) (-2081.789) (-2080.178) -- 0:01:13
743500 -- (-2078.737) [-2075.393] (-2079.343) (-2071.176) * [-2076.199] (-2079.479) (-2072.194) (-2088.916) -- 0:01:13
743600 -- [-2079.633] (-2078.928) (-2079.109) (-2071.847) * [-2071.160] (-2080.180) (-2077.363) (-2081.680) -- 0:01:13
743700 -- (-2081.617) (-2081.796) [-2075.096] (-2072.855) * [-2070.317] (-2075.730) (-2083.057) (-2082.612) -- 0:01:13
743800 -- (-2075.747) (-2078.673) [-2072.569] (-2082.003) * (-2075.530) (-2086.835) (-2074.264) [-2076.747] -- 0:01:13
743900 -- (-2078.496) [-2074.770] (-2079.969) (-2078.716) * [-2072.217] (-2087.331) (-2077.368) (-2078.886) -- 0:01:12
744000 -- (-2084.222) (-2078.344) [-2075.096] (-2074.609) * (-2072.161) (-2082.102) [-2072.546] (-2079.157) -- 0:01:12
Average standard deviation of split frequencies: 0.004977
744100 -- [-2079.785] (-2094.722) (-2087.745) (-2068.893) * [-2078.502] (-2085.748) (-2081.491) (-2080.264) -- 0:01:12
744200 -- (-2082.754) (-2090.118) (-2085.449) [-2077.767] * (-2084.503) (-2083.917) (-2075.536) [-2075.429] -- 0:01:13
744300 -- [-2078.049] (-2082.875) (-2082.658) (-2091.213) * (-2080.723) (-2085.444) (-2070.613) [-2078.040] -- 0:01:13
744400 -- (-2080.099) (-2084.030) [-2075.904] (-2085.969) * (-2082.647) (-2079.586) [-2073.860] (-2075.428) -- 0:01:13
744500 -- (-2079.432) (-2089.526) [-2083.963] (-2084.374) * (-2081.956) (-2076.067) [-2068.843] (-2081.964) -- 0:01:13
744600 -- (-2082.404) (-2087.696) (-2081.302) [-2073.927] * [-2081.298] (-2079.825) (-2076.030) (-2088.885) -- 0:01:13
744700 -- (-2077.364) (-2083.411) (-2086.178) [-2072.536] * (-2082.336) [-2076.207] (-2080.118) (-2085.569) -- 0:01:13
744800 -- (-2084.225) (-2086.340) [-2092.102] (-2078.770) * (-2083.392) (-2079.926) (-2081.442) [-2076.410] -- 0:01:12
744900 -- [-2077.475] (-2088.634) (-2090.266) (-2080.053) * (-2082.206) [-2074.634] (-2078.132) (-2081.680) -- 0:01:12
745000 -- (-2074.332) [-2077.083] (-2090.203) (-2081.124) * [-2074.781] (-2081.347) (-2073.516) (-2085.412) -- 0:01:12
Average standard deviation of split frequencies: 0.005025
745100 -- (-2079.064) [-2076.638] (-2087.246) (-2077.868) * (-2081.594) (-2075.730) [-2068.935] (-2085.322) -- 0:01:12
745200 -- (-2082.300) (-2086.196) (-2078.882) [-2079.108] * (-2076.104) (-2082.719) [-2071.528] (-2085.542) -- 0:01:12
745300 -- (-2079.775) (-2081.518) (-2080.288) [-2075.603] * (-2081.416) (-2093.630) [-2077.423] (-2086.933) -- 0:01:12
745400 -- (-2088.592) (-2085.697) (-2079.779) [-2074.205] * (-2081.415) (-2087.390) [-2075.355] (-2082.970) -- 0:01:12
745500 -- (-2084.403) (-2083.041) [-2081.711] (-2079.349) * (-2080.536) (-2085.110) (-2072.183) [-2079.008] -- 0:01:12
745600 -- (-2085.937) (-2079.455) [-2081.025] (-2080.394) * [-2073.596] (-2079.388) (-2078.328) (-2086.367) -- 0:01:12
745700 -- (-2089.722) (-2074.582) (-2088.347) [-2074.035] * (-2075.143) (-2081.294) (-2071.958) [-2076.599] -- 0:01:12
745800 -- (-2084.444) (-2086.570) (-2077.082) [-2075.715] * (-2076.346) (-2082.410) (-2077.344) [-2073.829] -- 0:01:12
745900 -- (-2084.002) (-2083.692) [-2076.192] (-2075.480) * (-2079.525) (-2076.385) [-2076.840] (-2081.599) -- 0:01:12
746000 -- (-2084.124) (-2091.004) [-2083.359] (-2078.692) * (-2076.093) (-2076.129) [-2074.853] (-2080.985) -- 0:01:12
Average standard deviation of split frequencies: 0.005090
746100 -- (-2089.075) [-2080.725] (-2091.124) (-2080.059) * (-2074.375) [-2076.477] (-2075.028) (-2078.622) -- 0:01:12
746200 -- (-2090.407) (-2080.261) (-2084.714) [-2074.123] * (-2076.486) [-2078.147] (-2078.688) (-2079.813) -- 0:01:12
746300 -- (-2091.325) (-2080.505) [-2083.377] (-2078.266) * [-2076.809] (-2085.039) (-2074.491) (-2077.101) -- 0:01:12
746400 -- (-2099.739) [-2079.016] (-2085.211) (-2079.852) * (-2082.688) (-2081.178) [-2074.109] (-2076.727) -- 0:01:12
746500 -- (-2091.220) [-2076.505] (-2086.080) (-2073.641) * (-2089.191) (-2086.897) (-2072.780) [-2077.674] -- 0:01:12
746600 -- (-2083.160) (-2081.105) (-2089.302) [-2079.396] * (-2083.082) (-2092.625) [-2074.140] (-2080.247) -- 0:01:12
746700 -- [-2083.021] (-2087.208) (-2079.283) (-2079.554) * [-2081.414] (-2097.459) (-2075.592) (-2076.027) -- 0:01:12
746800 -- [-2080.689] (-2087.373) (-2086.340) (-2076.211) * (-2092.190) (-2089.682) [-2076.836] (-2075.570) -- 0:01:12
746900 -- [-2081.783] (-2091.093) (-2075.680) (-2080.706) * (-2076.934) (-2088.895) [-2072.388] (-2075.429) -- 0:01:12
747000 -- [-2076.623] (-2084.750) (-2081.890) (-2082.589) * (-2081.245) (-2080.207) (-2075.895) [-2073.261] -- 0:01:12
Average standard deviation of split frequencies: 0.005173
747100 -- [-2082.692] (-2093.113) (-2079.367) (-2082.574) * (-2086.528) (-2076.205) [-2076.314] (-2081.786) -- 0:01:12
747200 -- [-2079.616] (-2085.983) (-2094.484) (-2088.239) * (-2084.770) (-2083.657) [-2074.087] (-2079.115) -- 0:01:12
747300 -- (-2090.348) (-2083.355) (-2086.805) [-2090.055] * (-2081.346) (-2093.690) [-2070.897] (-2076.676) -- 0:01:12
747400 -- (-2090.883) [-2073.938] (-2088.071) (-2081.918) * (-2081.827) (-2093.302) [-2073.286] (-2076.349) -- 0:01:11
747500 -- (-2080.459) [-2073.180] (-2087.413) (-2089.985) * (-2076.019) [-2079.481] (-2075.254) (-2082.932) -- 0:01:12
747600 -- (-2080.697) [-2072.973] (-2104.129) (-2085.166) * (-2076.371) [-2079.426] (-2078.541) (-2081.952) -- 0:01:12
747700 -- (-2085.825) [-2081.500] (-2101.741) (-2087.803) * (-2075.360) [-2077.982] (-2079.635) (-2081.890) -- 0:01:12
747800 -- (-2085.588) (-2081.419) (-2092.123) [-2077.761] * [-2075.191] (-2076.123) (-2072.002) (-2085.083) -- 0:01:12
747900 -- (-2095.778) (-2083.151) (-2084.611) [-2080.034] * (-2083.716) (-2074.081) [-2068.002] (-2091.118) -- 0:01:12
748000 -- (-2086.072) (-2083.709) (-2086.853) [-2073.134] * (-2083.642) (-2082.709) [-2068.428] (-2083.204) -- 0:01:12
Average standard deviation of split frequencies: 0.005095
748100 -- (-2086.484) (-2082.298) (-2081.276) [-2079.517] * [-2083.906] (-2078.116) (-2067.502) (-2091.951) -- 0:01:12
748200 -- (-2081.805) (-2080.252) (-2084.598) [-2079.123] * (-2081.608) (-2076.728) [-2073.011] (-2085.241) -- 0:01:12
748300 -- (-2078.034) [-2082.866] (-2078.548) (-2077.853) * (-2088.304) (-2077.429) [-2075.431] (-2078.495) -- 0:01:11
748400 -- (-2083.009) (-2096.804) (-2082.496) [-2077.617] * (-2089.740) [-2083.692] (-2076.857) (-2079.125) -- 0:01:11
748500 -- (-2083.240) (-2090.310) [-2086.229] (-2081.182) * (-2078.394) (-2081.206) (-2072.664) [-2075.993] -- 0:01:11
748600 -- (-2081.817) (-2082.981) [-2083.639] (-2081.611) * (-2083.901) (-2077.126) [-2077.192] (-2079.690) -- 0:01:11
748700 -- [-2075.779] (-2082.234) (-2086.684) (-2081.333) * [-2082.314] (-2085.820) (-2075.219) (-2088.272) -- 0:01:11
748800 -- (-2084.801) [-2075.638] (-2085.415) (-2085.005) * (-2077.456) (-2081.423) (-2072.176) [-2074.363] -- 0:01:11
748900 -- [-2077.417] (-2083.385) (-2080.907) (-2087.826) * (-2078.849) [-2075.789] (-2080.528) (-2077.338) -- 0:01:11
749000 -- [-2080.272] (-2076.936) (-2081.289) (-2078.722) * (-2079.146) (-2076.639) [-2077.393] (-2080.675) -- 0:01:11
Average standard deviation of split frequencies: 0.005213
749100 -- (-2075.716) (-2082.711) (-2086.100) [-2076.998] * (-2080.218) [-2083.171] (-2078.613) (-2074.597) -- 0:01:11
749200 -- (-2076.508) (-2100.650) (-2080.158) [-2075.660] * (-2098.919) [-2075.608] (-2078.394) (-2080.409) -- 0:01:11
749300 -- (-2074.070) (-2088.968) (-2081.978) [-2075.899] * (-2096.399) [-2072.474] (-2089.430) (-2078.494) -- 0:01:11
749400 -- (-2083.213) (-2085.732) (-2078.091) [-2075.898] * (-2084.204) (-2077.180) [-2075.132] (-2076.335) -- 0:01:11
749500 -- (-2082.056) (-2084.875) (-2082.746) [-2073.440] * (-2085.029) (-2081.623) [-2070.892] (-2075.456) -- 0:01:11
749600 -- [-2077.904] (-2078.879) (-2076.969) (-2076.323) * (-2079.153) (-2077.436) [-2072.379] (-2075.900) -- 0:01:11
749700 -- [-2071.509] (-2084.933) (-2076.667) (-2074.886) * (-2080.384) (-2076.338) [-2069.425] (-2083.959) -- 0:01:11
749800 -- (-2074.075) (-2080.107) (-2085.241) [-2074.561] * (-2083.555) [-2075.349] (-2072.201) (-2081.537) -- 0:01:11
749900 -- (-2074.791) (-2079.019) (-2091.901) [-2074.919] * (-2088.316) [-2074.296] (-2068.903) (-2077.739) -- 0:01:11
750000 -- [-2073.711] (-2077.710) (-2087.722) (-2076.306) * (-2078.487) (-2086.424) [-2074.202] (-2076.574) -- 0:01:11
Average standard deviation of split frequencies: 0.004938
750100 -- (-2083.409) [-2074.885] (-2083.783) (-2073.775) * (-2084.300) [-2078.885] (-2073.250) (-2078.124) -- 0:01:11
750200 -- (-2078.585) (-2074.090) (-2084.187) [-2082.434] * [-2077.819] (-2078.154) (-2073.991) (-2078.784) -- 0:01:11
750300 -- (-2079.024) [-2075.642] (-2085.312) (-2082.078) * (-2075.222) (-2085.279) [-2069.812] (-2081.463) -- 0:01:11
750400 -- (-2080.659) [-2077.591] (-2085.435) (-2083.880) * (-2072.435) (-2079.850) [-2070.359] (-2085.224) -- 0:01:11
750500 -- [-2080.106] (-2087.631) (-2084.235) (-2087.752) * [-2075.182] (-2081.937) (-2068.825) (-2077.027) -- 0:01:11
750600 -- [-2074.729] (-2092.578) (-2082.632) (-2087.442) * (-2076.532) (-2081.282) (-2071.156) [-2076.959] -- 0:01:11
750700 -- [-2075.465] (-2089.660) (-2080.580) (-2084.094) * (-2084.826) (-2083.774) [-2070.846] (-2090.855) -- 0:01:11
750800 -- (-2076.335) (-2083.503) (-2085.431) [-2079.231] * (-2087.485) [-2076.483] (-2078.820) (-2084.880) -- 0:01:11
750900 -- [-2073.381] (-2079.938) (-2081.624) (-2088.196) * (-2085.603) (-2079.739) [-2076.368] (-2082.556) -- 0:01:10
751000 -- [-2074.230] (-2086.179) (-2080.363) (-2086.464) * [-2081.411] (-2081.867) (-2078.757) (-2083.175) -- 0:01:11
Average standard deviation of split frequencies: 0.004931
751100 -- (-2077.783) (-2088.793) (-2081.179) [-2080.057] * [-2078.842] (-2088.734) (-2078.787) (-2081.133) -- 0:01:11
751200 -- (-2079.963) [-2084.421] (-2080.083) (-2079.239) * (-2087.667) (-2079.829) [-2074.547] (-2089.498) -- 0:01:11
751300 -- [-2073.380] (-2089.519) (-2082.231) (-2081.841) * (-2077.962) (-2078.180) [-2071.606] (-2080.841) -- 0:01:11
751400 -- [-2073.602] (-2080.019) (-2079.388) (-2091.398) * (-2080.262) [-2072.859] (-2070.952) (-2080.108) -- 0:01:11
751500 -- (-2083.734) (-2083.173) [-2076.930] (-2085.249) * (-2088.501) [-2077.802] (-2076.310) (-2084.029) -- 0:01:11
751600 -- (-2084.407) [-2081.403] (-2077.323) (-2086.347) * (-2084.648) (-2078.439) [-2072.273] (-2077.301) -- 0:01:11
751700 -- (-2096.003) [-2080.244] (-2075.116) (-2086.778) * (-2086.964) (-2079.087) [-2071.071] (-2082.229) -- 0:01:11
751800 -- (-2101.609) [-2080.922] (-2081.650) (-2085.346) * (-2084.981) (-2084.291) [-2069.329] (-2086.374) -- 0:01:10
751900 -- (-2094.014) (-2078.248) [-2078.513] (-2094.230) * (-2084.627) (-2083.070) (-2070.932) [-2081.384] -- 0:01:10
752000 -- (-2086.192) [-2076.176] (-2079.463) (-2092.872) * (-2087.765) (-2077.867) [-2075.847] (-2083.816) -- 0:01:10
Average standard deviation of split frequencies: 0.004996
752100 -- (-2080.308) [-2080.843] (-2077.038) (-2094.629) * (-2094.818) [-2073.074] (-2073.949) (-2085.366) -- 0:01:10
752200 -- (-2075.308) (-2075.699) [-2078.367] (-2081.021) * (-2086.216) (-2084.017) (-2074.208) [-2080.954] -- 0:01:10
752300 -- (-2080.022) (-2075.242) (-2074.955) [-2077.299] * (-2089.069) (-2085.122) [-2075.492] (-2079.183) -- 0:01:10
752400 -- (-2080.293) (-2077.060) [-2077.014] (-2077.052) * (-2094.656) (-2082.147) (-2078.160) [-2076.121] -- 0:01:10
752500 -- (-2076.328) (-2073.368) (-2081.592) [-2074.736] * (-2087.059) (-2084.225) [-2071.744] (-2081.197) -- 0:01:10
752600 -- (-2076.922) (-2077.783) (-2080.001) [-2075.769] * (-2089.291) (-2080.997) [-2069.934] (-2083.597) -- 0:01:10
752700 -- [-2077.804] (-2076.187) (-2078.453) (-2078.396) * [-2083.452] (-2077.580) (-2074.412) (-2083.974) -- 0:01:10
752800 -- (-2074.922) [-2073.125] (-2083.329) (-2078.302) * (-2077.884) (-2082.620) [-2075.854] (-2083.700) -- 0:01:10
752900 -- [-2080.007] (-2082.510) (-2076.405) (-2079.074) * (-2086.107) (-2081.685) (-2076.851) [-2076.225] -- 0:01:10
753000 -- [-2077.301] (-2073.973) (-2078.844) (-2084.674) * (-2077.854) (-2078.351) [-2075.127] (-2079.639) -- 0:01:10
Average standard deviation of split frequencies: 0.004774
753100 -- [-2081.804] (-2078.247) (-2076.780) (-2086.658) * (-2079.834) (-2092.298) [-2071.091] (-2083.276) -- 0:01:10
753200 -- (-2085.681) [-2078.602] (-2074.833) (-2076.132) * (-2080.032) (-2085.824) [-2070.656] (-2083.805) -- 0:01:10
753300 -- (-2080.197) (-2083.411) (-2074.750) [-2077.947] * (-2076.160) (-2086.756) [-2069.484] (-2084.145) -- 0:01:10
753400 -- (-2083.812) (-2083.554) [-2077.799] (-2083.297) * [-2072.845] (-2087.218) (-2079.299) (-2085.410) -- 0:01:10
753500 -- [-2073.603] (-2094.454) (-2077.654) (-2081.037) * (-2076.107) (-2098.891) [-2070.243] (-2081.174) -- 0:01:10
753600 -- [-2078.085] (-2088.995) (-2080.191) (-2077.415) * (-2076.478) (-2083.264) [-2071.976] (-2083.653) -- 0:01:10
753700 -- (-2081.037) (-2086.492) (-2091.003) [-2078.705] * (-2074.472) (-2085.357) (-2077.193) [-2076.025] -- 0:01:10
753800 -- (-2079.827) [-2080.482] (-2086.875) (-2084.723) * (-2073.466) (-2085.237) (-2074.033) [-2079.692] -- 0:01:10
753900 -- [-2074.936] (-2081.638) (-2074.702) (-2090.447) * [-2073.347] (-2084.718) (-2072.958) (-2081.906) -- 0:01:10
754000 -- [-2075.556] (-2082.050) (-2076.004) (-2086.915) * (-2079.626) (-2090.773) (-2076.196) [-2077.601] -- 0:01:10
Average standard deviation of split frequencies: 0.004447
754100 -- (-2080.477) (-2082.945) [-2081.746] (-2088.166) * (-2076.824) (-2091.250) [-2074.087] (-2078.901) -- 0:01:10
754200 -- [-2075.165] (-2084.264) (-2077.945) (-2092.367) * [-2072.738] (-2077.707) (-2080.472) (-2075.186) -- 0:01:10
754300 -- (-2080.934) (-2078.935) [-2077.787] (-2095.869) * (-2073.553) (-2078.167) (-2081.247) [-2077.384] -- 0:01:10
754400 -- (-2083.595) (-2076.363) [-2077.100] (-2085.192) * [-2072.223] (-2085.478) (-2073.581) (-2074.348) -- 0:01:10
754500 -- (-2083.258) [-2077.074] (-2077.937) (-2085.400) * [-2069.176] (-2076.510) (-2070.527) (-2079.488) -- 0:01:10
754600 -- (-2080.135) [-2078.786] (-2077.887) (-2086.190) * [-2074.240] (-2093.098) (-2069.874) (-2076.934) -- 0:01:10
754700 -- [-2074.336] (-2078.499) (-2084.366) (-2083.987) * (-2075.490) (-2092.602) [-2070.574] (-2078.513) -- 0:01:10
754800 -- [-2072.100] (-2080.355) (-2080.539) (-2088.369) * [-2077.645] (-2088.693) (-2075.215) (-2085.082) -- 0:01:10
754900 -- [-2075.452] (-2076.180) (-2084.947) (-2093.485) * (-2071.428) (-2081.289) (-2071.710) [-2081.712] -- 0:01:10
755000 -- [-2076.407] (-2078.790) (-2078.551) (-2087.704) * (-2080.731) (-2080.600) [-2070.954] (-2090.516) -- 0:01:10
Average standard deviation of split frequencies: 0.004548
755100 -- [-2074.972] (-2078.468) (-2079.809) (-2086.646) * (-2080.589) (-2081.123) [-2073.592] (-2085.323) -- 0:01:10
755200 -- (-2080.334) (-2075.168) [-2079.258] (-2081.928) * (-2076.283) [-2075.146] (-2072.130) (-2080.208) -- 0:01:10
755300 -- (-2074.747) (-2074.818) [-2075.332] (-2084.471) * [-2077.842] (-2073.904) (-2079.949) (-2088.566) -- 0:01:09
755400 -- (-2074.222) (-2085.598) [-2075.375] (-2080.877) * (-2079.479) [-2077.239] (-2078.500) (-2082.639) -- 0:01:09
755500 -- [-2073.489] (-2082.214) (-2079.562) (-2080.162) * (-2082.441) (-2074.865) [-2071.171] (-2090.346) -- 0:01:09
755600 -- (-2081.851) (-2079.578) [-2075.219] (-2080.207) * (-2078.847) (-2085.778) [-2072.428] (-2082.089) -- 0:01:09
755700 -- (-2088.442) (-2077.298) (-2076.264) [-2072.463] * [-2072.078] (-2079.875) (-2077.088) (-2077.643) -- 0:01:09
755800 -- (-2090.867) [-2077.052] (-2076.475) (-2076.017) * (-2079.316) (-2089.830) [-2078.248] (-2074.738) -- 0:01:09
755900 -- (-2090.788) (-2077.172) [-2077.550] (-2077.972) * (-2077.120) (-2087.391) (-2075.782) [-2077.955] -- 0:01:09
756000 -- (-2092.496) (-2077.641) [-2072.938] (-2082.834) * [-2075.807] (-2087.606) (-2074.435) (-2072.144) -- 0:01:09
Average standard deviation of split frequencies: 0.004204
756100 -- (-2091.552) (-2081.934) [-2070.827] (-2086.955) * (-2076.296) [-2077.457] (-2084.481) (-2077.162) -- 0:01:09
756200 -- (-2086.842) (-2079.331) [-2074.414] (-2077.147) * [-2073.597] (-2075.843) (-2082.788) (-2072.971) -- 0:01:09
756300 -- (-2079.738) (-2088.044) (-2076.453) [-2071.053] * [-2070.925] (-2086.082) (-2080.952) (-2085.246) -- 0:01:09
756400 -- (-2078.815) [-2077.874] (-2073.976) (-2072.890) * [-2068.890] (-2081.060) (-2077.315) (-2079.022) -- 0:01:09
756500 -- (-2089.314) (-2082.905) (-2078.249) [-2077.383] * [-2070.053] (-2082.934) (-2078.446) (-2076.559) -- 0:01:09
756600 -- (-2089.164) (-2076.928) (-2079.889) [-2074.596] * [-2067.016] (-2081.476) (-2080.989) (-2078.829) -- 0:01:09
756700 -- (-2085.879) [-2076.570] (-2071.433) (-2082.068) * [-2070.309] (-2079.239) (-2083.475) (-2080.193) -- 0:01:09
756800 -- (-2078.896) (-2081.967) [-2073.481] (-2081.852) * (-2076.007) [-2078.157] (-2089.575) (-2098.646) -- 0:01:09
756900 -- (-2092.448) [-2077.328] (-2074.092) (-2078.260) * [-2071.642] (-2079.459) (-2083.467) (-2090.514) -- 0:01:09
757000 -- (-2082.816) (-2077.602) [-2075.614] (-2075.654) * [-2074.882] (-2076.740) (-2077.934) (-2085.701) -- 0:01:09
Average standard deviation of split frequencies: 0.003984
757100 -- (-2088.052) [-2079.783] (-2088.188) (-2078.951) * [-2073.922] (-2076.256) (-2075.405) (-2097.204) -- 0:01:09
757200 -- (-2083.640) (-2078.246) (-2082.221) [-2073.974] * [-2075.982] (-2077.118) (-2072.976) (-2085.448) -- 0:01:09
757300 -- [-2076.866] (-2078.694) (-2080.956) (-2081.397) * [-2078.987] (-2076.997) (-2075.930) (-2079.163) -- 0:01:09
757400 -- (-2073.664) [-2083.355] (-2085.720) (-2084.404) * [-2076.432] (-2076.668) (-2073.295) (-2078.231) -- 0:01:09
757500 -- [-2068.654] (-2092.020) (-2082.672) (-2085.068) * [-2075.060] (-2083.735) (-2072.062) (-2083.578) -- 0:01:09
757600 -- [-2074.398] (-2091.305) (-2080.959) (-2080.037) * [-2074.380] (-2077.546) (-2076.115) (-2086.138) -- 0:01:09
757700 -- [-2071.410] (-2087.769) (-2081.175) (-2078.656) * (-2082.603) (-2078.313) [-2071.094] (-2082.312) -- 0:01:09
757800 -- [-2076.235] (-2080.611) (-2077.675) (-2080.926) * (-2090.609) (-2078.121) [-2072.937] (-2090.905) -- 0:01:09
757900 -- (-2071.806) [-2071.903] (-2083.139) (-2091.028) * (-2086.498) (-2079.596) [-2073.346] (-2081.133) -- 0:01:09
758000 -- (-2085.555) [-2079.208] (-2074.545) (-2088.079) * (-2077.562) [-2078.226] (-2075.198) (-2085.146) -- 0:01:09
Average standard deviation of split frequencies: 0.004104
758100 -- (-2082.814) (-2077.628) (-2083.768) [-2083.532] * (-2079.596) (-2075.687) [-2073.341] (-2084.124) -- 0:01:09
758200 -- (-2078.620) (-2079.950) [-2084.282] (-2092.187) * (-2078.358) [-2077.769] (-2076.408) (-2091.191) -- 0:01:09
758300 -- (-2081.906) (-2080.691) (-2080.861) [-2079.112] * (-2070.568) (-2084.357) [-2075.836] (-2101.873) -- 0:01:09
758400 -- (-2080.620) [-2076.897] (-2075.011) (-2078.103) * [-2074.624] (-2083.195) (-2074.694) (-2081.877) -- 0:01:09
758500 -- (-2078.708) (-2076.442) [-2074.462] (-2074.931) * (-2075.607) (-2085.526) [-2078.393] (-2090.060) -- 0:01:09
758600 -- (-2083.622) (-2081.207) [-2071.729] (-2080.035) * [-2071.766] (-2079.974) (-2074.102) (-2084.291) -- 0:01:09
758700 -- (-2089.512) (-2085.671) [-2077.452] (-2075.598) * [-2072.791] (-2075.768) (-2081.629) (-2082.494) -- 0:01:09
758800 -- [-2083.077] (-2074.443) (-2084.300) (-2080.297) * [-2076.107] (-2078.863) (-2083.647) (-2084.773) -- 0:01:08
758900 -- (-2083.400) [-2078.480] (-2076.002) (-2090.810) * (-2080.617) (-2081.389) [-2085.117] (-2082.512) -- 0:01:08
759000 -- [-2080.101] (-2080.367) (-2077.469) (-2083.866) * (-2075.489) [-2081.677] (-2079.147) (-2087.127) -- 0:01:08
Average standard deviation of split frequencies: 0.003956
759100 -- [-2076.314] (-2077.074) (-2075.637) (-2080.867) * [-2073.362] (-2083.330) (-2089.348) (-2075.454) -- 0:01:08
759200 -- (-2075.183) [-2073.461] (-2076.476) (-2079.990) * [-2072.218] (-2081.335) (-2082.090) (-2084.601) -- 0:01:08
759300 -- (-2076.007) [-2070.851] (-2082.003) (-2082.517) * [-2073.483] (-2078.037) (-2087.893) (-2080.820) -- 0:01:08
759400 -- (-2079.760) (-2071.913) (-2090.446) [-2077.102] * (-2076.201) (-2078.983) [-2078.560] (-2077.058) -- 0:01:08
759500 -- (-2074.688) (-2075.484) (-2087.137) [-2076.794] * (-2074.578) (-2078.500) [-2078.017] (-2083.067) -- 0:01:08
759600 -- [-2078.535] (-2080.048) (-2084.035) (-2090.653) * (-2083.438) (-2080.962) [-2082.352] (-2081.507) -- 0:01:08
759700 -- (-2074.039) [-2072.500] (-2083.925) (-2091.118) * [-2079.949] (-2082.089) (-2081.129) (-2080.279) -- 0:01:08
759800 -- [-2071.574] (-2075.276) (-2075.572) (-2086.653) * (-2080.194) [-2081.456] (-2091.307) (-2087.027) -- 0:01:08
759900 -- (-2074.011) [-2070.809] (-2086.318) (-2085.925) * (-2075.982) [-2075.128] (-2084.876) (-2087.837) -- 0:01:08
760000 -- [-2072.714] (-2078.015) (-2084.431) (-2079.973) * (-2090.866) [-2074.316] (-2086.610) (-2093.164) -- 0:01:08
Average standard deviation of split frequencies: 0.004199
760100 -- (-2072.991) [-2070.843] (-2080.761) (-2081.531) * [-2078.025] (-2079.866) (-2087.867) (-2082.331) -- 0:01:08
760200 -- (-2069.333) [-2072.527] (-2080.548) (-2080.269) * [-2072.236] (-2086.158) (-2082.460) (-2082.445) -- 0:01:08
760300 -- [-2068.735] (-2074.754) (-2077.276) (-2082.636) * [-2073.083] (-2085.357) (-2076.541) (-2088.536) -- 0:01:08
760400 -- [-2070.818] (-2075.341) (-2081.883) (-2079.806) * (-2073.262) [-2085.296] (-2079.292) (-2080.945) -- 0:01:08
760500 -- (-2068.060) (-2072.585) [-2079.068] (-2084.557) * (-2074.472) (-2074.133) [-2076.562] (-2082.045) -- 0:01:08
760600 -- [-2068.582] (-2084.715) (-2092.493) (-2091.237) * (-2072.220) (-2089.861) [-2074.129] (-2082.831) -- 0:01:08
760700 -- [-2066.845] (-2086.814) (-2079.584) (-2094.166) * (-2079.178) (-2085.443) (-2074.945) [-2079.701] -- 0:01:08
760800 -- [-2071.872] (-2081.566) (-2088.637) (-2089.587) * (-2080.198) (-2084.821) [-2080.000] (-2087.108) -- 0:01:08
760900 -- [-2069.901] (-2089.659) (-2086.257) (-2088.053) * (-2076.552) (-2079.732) [-2074.755] (-2088.528) -- 0:01:08
761000 -- [-2071.472] (-2078.069) (-2082.796) (-2080.701) * (-2077.782) (-2081.291) [-2076.891] (-2077.480) -- 0:01:08
Average standard deviation of split frequencies: 0.004264
761100 -- [-2072.785] (-2081.383) (-2084.583) (-2084.921) * [-2072.090] (-2089.588) (-2074.612) (-2085.996) -- 0:01:08
761200 -- (-2080.535) [-2074.226] (-2082.789) (-2090.008) * (-2074.733) (-2085.381) [-2076.041] (-2080.930) -- 0:01:08
761300 -- (-2076.177) (-2082.770) [-2078.149] (-2083.158) * [-2074.217] (-2078.351) (-2082.129) (-2071.794) -- 0:01:08
761400 -- (-2079.940) (-2075.141) (-2075.794) [-2074.807] * [-2073.261] (-2083.362) (-2078.928) (-2072.855) -- 0:01:08
761500 -- (-2072.010) [-2071.315] (-2072.801) (-2086.671) * (-2073.561) (-2085.067) [-2089.703] (-2079.456) -- 0:01:08
761600 -- [-2066.607] (-2086.689) (-2074.727) (-2078.470) * (-2071.689) [-2073.621] (-2083.728) (-2075.182) -- 0:01:08
761700 -- [-2069.171] (-2085.967) (-2080.568) (-2086.779) * (-2071.584) (-2077.534) (-2078.835) [-2079.692] -- 0:01:08
761800 -- [-2073.974] (-2087.174) (-2087.726) (-2084.001) * (-2080.032) (-2084.895) [-2080.839] (-2081.133) -- 0:01:08
761900 -- [-2073.434] (-2074.158) (-2083.328) (-2083.572) * (-2080.975) [-2078.078] (-2081.490) (-2077.669) -- 0:01:08
762000 -- (-2071.210) [-2070.678] (-2081.992) (-2080.663) * (-2081.565) (-2072.606) (-2091.180) [-2074.944] -- 0:01:08
Average standard deviation of split frequencies: 0.004259
762100 -- (-2076.043) [-2072.853] (-2078.254) (-2085.646) * (-2075.163) (-2083.434) (-2082.713) [-2074.060] -- 0:01:08
762200 -- (-2075.527) [-2070.859] (-2076.707) (-2082.898) * [-2072.134] (-2086.406) (-2084.055) (-2077.007) -- 0:01:08
762300 -- (-2074.080) [-2070.283] (-2077.442) (-2082.105) * [-2077.356] (-2084.392) (-2086.468) (-2078.892) -- 0:01:07
762400 -- [-2075.431] (-2073.147) (-2081.222) (-2081.078) * (-2081.599) (-2085.176) (-2077.236) [-2078.268] -- 0:01:07
762500 -- (-2073.447) [-2067.341] (-2077.341) (-2080.846) * (-2070.474) (-2076.855) (-2082.197) [-2077.681] -- 0:01:07
762600 -- (-2075.823) [-2076.868] (-2076.664) (-2080.622) * [-2075.128] (-2075.843) (-2084.673) (-2079.408) -- 0:01:07
762700 -- (-2082.037) [-2072.810] (-2079.120) (-2086.269) * [-2075.698] (-2086.182) (-2084.457) (-2076.435) -- 0:01:07
762800 -- (-2080.936) (-2074.817) [-2079.455] (-2082.619) * [-2070.764] (-2081.441) (-2078.827) (-2080.617) -- 0:01:07
762900 -- (-2078.079) [-2075.541] (-2080.533) (-2084.938) * [-2071.732] (-2079.981) (-2078.585) (-2077.161) -- 0:01:07
763000 -- (-2073.349) [-2078.066] (-2083.372) (-2082.086) * [-2073.263] (-2077.333) (-2073.110) (-2083.535) -- 0:01:07
Average standard deviation of split frequencies: 0.004377
763100 -- [-2071.417] (-2077.880) (-2078.155) (-2081.200) * [-2069.921] (-2074.973) (-2089.692) (-2080.252) -- 0:01:07
763200 -- [-2068.551] (-2071.604) (-2088.363) (-2079.149) * (-2069.918) (-2074.446) (-2084.201) [-2080.802] -- 0:01:07
763300 -- (-2076.297) [-2075.679] (-2083.080) (-2079.864) * (-2074.770) (-2073.131) (-2080.757) [-2077.667] -- 0:01:07
763400 -- (-2072.662) [-2074.799] (-2082.781) (-2079.917) * (-2077.840) [-2073.941] (-2077.978) (-2074.514) -- 0:01:07
763500 -- (-2068.396) [-2071.012] (-2081.297) (-2080.478) * (-2074.688) [-2072.609] (-2083.206) (-2090.352) -- 0:01:07
763600 -- [-2068.983] (-2073.166) (-2090.316) (-2084.276) * (-2073.675) [-2068.021] (-2086.499) (-2082.495) -- 0:01:07
763700 -- (-2070.861) (-2074.096) (-2082.489) [-2081.918] * (-2081.091) [-2071.825] (-2089.433) (-2084.016) -- 0:01:07
763800 -- (-2079.381) [-2069.711] (-2077.695) (-2078.446) * (-2074.608) (-2075.342) [-2080.425] (-2078.674) -- 0:01:07
763900 -- (-2079.820) (-2068.277) (-2078.441) [-2078.262] * (-2077.968) [-2075.986] (-2084.996) (-2075.700) -- 0:01:07
764000 -- (-2078.321) [-2068.979] (-2082.354) (-2080.694) * (-2077.320) [-2074.772] (-2074.963) (-2076.715) -- 0:01:07
Average standard deviation of split frequencies: 0.004600
764100 -- (-2075.406) [-2069.255] (-2090.307) (-2090.685) * [-2072.565] (-2073.367) (-2095.423) (-2081.284) -- 0:01:07
764200 -- (-2077.703) [-2067.383] (-2084.281) (-2084.655) * (-2081.550) [-2074.648] (-2090.034) (-2077.340) -- 0:01:07
764300 -- [-2076.795] (-2073.536) (-2083.203) (-2077.818) * (-2081.834) (-2071.656) (-2082.876) [-2076.686] -- 0:01:07
764400 -- (-2080.362) [-2080.268] (-2076.981) (-2077.667) * (-2088.946) [-2069.841] (-2079.127) (-2078.672) -- 0:01:07
764500 -- (-2082.201) [-2072.346] (-2084.376) (-2074.516) * (-2079.577) [-2078.584] (-2084.810) (-2080.802) -- 0:01:07
764600 -- (-2079.634) (-2075.145) [-2079.621] (-2079.238) * (-2075.947) [-2071.906] (-2080.002) (-2077.543) -- 0:01:07
764700 -- (-2086.492) [-2080.399] (-2082.303) (-2076.051) * (-2088.569) [-2070.113] (-2083.850) (-2080.099) -- 0:01:07
764800 -- (-2088.434) (-2086.404) (-2085.260) [-2074.881] * (-2074.662) [-2074.942] (-2081.090) (-2085.434) -- 0:01:07
764900 -- (-2081.940) (-2077.238) (-2088.660) [-2077.725] * (-2079.613) [-2076.205] (-2084.214) (-2085.257) -- 0:01:07
765000 -- (-2081.464) [-2073.674] (-2084.828) (-2086.038) * (-2082.712) [-2075.478] (-2084.626) (-2083.127) -- 0:01:07
Average standard deviation of split frequencies: 0.004541
765100 -- (-2086.426) [-2076.482] (-2081.656) (-2088.585) * (-2082.325) [-2070.402] (-2083.106) (-2083.218) -- 0:01:07
765200 -- (-2077.249) [-2069.057] (-2088.980) (-2086.667) * (-2081.722) [-2072.139] (-2085.098) (-2079.222) -- 0:01:07
765300 -- (-2079.586) (-2071.530) [-2078.751] (-2083.300) * [-2066.589] (-2074.275) (-2082.033) (-2080.511) -- 0:01:07
765400 -- [-2072.200] (-2069.450) (-2081.109) (-2082.063) * [-2068.962] (-2076.429) (-2079.536) (-2080.715) -- 0:01:07
765500 -- (-2071.851) [-2068.290] (-2079.409) (-2083.484) * [-2067.016] (-2082.434) (-2083.713) (-2080.700) -- 0:01:07
765600 -- [-2073.476] (-2069.024) (-2079.118) (-2083.488) * [-2071.503] (-2079.668) (-2091.070) (-2082.443) -- 0:01:07
765700 -- (-2071.989) [-2070.197] (-2077.209) (-2088.039) * (-2077.011) (-2079.032) (-2085.306) [-2078.714] -- 0:01:07
765800 -- (-2076.955) [-2071.744] (-2079.734) (-2081.751) * [-2077.659] (-2079.309) (-2079.360) (-2075.937) -- 0:01:06
765900 -- (-2077.981) (-2069.767) [-2072.267] (-2080.268) * [-2072.900] (-2077.092) (-2084.619) (-2077.485) -- 0:01:06
766000 -- (-2075.518) [-2068.943] (-2079.238) (-2082.091) * (-2070.128) (-2077.309) (-2092.900) [-2077.873] -- 0:01:06
Average standard deviation of split frequencies: 0.004553
766100 -- [-2074.532] (-2069.098) (-2074.701) (-2079.903) * (-2076.498) (-2081.062) (-2085.626) [-2076.224] -- 0:01:06
766200 -- (-2078.606) (-2072.731) [-2074.692] (-2085.629) * (-2071.979) (-2080.504) [-2076.765] (-2083.185) -- 0:01:06
766300 -- (-2079.479) (-2072.253) (-2075.617) [-2078.738] * [-2069.349] (-2080.340) (-2074.710) (-2078.621) -- 0:01:06
766400 -- (-2076.302) [-2072.601] (-2077.698) (-2074.298) * [-2067.270] (-2076.045) (-2077.882) (-2083.296) -- 0:01:06
766500 -- (-2077.448) [-2071.238] (-2080.244) (-2079.199) * (-2074.324) [-2077.344] (-2079.370) (-2075.226) -- 0:01:06
766600 -- (-2080.540) [-2072.202] (-2079.298) (-2076.104) * [-2072.922] (-2082.633) (-2079.240) (-2077.946) -- 0:01:06
766700 -- [-2079.665] (-2072.275) (-2081.948) (-2077.523) * (-2077.568) (-2082.198) [-2074.385] (-2077.429) -- 0:01:06
766800 -- [-2074.445] (-2071.766) (-2087.759) (-2081.540) * (-2073.971) (-2075.032) (-2081.448) [-2079.824] -- 0:01:06
766900 -- (-2080.968) (-2082.309) [-2081.055] (-2077.414) * (-2075.082) [-2072.632] (-2085.455) (-2084.347) -- 0:01:06
767000 -- (-2084.496) [-2071.580] (-2088.271) (-2075.204) * [-2072.910] (-2073.233) (-2088.334) (-2079.478) -- 0:01:06
Average standard deviation of split frequencies: 0.004301
767100 -- [-2077.613] (-2070.290) (-2086.533) (-2074.292) * (-2079.132) [-2076.529] (-2084.949) (-2082.364) -- 0:01:06
767200 -- [-2073.736] (-2074.332) (-2083.555) (-2077.471) * (-2075.295) (-2079.397) (-2079.364) [-2082.097] -- 0:01:06
767300 -- (-2084.173) [-2078.028] (-2088.218) (-2075.087) * (-2074.685) [-2074.635] (-2084.632) (-2085.237) -- 0:01:06
767400 -- (-2088.247) [-2070.464] (-2092.832) (-2074.267) * [-2073.196] (-2079.990) (-2080.366) (-2088.511) -- 0:01:06
767500 -- (-2075.721) (-2074.871) (-2087.548) [-2075.466] * (-2078.875) (-2079.053) [-2072.505] (-2075.226) -- 0:01:06
767600 -- (-2079.335) [-2073.811] (-2084.501) (-2075.319) * (-2078.037) (-2069.388) [-2074.830] (-2079.166) -- 0:01:06
767700 -- (-2093.054) (-2072.535) (-2083.684) [-2079.345] * (-2069.367) (-2070.755) [-2074.219] (-2093.621) -- 0:01:06
767800 -- (-2081.831) [-2070.881] (-2077.983) (-2077.806) * [-2073.470] (-2077.188) (-2088.625) (-2088.976) -- 0:01:06
767900 -- (-2078.992) [-2073.949] (-2074.833) (-2079.336) * [-2080.381] (-2073.602) (-2075.458) (-2093.007) -- 0:01:06
768000 -- (-2079.143) [-2072.194] (-2083.696) (-2079.142) * (-2076.326) [-2068.273] (-2073.478) (-2096.778) -- 0:01:06
Average standard deviation of split frequencies: 0.004191
768100 -- (-2087.896) [-2071.343] (-2086.294) (-2075.162) * (-2074.290) (-2072.347) [-2070.878] (-2084.796) -- 0:01:06
768200 -- (-2077.714) [-2073.868] (-2083.708) (-2075.035) * (-2074.441) (-2075.060) [-2075.518] (-2089.956) -- 0:01:06
768300 -- (-2082.643) (-2085.741) (-2080.844) [-2075.203] * [-2075.375] (-2078.737) (-2072.569) (-2083.606) -- 0:01:06
768400 -- (-2091.588) (-2080.446) (-2078.123) [-2080.204] * (-2077.963) [-2075.776] (-2085.286) (-2081.217) -- 0:01:06
768500 -- (-2089.285) (-2071.271) [-2080.037] (-2076.113) * (-2070.885) (-2071.037) [-2070.455] (-2082.497) -- 0:01:06
768600 -- (-2090.342) [-2074.955] (-2080.520) (-2080.638) * (-2075.374) [-2074.563] (-2074.143) (-2081.908) -- 0:01:06
768700 -- (-2080.160) [-2073.708] (-2082.933) (-2080.201) * (-2074.660) (-2072.200) [-2074.471] (-2088.024) -- 0:01:06
768800 -- [-2074.171] (-2071.857) (-2089.911) (-2076.301) * [-2070.717] (-2071.135) (-2080.142) (-2081.306) -- 0:01:06
768900 -- (-2074.553) [-2070.477] (-2099.646) (-2077.545) * [-2066.910] (-2075.120) (-2078.286) (-2081.156) -- 0:01:06
769000 -- (-2075.916) (-2074.688) (-2088.804) [-2078.013] * (-2074.828) (-2078.137) [-2074.022] (-2088.022) -- 0:01:06
Average standard deviation of split frequencies: 0.004045
769100 -- [-2078.268] (-2081.716) (-2088.429) (-2076.379) * (-2082.722) (-2084.715) [-2074.220] (-2075.457) -- 0:01:06
769200 -- (-2078.240) [-2078.565] (-2090.958) (-2079.880) * [-2070.304] (-2092.370) (-2077.354) (-2080.724) -- 0:01:06
769300 -- [-2070.565] (-2075.536) (-2084.848) (-2080.179) * (-2075.308) (-2080.947) (-2078.898) [-2077.102] -- 0:01:05
769400 -- (-2076.728) [-2079.026] (-2087.251) (-2079.429) * (-2073.588) [-2074.270] (-2080.811) (-2076.156) -- 0:01:05
769500 -- (-2081.690) [-2075.194] (-2084.290) (-2084.456) * (-2074.142) (-2076.748) (-2087.805) [-2076.230] -- 0:01:05
769600 -- (-2084.701) [-2071.754] (-2082.296) (-2076.443) * (-2074.178) (-2075.319) (-2089.851) [-2074.892] -- 0:01:05
769700 -- (-2080.264) (-2068.218) [-2076.916] (-2080.289) * [-2074.168] (-2083.174) (-2077.392) (-2075.447) -- 0:01:05
769800 -- (-2093.223) (-2068.008) (-2081.606) [-2072.322] * (-2073.718) (-2085.096) [-2075.698] (-2074.731) -- 0:01:05
769900 -- (-2084.219) [-2068.057] (-2080.222) (-2083.366) * (-2076.043) (-2076.609) [-2068.535] (-2080.788) -- 0:01:05
770000 -- (-2081.888) [-2072.748] (-2086.104) (-2079.493) * [-2072.814] (-2080.317) (-2079.455) (-2088.315) -- 0:01:05
Average standard deviation of split frequencies: 0.004040
770100 -- (-2083.347) [-2068.540] (-2085.909) (-2086.533) * (-2077.070) (-2080.546) [-2069.558] (-2079.746) -- 0:01:05
770200 -- [-2072.527] (-2073.124) (-2084.764) (-2090.876) * (-2080.482) [-2072.667] (-2069.938) (-2077.516) -- 0:01:05
770300 -- (-2078.957) (-2081.817) [-2078.360] (-2078.349) * (-2082.185) (-2078.674) [-2072.809] (-2080.743) -- 0:01:05
770400 -- (-2077.419) [-2076.619] (-2083.837) (-2085.147) * (-2076.739) (-2086.462) [-2072.539] (-2087.229) -- 0:01:05
770500 -- [-2073.560] (-2074.937) (-2079.124) (-2081.251) * (-2079.404) (-2082.991) [-2071.838] (-2086.720) -- 0:01:05
770600 -- (-2072.931) (-2082.948) (-2080.285) [-2079.469] * (-2074.960) (-2081.837) [-2071.122] (-2093.825) -- 0:01:05
770700 -- [-2073.225] (-2085.458) (-2075.227) (-2074.846) * [-2070.454] (-2076.971) (-2074.102) (-2087.019) -- 0:01:05
770800 -- (-2083.225) (-2087.607) (-2082.063) [-2073.479] * (-2075.800) [-2078.121] (-2070.331) (-2086.922) -- 0:01:05
770900 -- (-2079.772) (-2088.490) (-2079.982) [-2074.365] * (-2080.915) [-2074.405] (-2074.816) (-2080.745) -- 0:01:05
771000 -- (-2078.738) (-2101.465) (-2076.877) [-2080.608] * (-2075.911) (-2079.708) (-2085.371) [-2072.740] -- 0:01:05
Average standard deviation of split frequencies: 0.003964
771100 -- [-2080.597] (-2099.422) (-2079.893) (-2083.596) * [-2074.535] (-2073.471) (-2077.826) (-2083.079) -- 0:01:05
771200 -- [-2078.108] (-2086.691) (-2074.155) (-2086.000) * [-2073.315] (-2076.808) (-2079.443) (-2078.400) -- 0:01:05
771300 -- (-2078.834) (-2089.468) (-2078.314) [-2074.942] * [-2073.593] (-2078.848) (-2078.692) (-2078.180) -- 0:01:05
771400 -- [-2079.069] (-2079.619) (-2081.213) (-2083.463) * (-2074.941) [-2074.437] (-2087.359) (-2080.472) -- 0:01:05
771500 -- (-2079.985) (-2080.322) [-2074.476] (-2083.216) * [-2073.218] (-2070.539) (-2085.961) (-2083.321) -- 0:01:05
771600 -- [-2073.699] (-2085.840) (-2075.471) (-2077.162) * (-2072.477) [-2071.389] (-2081.280) (-2082.028) -- 0:01:05
771700 -- [-2073.994] (-2072.733) (-2076.882) (-2080.178) * (-2075.273) [-2073.876] (-2080.798) (-2076.292) -- 0:01:05
771800 -- (-2074.707) (-2072.628) [-2075.254] (-2081.959) * (-2075.347) [-2069.937] (-2087.170) (-2078.900) -- 0:01:05
771900 -- [-2073.508] (-2075.928) (-2086.966) (-2085.462) * (-2078.490) [-2069.106] (-2095.926) (-2083.514) -- 0:01:05
772000 -- (-2076.812) [-2079.644] (-2083.469) (-2078.313) * [-2073.652] (-2071.000) (-2084.782) (-2076.709) -- 0:01:05
Average standard deviation of split frequencies: 0.003942
772100 -- (-2074.252) [-2081.555] (-2082.161) (-2079.961) * [-2068.886] (-2078.702) (-2074.132) (-2081.582) -- 0:01:05
772200 -- (-2082.305) (-2081.685) (-2097.195) [-2078.925] * (-2077.158) [-2077.749] (-2070.344) (-2085.151) -- 0:01:05
772300 -- [-2075.943] (-2078.318) (-2093.761) (-2077.980) * (-2079.765) (-2077.512) [-2072.636] (-2098.159) -- 0:01:05
772400 -- (-2092.661) [-2072.426] (-2091.644) (-2074.463) * (-2076.942) (-2076.751) [-2075.278] (-2090.837) -- 0:01:05
772500 -- (-2077.158) (-2081.959) (-2084.815) [-2078.517] * [-2079.277] (-2075.493) (-2071.500) (-2104.786) -- 0:01:05
772600 -- [-2079.688] (-2086.565) (-2084.711) (-2089.145) * (-2072.941) (-2075.463) [-2066.147] (-2092.900) -- 0:01:05
772700 -- (-2088.698) (-2078.896) (-2081.470) [-2080.153] * (-2074.436) (-2076.794) [-2066.173] (-2086.657) -- 0:01:05
772800 -- [-2077.418] (-2083.691) (-2080.706) (-2078.026) * [-2076.012] (-2084.574) (-2076.431) (-2083.401) -- 0:01:04
772900 -- (-2076.537) [-2080.931] (-2078.165) (-2086.684) * [-2073.544] (-2093.543) (-2073.300) (-2085.822) -- 0:01:04
773000 -- (-2079.451) (-2078.076) [-2076.863] (-2077.604) * [-2071.186] (-2078.925) (-2074.708) (-2076.641) -- 0:01:04
Average standard deviation of split frequencies: 0.003902
773100 -- (-2082.733) [-2081.101] (-2078.281) (-2081.204) * (-2069.859) (-2075.979) [-2070.218] (-2077.094) -- 0:01:04
773200 -- (-2086.230) (-2086.042) [-2074.836] (-2088.581) * (-2076.017) (-2081.394) [-2069.254] (-2079.458) -- 0:01:04
773300 -- [-2087.578] (-2077.796) (-2074.584) (-2089.693) * [-2079.254] (-2084.458) (-2075.203) (-2077.998) -- 0:01:04
773400 -- (-2080.807) (-2084.594) [-2074.921] (-2086.909) * [-2066.746] (-2081.438) (-2073.550) (-2091.016) -- 0:01:04
773500 -- (-2083.388) (-2080.807) [-2075.006] (-2085.699) * [-2072.707] (-2081.253) (-2088.072) (-2093.828) -- 0:01:04
773600 -- (-2081.735) [-2074.760] (-2075.342) (-2077.728) * [-2072.768] (-2078.971) (-2085.544) (-2076.895) -- 0:01:04
773700 -- (-2087.756) (-2075.855) (-2075.394) [-2074.390] * (-2073.223) [-2077.172] (-2079.212) (-2079.710) -- 0:01:04
773800 -- (-2086.284) (-2077.193) [-2079.962] (-2078.865) * (-2068.530) (-2076.475) [-2074.931] (-2081.195) -- 0:01:04
773900 -- (-2079.782) (-2069.959) [-2080.034] (-2081.962) * [-2068.598] (-2075.011) (-2078.095) (-2082.179) -- 0:01:04
774000 -- (-2087.810) [-2072.769] (-2076.561) (-2089.192) * [-2072.238] (-2075.625) (-2085.434) (-2078.562) -- 0:01:04
Average standard deviation of split frequencies: 0.003862
774100 -- (-2084.332) (-2072.047) [-2076.859] (-2079.103) * [-2073.854] (-2072.903) (-2083.241) (-2077.028) -- 0:01:04
774200 -- (-2083.948) [-2073.091] (-2079.635) (-2081.005) * (-2071.018) (-2075.509) [-2079.350] (-2078.367) -- 0:01:04
774300 -- (-2089.056) [-2070.783] (-2081.134) (-2081.979) * (-2072.661) [-2077.940] (-2084.858) (-2075.803) -- 0:01:04
774400 -- (-2077.335) [-2076.330] (-2082.917) (-2086.114) * [-2071.876] (-2085.168) (-2084.548) (-2079.059) -- 0:01:04
774500 -- [-2081.382] (-2083.483) (-2088.554) (-2078.517) * [-2071.586] (-2088.057) (-2082.910) (-2083.597) -- 0:01:04
774600 -- (-2076.500) (-2077.700) [-2077.407] (-2079.256) * (-2077.231) (-2086.097) [-2078.204] (-2086.322) -- 0:01:04
774700 -- (-2083.451) (-2079.653) [-2079.342] (-2078.272) * [-2075.008] (-2085.490) (-2073.753) (-2077.004) -- 0:01:04
774800 -- (-2079.266) (-2076.177) (-2079.878) [-2078.668] * (-2076.926) (-2076.161) [-2076.078] (-2079.874) -- 0:01:04
774900 -- (-2084.329) [-2074.839] (-2089.647) (-2077.857) * (-2074.344) (-2078.088) [-2075.012] (-2089.228) -- 0:01:04
775000 -- [-2075.392] (-2077.598) (-2078.339) (-2078.326) * (-2076.885) (-2078.041) [-2072.243] (-2083.849) -- 0:01:04
Average standard deviation of split frequencies: 0.003649
775100 -- (-2085.996) [-2073.932] (-2074.599) (-2075.580) * [-2072.801] (-2082.169) (-2072.211) (-2084.511) -- 0:01:04
775200 -- (-2074.932) (-2084.607) (-2075.907) [-2077.827] * [-2072.031] (-2084.031) (-2077.353) (-2079.628) -- 0:01:04
775300 -- (-2075.527) (-2076.844) [-2074.717] (-2080.203) * (-2079.974) (-2087.587) (-2075.815) [-2078.878] -- 0:01:04
775400 -- (-2073.640) (-2082.924) (-2077.268) [-2079.074] * (-2082.407) (-2079.744) (-2079.676) [-2078.500] -- 0:01:04
775500 -- (-2088.022) (-2081.154) (-2082.268) [-2080.166] * [-2072.372] (-2076.574) (-2082.567) (-2092.013) -- 0:01:04
775600 -- (-2082.320) (-2074.932) [-2082.015] (-2088.109) * (-2074.012) [-2072.892] (-2071.346) (-2089.363) -- 0:01:04
775700 -- (-2082.270) [-2068.396] (-2081.380) (-2081.255) * (-2076.736) [-2070.529] (-2080.369) (-2083.786) -- 0:01:04
775800 -- (-2081.765) [-2071.702] (-2085.197) (-2076.768) * (-2074.092) [-2072.807] (-2078.884) (-2085.095) -- 0:01:04
775900 -- (-2091.918) [-2070.882] (-2084.425) (-2075.285) * (-2074.779) (-2085.521) [-2071.854] (-2082.109) -- 0:01:04
776000 -- (-2086.378) (-2077.012) (-2084.758) [-2081.958] * (-2077.066) (-2081.698) [-2071.871] (-2083.052) -- 0:01:04
Average standard deviation of split frequencies: 0.003592
776100 -- (-2083.006) [-2077.953] (-2080.978) (-2082.638) * (-2068.227) (-2075.461) [-2073.188] (-2078.186) -- 0:01:04
776200 -- (-2085.821) (-2080.758) (-2082.024) [-2078.211] * (-2068.324) (-2078.169) [-2069.731] (-2078.543) -- 0:01:04
776300 -- [-2074.279] (-2075.363) (-2080.291) (-2077.599) * (-2072.912) [-2084.058] (-2070.306) (-2080.893) -- 0:01:03
776400 -- (-2077.455) [-2067.359] (-2085.694) (-2082.805) * (-2073.090) (-2080.879) [-2069.429] (-2092.065) -- 0:01:03
776500 -- (-2079.623) (-2070.525) [-2075.258] (-2086.613) * (-2076.693) (-2085.392) [-2071.754] (-2078.715) -- 0:01:03
776600 -- (-2076.386) (-2079.075) [-2075.635] (-2082.383) * (-2071.954) (-2080.515) (-2071.545) [-2073.942] -- 0:01:03
776700 -- (-2082.930) (-2073.444) [-2068.612] (-2074.788) * [-2072.297] (-2082.545) (-2077.094) (-2073.880) -- 0:01:03
776800 -- (-2074.947) (-2078.761) (-2085.486) [-2074.586] * (-2077.894) [-2078.198] (-2070.404) (-2078.084) -- 0:01:03
776900 -- (-2074.997) (-2076.542) [-2079.298] (-2077.958) * [-2077.425] (-2088.569) (-2071.793) (-2073.932) -- 0:01:03
777000 -- (-2075.613) (-2076.332) [-2079.612] (-2095.959) * (-2085.315) (-2080.010) [-2071.969] (-2073.279) -- 0:01:03
Average standard deviation of split frequencies: 0.003743
777100 -- (-2075.274) (-2085.820) [-2076.036] (-2083.192) * (-2076.203) (-2082.428) [-2071.953] (-2073.021) -- 0:01:03
777200 -- [-2073.492] (-2090.411) (-2076.973) (-2085.237) * (-2080.123) (-2083.434) (-2077.518) [-2076.643] -- 0:01:03
777300 -- [-2077.394] (-2087.298) (-2072.343) (-2095.970) * [-2068.881] (-2079.614) (-2073.516) (-2076.025) -- 0:01:03
777400 -- (-2075.605) (-2087.524) [-2068.131] (-2088.504) * [-2071.205] (-2077.110) (-2075.637) (-2080.179) -- 0:01:03
777500 -- (-2086.325) (-2082.945) [-2071.589] (-2076.348) * (-2072.615) (-2074.455) [-2068.484] (-2075.995) -- 0:01:03
777600 -- (-2083.052) (-2079.963) [-2070.930] (-2082.647) * (-2077.520) (-2082.428) [-2074.160] (-2085.330) -- 0:01:03
777700 -- (-2076.015) (-2081.500) [-2067.609] (-2081.237) * (-2080.579) (-2085.521) [-2072.030] (-2098.422) -- 0:01:03
777800 -- (-2076.975) (-2082.263) [-2071.461] (-2078.972) * (-2081.268) (-2086.592) [-2072.286] (-2087.721) -- 0:01:03
777900 -- (-2079.628) (-2074.279) [-2071.962] (-2080.496) * (-2081.270) [-2079.839] (-2086.150) (-2080.358) -- 0:01:03
778000 -- [-2076.428] (-2073.980) (-2073.096) (-2076.259) * (-2087.598) [-2078.183] (-2072.714) (-2083.888) -- 0:01:03
Average standard deviation of split frequencies: 0.003600
778100 -- (-2086.272) (-2070.800) [-2076.743] (-2089.946) * (-2081.900) (-2077.910) [-2068.694] (-2088.534) -- 0:01:03
778200 -- (-2086.028) (-2085.279) [-2072.938] (-2080.350) * (-2080.324) (-2081.753) [-2072.881] (-2086.407) -- 0:01:03
778300 -- (-2082.181) (-2074.581) [-2073.499] (-2076.274) * (-2073.058) (-2075.590) [-2070.752] (-2079.174) -- 0:01:03
778400 -- (-2086.434) (-2073.739) [-2071.550] (-2081.239) * (-2075.286) (-2083.922) [-2077.815] (-2078.087) -- 0:01:03
778500 -- (-2080.460) (-2080.549) [-2068.696] (-2073.511) * (-2074.264) (-2092.366) [-2071.772] (-2080.345) -- 0:01:03
778600 -- (-2078.654) (-2082.957) (-2071.456) [-2074.252] * (-2074.346) (-2090.703) (-2079.142) [-2074.415] -- 0:01:03
778700 -- [-2079.526] (-2075.207) (-2071.230) (-2081.672) * (-2080.224) [-2080.818] (-2077.190) (-2082.016) -- 0:01:03
778800 -- (-2076.948) [-2078.853] (-2077.896) (-2080.808) * (-2082.584) (-2083.753) [-2074.000] (-2073.878) -- 0:01:03
778900 -- (-2078.614) (-2074.961) [-2079.194] (-2093.364) * (-2075.702) (-2085.984) [-2073.723] (-2075.879) -- 0:01:03
779000 -- [-2079.181] (-2074.511) (-2078.245) (-2080.745) * (-2076.264) [-2080.675] (-2079.062) (-2081.133) -- 0:01:03
Average standard deviation of split frequencies: 0.003595
779100 -- [-2074.526] (-2087.300) (-2084.641) (-2079.733) * [-2075.713] (-2078.487) (-2068.494) (-2080.006) -- 0:01:03
779200 -- (-2076.716) (-2080.158) [-2074.069] (-2081.793) * (-2077.226) (-2088.288) [-2068.185] (-2081.461) -- 0:01:03
779300 -- [-2078.791] (-2078.960) (-2077.559) (-2086.358) * [-2068.751] (-2090.099) (-2071.555) (-2078.671) -- 0:01:03
779400 -- [-2074.967] (-2082.670) (-2073.810) (-2084.646) * (-2069.623) (-2084.630) [-2077.668] (-2084.933) -- 0:01:03
779500 -- (-2078.531) (-2076.023) [-2068.640] (-2086.779) * [-2071.169] (-2083.617) (-2073.602) (-2086.871) -- 0:01:03
779600 -- (-2081.296) (-2075.681) [-2073.149] (-2086.600) * (-2072.060) [-2074.963] (-2083.198) (-2094.295) -- 0:01:03
779700 -- [-2078.260] (-2083.615) (-2072.653) (-2098.566) * [-2069.260] (-2093.449) (-2075.055) (-2084.442) -- 0:01:03
779800 -- (-2084.612) (-2082.234) [-2072.224] (-2095.587) * (-2070.948) (-2083.263) [-2067.891] (-2079.140) -- 0:01:02
779900 -- (-2078.552) (-2081.196) [-2070.189] (-2079.159) * (-2080.468) (-2078.149) (-2074.820) [-2078.719] -- 0:01:02
780000 -- (-2076.937) (-2080.391) [-2076.766] (-2084.941) * (-2073.989) (-2077.100) [-2071.064] (-2083.225) -- 0:01:02
Average standard deviation of split frequencies: 0.003591
780100 -- (-2080.211) [-2074.074] (-2080.039) (-2076.588) * [-2067.418] (-2082.761) (-2069.729) (-2092.022) -- 0:01:02
780200 -- (-2083.034) [-2073.380] (-2084.271) (-2073.774) * (-2072.899) (-2092.445) [-2074.146] (-2088.790) -- 0:01:02
780300 -- (-2079.716) [-2075.880] (-2075.576) (-2078.914) * [-2073.632] (-2081.429) (-2077.673) (-2078.826) -- 0:01:02
780400 -- (-2071.931) (-2075.213) [-2070.006] (-2076.003) * (-2072.649) (-2087.315) (-2078.246) [-2076.937] -- 0:01:02
780500 -- (-2087.224) (-2074.568) [-2069.453] (-2078.374) * (-2075.428) (-2088.648) (-2077.848) [-2073.381] -- 0:01:02
780600 -- (-2074.625) (-2082.707) [-2074.856] (-2080.216) * (-2081.218) (-2089.588) (-2085.565) [-2075.279] -- 0:01:02
780700 -- [-2074.239] (-2077.497) (-2087.020) (-2076.690) * (-2085.084) (-2088.853) (-2078.580) [-2076.413] -- 0:01:02
780800 -- (-2081.541) [-2075.875] (-2085.970) (-2076.339) * (-2080.130) (-2084.663) [-2082.526] (-2079.598) -- 0:01:02
780900 -- [-2077.689] (-2084.142) (-2076.855) (-2077.697) * (-2085.642) (-2081.950) (-2089.590) [-2077.945] -- 0:01:02
781000 -- (-2079.021) (-2079.044) [-2074.618] (-2085.113) * [-2081.300] (-2088.251) (-2084.643) (-2080.467) -- 0:01:02
Average standard deviation of split frequencies: 0.003586
781100 -- [-2075.064] (-2086.791) (-2078.699) (-2082.776) * (-2078.159) (-2084.778) [-2072.462] (-2083.221) -- 0:01:02
781200 -- (-2075.591) (-2095.070) [-2076.182] (-2079.700) * (-2094.542) (-2086.601) [-2072.791] (-2080.395) -- 0:01:02
781300 -- (-2080.343) (-2090.485) [-2075.684] (-2082.510) * (-2083.017) (-2083.043) [-2071.696] (-2080.647) -- 0:01:02
781400 -- (-2080.842) (-2079.248) [-2071.841] (-2083.674) * [-2074.474] (-2083.271) (-2072.830) (-2085.407) -- 0:01:02
781500 -- (-2079.356) (-2083.810) (-2077.639) [-2077.148] * (-2077.719) (-2086.906) [-2071.699] (-2077.632) -- 0:01:02
781600 -- (-2080.854) (-2095.471) (-2079.979) [-2077.698] * (-2081.164) (-2085.883) [-2081.287] (-2076.666) -- 0:01:02
781700 -- (-2078.423) (-2083.516) (-2076.255) [-2075.518] * (-2078.020) (-2075.512) [-2071.358] (-2077.879) -- 0:01:02
781800 -- (-2077.670) (-2084.578) (-2083.162) [-2074.182] * (-2074.307) (-2076.690) [-2071.467] (-2085.661) -- 0:01:02
781900 -- (-2074.506) (-2080.977) (-2080.673) [-2076.143] * (-2083.677) (-2081.323) [-2068.829] (-2083.152) -- 0:01:02
782000 -- (-2078.807) (-2078.831) [-2077.109] (-2081.267) * (-2074.479) (-2081.903) (-2068.449) [-2081.234] -- 0:01:02
Average standard deviation of split frequencies: 0.003496
782100 -- [-2080.484] (-2078.845) (-2076.996) (-2077.744) * (-2070.288) (-2078.585) [-2068.794] (-2079.700) -- 0:01:02
782200 -- (-2090.027) (-2080.190) (-2075.927) [-2083.712] * [-2076.108] (-2087.753) (-2073.000) (-2084.272) -- 0:01:02
782300 -- (-2081.904) (-2078.669) [-2076.844] (-2080.886) * [-2074.255] (-2087.025) (-2071.371) (-2087.180) -- 0:01:02
782400 -- [-2088.322] (-2078.214) (-2074.753) (-2087.038) * (-2073.513) (-2089.224) [-2071.278] (-2078.924) -- 0:01:02
782500 -- (-2086.610) [-2070.281] (-2074.495) (-2083.330) * (-2068.981) (-2090.101) [-2073.262] (-2073.228) -- 0:01:02
782600 -- (-2081.504) (-2073.285) [-2069.253] (-2076.267) * (-2079.269) (-2084.227) (-2074.022) [-2076.553] -- 0:01:02
782700 -- (-2088.767) [-2070.815] (-2072.722) (-2074.346) * (-2080.259) (-2079.303) [-2078.777] (-2076.852) -- 0:01:02
782800 -- (-2091.267) [-2070.253] (-2074.455) (-2079.362) * (-2078.542) [-2077.304] (-2077.779) (-2078.526) -- 0:01:02
782900 -- (-2082.215) (-2071.161) (-2076.400) [-2077.048] * [-2077.414] (-2085.489) (-2078.306) (-2080.710) -- 0:01:02
783000 -- (-2087.032) [-2069.276] (-2081.972) (-2077.690) * (-2078.561) (-2090.365) [-2072.036] (-2077.713) -- 0:01:02
Average standard deviation of split frequencies: 0.003491
783100 -- (-2085.787) [-2072.092] (-2085.895) (-2075.487) * [-2081.397] (-2080.631) (-2077.380) (-2071.455) -- 0:01:02
783200 -- (-2084.591) (-2074.953) [-2082.173] (-2079.983) * (-2072.205) (-2079.428) (-2076.348) [-2071.978] -- 0:01:02
783300 -- (-2091.813) (-2073.804) [-2074.638] (-2079.781) * (-2076.073) (-2078.491) (-2084.437) [-2074.868] -- 0:01:01
783400 -- (-2085.736) [-2074.855] (-2075.217) (-2082.461) * (-2074.736) (-2084.448) (-2078.849) [-2080.034] -- 0:01:01
783500 -- (-2077.965) (-2079.620) [-2077.766] (-2076.838) * [-2077.606] (-2088.393) (-2089.119) (-2081.678) -- 0:01:01
783600 -- (-2077.759) (-2079.614) [-2072.356] (-2084.581) * [-2078.415] (-2095.820) (-2077.255) (-2090.926) -- 0:01:01
783700 -- (-2082.730) (-2078.843) [-2075.856] (-2073.261) * (-2079.389) (-2086.012) [-2076.774] (-2086.540) -- 0:01:01
783800 -- (-2084.875) (-2079.794) [-2071.911] (-2075.462) * (-2075.209) [-2075.687] (-2071.728) (-2087.841) -- 0:01:01
783900 -- (-2078.728) (-2079.888) (-2072.508) [-2074.286] * (-2082.390) [-2073.400] (-2084.048) (-2097.241) -- 0:01:01
784000 -- (-2081.992) (-2074.286) [-2070.780] (-2074.656) * [-2079.115] (-2075.906) (-2088.553) (-2097.990) -- 0:01:01
Average standard deviation of split frequencies: 0.003367
784100 -- (-2085.607) (-2077.274) [-2069.064] (-2081.891) * (-2085.507) [-2078.112] (-2075.580) (-2100.152) -- 0:01:01
784200 -- (-2080.183) [-2067.654] (-2079.726) (-2082.591) * (-2086.416) [-2078.354] (-2077.307) (-2087.930) -- 0:01:01
784300 -- (-2075.881) [-2068.976] (-2075.704) (-2082.458) * (-2086.296) (-2081.862) [-2070.574] (-2080.613) -- 0:01:01
784400 -- (-2083.968) (-2070.808) [-2066.566] (-2081.207) * (-2082.989) (-2081.505) [-2073.289] (-2086.967) -- 0:01:01
784500 -- (-2077.728) (-2076.209) [-2070.984] (-2085.834) * (-2082.057) (-2078.253) (-2074.496) [-2077.121] -- 0:01:01
784600 -- (-2079.362) (-2075.958) [-2072.294] (-2080.877) * (-2079.703) [-2075.815] (-2073.803) (-2077.698) -- 0:01:01
784700 -- (-2078.049) (-2075.993) [-2069.601] (-2083.213) * (-2074.326) [-2077.743] (-2073.185) (-2075.566) -- 0:01:01
784800 -- (-2094.683) (-2076.406) (-2069.977) [-2073.295] * [-2071.250] (-2081.257) (-2079.182) (-2081.730) -- 0:01:01
784900 -- (-2077.949) (-2074.848) [-2075.953] (-2075.945) * (-2073.749) [-2081.688] (-2075.232) (-2079.006) -- 0:01:01
785000 -- (-2074.195) [-2070.608] (-2071.373) (-2084.619) * (-2077.114) (-2082.287) [-2077.792] (-2084.340) -- 0:01:01
Average standard deviation of split frequencies: 0.003602
785100 -- (-2088.048) [-2071.835] (-2070.662) (-2076.883) * [-2072.701] (-2084.377) (-2072.852) (-2081.332) -- 0:01:01
785200 -- (-2079.920) [-2074.254] (-2074.449) (-2079.696) * (-2073.761) [-2079.895] (-2083.889) (-2079.117) -- 0:01:01
785300 -- (-2088.183) [-2066.906] (-2076.763) (-2078.720) * (-2075.659) (-2078.715) [-2081.662] (-2091.146) -- 0:01:01
785400 -- (-2086.227) [-2070.648] (-2078.566) (-2075.212) * [-2076.296] (-2079.145) (-2075.857) (-2092.396) -- 0:01:01
785500 -- (-2083.061) [-2071.074] (-2075.465) (-2078.468) * (-2081.262) (-2077.539) [-2070.562] (-2076.891) -- 0:01:01
785600 -- (-2075.829) [-2070.298] (-2087.084) (-2080.004) * (-2076.936) [-2081.076] (-2072.902) (-2082.281) -- 0:01:01
785700 -- [-2073.334] (-2074.181) (-2079.837) (-2084.861) * (-2083.289) (-2080.368) (-2073.615) [-2072.305] -- 0:01:01
785800 -- (-2075.268) [-2075.626] (-2084.586) (-2078.225) * (-2091.053) (-2085.855) [-2072.722] (-2078.111) -- 0:01:01
785900 -- [-2075.308] (-2076.723) (-2075.298) (-2089.165) * (-2080.151) [-2075.488] (-2073.782) (-2085.040) -- 0:01:01
786000 -- (-2078.285) [-2076.233] (-2075.663) (-2095.105) * (-2084.365) (-2084.438) [-2072.414] (-2072.249) -- 0:01:01
Average standard deviation of split frequencies: 0.003529
786100 -- (-2082.584) (-2075.715) [-2082.060] (-2082.289) * (-2078.773) (-2083.495) (-2079.558) [-2073.954] -- 0:01:01
786200 -- (-2083.730) (-2073.572) (-2084.264) [-2073.170] * [-2076.471] (-2085.481) (-2072.645) (-2076.241) -- 0:01:01
786300 -- [-2072.474] (-2073.537) (-2078.426) (-2079.393) * (-2081.809) (-2085.129) (-2078.800) [-2082.734] -- 0:01:01
786400 -- (-2074.724) [-2070.137] (-2086.968) (-2081.113) * (-2076.833) [-2082.412] (-2082.860) (-2081.048) -- 0:01:01
786500 -- (-2078.155) [-2073.979] (-2086.068) (-2089.377) * (-2080.058) (-2080.653) [-2076.163] (-2089.678) -- 0:01:01
786600 -- (-2084.047) [-2074.421] (-2079.021) (-2077.498) * (-2078.774) (-2076.493) [-2072.583] (-2077.767) -- 0:01:01
786700 -- (-2082.403) [-2079.350] (-2085.645) (-2078.119) * (-2083.873) (-2078.868) [-2077.297] (-2083.641) -- 0:01:01
786800 -- (-2089.630) [-2080.722] (-2085.635) (-2079.284) * (-2084.170) (-2078.403) [-2077.187] (-2081.193) -- 0:01:00
786900 -- (-2080.351) [-2074.181] (-2078.404) (-2075.396) * (-2085.392) [-2078.945] (-2073.815) (-2092.520) -- 0:01:00
787000 -- [-2080.747] (-2072.185) (-2080.287) (-2080.393) * (-2091.312) (-2078.929) [-2075.913] (-2083.433) -- 0:01:00
Average standard deviation of split frequencies: 0.003490
787100 -- (-2084.291) [-2076.609] (-2077.664) (-2084.367) * (-2087.887) [-2076.134] (-2082.232) (-2088.935) -- 0:01:00
787200 -- (-2085.211) [-2078.811] (-2084.397) (-2088.130) * (-2087.283) (-2077.287) [-2075.503] (-2088.626) -- 0:01:00
787300 -- (-2080.479) (-2081.998) [-2078.266] (-2087.850) * (-2076.810) (-2075.932) (-2078.667) [-2077.863] -- 0:01:00
787400 -- [-2076.047] (-2075.241) (-2071.591) (-2087.556) * (-2083.960) [-2076.043] (-2082.061) (-2081.489) -- 0:01:00
787500 -- [-2072.945] (-2081.040) (-2073.549) (-2079.237) * (-2087.475) (-2085.731) [-2078.485] (-2078.036) -- 0:01:00
787600 -- (-2074.200) (-2077.728) (-2084.710) [-2079.275] * (-2086.152) [-2075.801] (-2079.899) (-2082.651) -- 0:01:00
787700 -- [-2071.908] (-2081.596) (-2077.865) (-2078.539) * (-2077.668) (-2078.269) [-2076.152] (-2078.706) -- 0:01:00
787800 -- (-2076.435) [-2079.885] (-2079.838) (-2080.245) * (-2078.624) [-2073.643] (-2072.225) (-2081.300) -- 0:01:00
787900 -- (-2080.025) [-2074.906] (-2083.630) (-2085.365) * (-2079.947) (-2081.670) [-2071.574] (-2078.496) -- 0:01:00
788000 -- (-2079.241) (-2073.837) (-2081.357) [-2081.013] * [-2081.419] (-2077.240) (-2071.692) (-2086.473) -- 0:01:00
Average standard deviation of split frequencies: 0.003486
788100 -- [-2073.368] (-2081.385) (-2086.881) (-2077.947) * (-2082.018) (-2081.943) (-2077.817) [-2081.508] -- 0:01:00
788200 -- [-2074.587] (-2073.747) (-2086.804) (-2076.987) * (-2082.599) (-2081.904) (-2082.850) [-2075.677] -- 0:01:00
788300 -- (-2075.153) [-2080.613] (-2089.054) (-2085.290) * (-2074.959) (-2088.040) [-2070.765] (-2081.682) -- 0:01:00
788400 -- (-2076.056) (-2083.458) (-2085.176) [-2081.126] * (-2074.936) (-2082.245) [-2069.669] (-2076.081) -- 0:01:00
788500 -- [-2076.241] (-2093.861) (-2081.835) (-2073.380) * (-2088.081) (-2082.843) [-2072.566] (-2074.960) -- 0:01:00
788600 -- [-2076.105] (-2088.629) (-2090.130) (-2082.281) * [-2079.112] (-2072.862) (-2074.892) (-2082.660) -- 0:01:00
788700 -- [-2075.879] (-2104.086) (-2104.338) (-2075.110) * (-2079.960) [-2077.024] (-2077.659) (-2077.935) -- 0:01:00
788800 -- (-2080.062) (-2079.327) (-2089.583) [-2071.801] * (-2089.401) (-2082.038) (-2080.249) [-2072.957] -- 0:01:00
788900 -- (-2083.178) (-2076.326) (-2087.844) [-2073.771] * (-2090.491) (-2078.534) (-2078.720) [-2074.765] -- 0:01:00
789000 -- (-2081.567) [-2074.138] (-2088.342) (-2071.059) * (-2094.323) [-2073.243] (-2076.536) (-2078.793) -- 0:01:00
Average standard deviation of split frequencies: 0.003464
789100 -- (-2085.048) [-2073.958] (-2084.206) (-2081.161) * (-2083.626) [-2074.666] (-2077.843) (-2084.971) -- 0:01:00
789200 -- (-2089.692) [-2073.234] (-2083.937) (-2079.544) * (-2075.980) (-2078.241) [-2072.272] (-2080.055) -- 0:01:00
789300 -- (-2082.262) [-2073.527] (-2085.781) (-2083.468) * [-2075.405] (-2087.997) (-2074.128) (-2082.329) -- 0:01:00
789400 -- (-2075.902) (-2076.062) (-2087.989) [-2081.958] * [-2074.980] (-2079.568) (-2076.106) (-2092.924) -- 0:01:00
789500 -- (-2077.116) [-2072.556] (-2089.706) (-2073.643) * [-2078.267] (-2079.596) (-2075.972) (-2087.525) -- 0:01:00
789600 -- (-2078.849) [-2068.028] (-2080.448) (-2074.972) * [-2074.054] (-2078.053) (-2074.711) (-2093.815) -- 0:01:00
789700 -- (-2084.694) (-2070.437) (-2087.128) [-2075.397] * (-2074.933) (-2080.314) [-2068.414] (-2085.336) -- 0:01:00
789800 -- (-2093.523) [-2072.224] (-2083.747) (-2076.394) * (-2086.359) (-2071.869) (-2077.576) [-2078.241] -- 0:01:00
789900 -- (-2086.639) (-2075.307) [-2077.757] (-2081.650) * (-2073.323) [-2077.899] (-2076.538) (-2087.777) -- 0:01:00
790000 -- (-2085.720) [-2083.322] (-2081.113) (-2079.952) * (-2076.404) [-2073.408] (-2068.838) (-2082.683) -- 0:01:00
Average standard deviation of split frequencies: 0.003443
790100 -- (-2080.914) (-2075.491) (-2074.598) [-2071.632] * (-2076.921) (-2086.098) [-2072.440] (-2092.460) -- 0:01:00
790200 -- (-2096.666) (-2078.146) (-2077.184) [-2072.086] * (-2084.790) (-2079.507) [-2069.554] (-2078.098) -- 0:01:00
790300 -- (-2091.788) (-2076.549) (-2074.477) [-2071.402] * (-2083.635) (-2076.022) [-2071.849] (-2087.712) -- 0:00:59
790400 -- (-2088.928) (-2072.226) [-2075.472] (-2077.045) * (-2083.909) (-2080.967) [-2070.301] (-2078.875) -- 0:00:59
790500 -- (-2086.177) [-2079.482] (-2084.354) (-2075.983) * (-2078.413) (-2076.386) [-2075.453] (-2085.113) -- 0:00:59
790600 -- (-2084.887) [-2079.537] (-2080.174) (-2087.353) * (-2080.173) (-2078.641) [-2072.418] (-2087.092) -- 0:00:59
790700 -- (-2086.312) [-2080.505] (-2079.023) (-2075.769) * (-2078.828) (-2079.993) (-2081.293) [-2072.736] -- 0:00:59
790800 -- (-2079.610) (-2093.285) (-2076.682) [-2075.495] * (-2078.565) [-2075.432] (-2077.454) (-2073.893) -- 0:00:59
790900 -- (-2078.857) (-2079.512) [-2078.434] (-2072.997) * (-2079.091) (-2081.965) (-2083.462) [-2074.984] -- 0:00:59
791000 -- [-2081.085] (-2074.962) (-2083.447) (-2075.089) * (-2074.417) (-2076.192) (-2082.285) [-2072.343] -- 0:00:59
Average standard deviation of split frequencies: 0.003422
791100 -- (-2078.618) (-2076.267) [-2074.283] (-2071.781) * [-2074.646] (-2074.562) (-2072.625) (-2072.612) -- 0:00:59
791200 -- (-2072.256) (-2075.369) [-2081.993] (-2073.619) * (-2081.430) (-2078.637) [-2085.479] (-2084.716) -- 0:00:59
791300 -- (-2080.347) (-2071.871) (-2079.003) [-2071.482] * (-2083.630) (-2086.121) [-2077.144] (-2074.634) -- 0:00:59
791400 -- (-2081.846) (-2086.143) [-2080.959] (-2077.854) * (-2076.086) (-2084.768) (-2085.434) [-2075.772] -- 0:00:59
791500 -- [-2077.670] (-2075.680) (-2076.940) (-2074.107) * (-2082.861) [-2081.263] (-2077.582) (-2076.106) -- 0:00:59
791600 -- (-2082.620) [-2071.138] (-2076.180) (-2080.979) * (-2078.708) (-2092.070) (-2079.694) [-2077.470] -- 0:00:59
791700 -- (-2085.546) [-2072.518] (-2078.171) (-2078.073) * (-2085.119) [-2072.607] (-2074.233) (-2076.973) -- 0:00:59
791800 -- [-2079.820] (-2068.204) (-2089.248) (-2074.642) * (-2082.226) (-2080.396) (-2078.920) [-2074.543] -- 0:00:59
791900 -- (-2088.333) [-2072.126] (-2081.364) (-2075.446) * (-2086.090) [-2075.364] (-2075.611) (-2085.627) -- 0:00:59
792000 -- (-2079.949) (-2077.537) (-2084.993) [-2072.750] * (-2087.579) (-2083.859) (-2072.861) [-2081.142] -- 0:00:59
Average standard deviation of split frequencies: 0.003622
792100 -- (-2082.887) [-2072.708] (-2085.031) (-2076.249) * (-2079.851) (-2084.794) [-2074.633] (-2078.581) -- 0:00:59
792200 -- (-2080.459) [-2070.010] (-2083.770) (-2077.767) * (-2079.874) (-2086.773) [-2068.535] (-2077.864) -- 0:00:59
792300 -- (-2076.407) [-2074.711] (-2086.861) (-2074.921) * [-2080.119] (-2084.322) (-2081.876) (-2080.349) -- 0:00:59
792400 -- [-2079.496] (-2075.111) (-2084.617) (-2078.674) * (-2085.078) (-2081.024) (-2077.230) [-2075.797] -- 0:00:59
792500 -- (-2079.718) (-2071.845) (-2092.524) [-2076.000] * (-2089.009) (-2079.533) [-2072.841] (-2076.834) -- 0:00:59
792600 -- (-2080.095) (-2078.263) (-2101.011) [-2077.994] * (-2087.217) (-2083.105) (-2078.098) [-2076.448] -- 0:00:59
792700 -- (-2078.512) [-2070.021] (-2090.421) (-2073.897) * (-2077.559) (-2078.420) [-2068.369] (-2077.960) -- 0:00:59
792800 -- (-2079.953) (-2076.146) (-2096.875) [-2071.610] * (-2085.830) (-2089.571) [-2069.140] (-2078.320) -- 0:00:59
792900 -- [-2079.704] (-2072.272) (-2098.186) (-2073.363) * (-2089.710) (-2091.201) (-2076.955) [-2081.073] -- 0:00:59
793000 -- (-2084.563) [-2068.875] (-2088.203) (-2071.776) * (-2084.769) (-2082.487) [-2071.361] (-2080.037) -- 0:00:59
Average standard deviation of split frequencies: 0.003583
793100 -- (-2077.851) [-2072.065] (-2086.166) (-2076.260) * (-2078.473) (-2081.225) [-2069.863] (-2077.521) -- 0:00:59
793200 -- (-2084.142) [-2068.867] (-2087.635) (-2072.328) * (-2074.301) (-2083.101) [-2069.760] (-2079.960) -- 0:00:59
793300 -- (-2078.795) (-2074.898) (-2081.954) [-2069.027] * (-2079.076) (-2078.660) [-2075.574] (-2082.226) -- 0:00:59
793400 -- (-2078.919) (-2076.111) (-2086.279) [-2070.517] * (-2086.230) (-2079.278) [-2076.613] (-2087.996) -- 0:00:59
793500 -- [-2075.284] (-2075.663) (-2077.908) (-2072.228) * (-2085.472) [-2073.546] (-2070.721) (-2089.996) -- 0:00:59
793600 -- (-2076.181) (-2076.246) (-2086.351) [-2073.974] * (-2078.731) [-2078.588] (-2072.273) (-2083.340) -- 0:00:59
793700 -- (-2081.221) (-2074.329) [-2078.709] (-2081.320) * (-2080.219) [-2078.894] (-2070.496) (-2080.139) -- 0:00:59
793800 -- (-2086.854) (-2068.837) [-2075.203] (-2083.237) * (-2081.863) (-2091.270) [-2074.148] (-2085.776) -- 0:00:58
793900 -- (-2082.761) [-2074.678] (-2081.747) (-2081.381) * (-2083.387) (-2086.220) [-2070.827] (-2082.991) -- 0:00:58
794000 -- (-2076.776) [-2071.524] (-2086.785) (-2079.246) * (-2084.984) (-2082.226) [-2065.330] (-2081.951) -- 0:00:58
Average standard deviation of split frequencies: 0.003392
794100 -- (-2075.037) (-2071.395) (-2081.095) [-2075.306] * (-2078.706) (-2084.701) [-2068.502] (-2091.435) -- 0:00:58
794200 -- (-2074.494) [-2079.597] (-2078.935) (-2071.214) * (-2091.236) (-2078.821) [-2070.855] (-2083.980) -- 0:00:58
794300 -- (-2077.867) [-2072.613] (-2081.648) (-2077.799) * (-2082.986) (-2078.545) [-2068.128] (-2086.288) -- 0:00:58
794400 -- (-2081.163) [-2071.520] (-2079.790) (-2072.116) * (-2077.152) (-2088.132) [-2067.332] (-2077.740) -- 0:00:58
794500 -- (-2082.021) [-2072.997] (-2077.590) (-2075.230) * (-2078.717) (-2075.445) [-2068.827] (-2082.713) -- 0:00:58
794600 -- [-2076.986] (-2082.947) (-2081.449) (-2084.196) * (-2080.051) (-2074.580) (-2071.823) [-2082.772] -- 0:00:58
794700 -- (-2083.336) (-2075.135) (-2078.908) [-2069.033] * [-2078.011] (-2079.107) (-2075.275) (-2075.051) -- 0:00:58
794800 -- (-2080.880) (-2074.306) (-2077.488) [-2073.932] * (-2078.033) (-2080.242) [-2076.027] (-2092.185) -- 0:00:58
794900 -- (-2089.079) (-2082.987) (-2090.641) [-2077.573] * (-2083.795) (-2087.343) [-2074.215] (-2082.391) -- 0:00:58
795000 -- (-2075.006) [-2077.771] (-2076.737) (-2076.864) * (-2081.885) (-2091.361) (-2072.816) [-2077.104] -- 0:00:58
Average standard deviation of split frequencies: 0.003337
795100 -- [-2076.143] (-2076.867) (-2075.152) (-2075.131) * (-2087.321) (-2089.327) [-2070.212] (-2091.689) -- 0:00:58
795200 -- (-2079.032) [-2075.910] (-2086.564) (-2074.937) * (-2090.489) (-2082.369) [-2071.386] (-2083.841) -- 0:00:58
795300 -- (-2082.200) (-2075.826) [-2080.239] (-2083.575) * (-2084.702) (-2081.398) [-2067.609] (-2083.448) -- 0:00:58
795400 -- (-2082.499) (-2079.445) (-2082.464) [-2079.050] * (-2085.551) (-2079.576) [-2073.717] (-2085.478) -- 0:00:58
795500 -- (-2082.322) (-2084.810) (-2076.554) [-2074.709] * (-2086.045) (-2074.455) [-2068.698] (-2081.378) -- 0:00:58
795600 -- (-2080.693) (-2087.375) [-2076.695] (-2084.133) * [-2081.881] (-2077.206) (-2073.366) (-2084.349) -- 0:00:58
795700 -- [-2076.397] (-2083.436) (-2083.478) (-2076.615) * (-2080.616) (-2073.963) [-2069.469] (-2080.732) -- 0:00:58
795800 -- (-2076.353) [-2071.796] (-2082.241) (-2070.878) * (-2076.127) [-2078.086] (-2068.889) (-2085.063) -- 0:00:58
795900 -- (-2081.463) [-2071.791] (-2092.772) (-2071.005) * (-2082.835) (-2076.525) [-2071.968] (-2076.226) -- 0:00:58
796000 -- (-2076.981) [-2067.041] (-2079.056) (-2075.063) * [-2076.658] (-2084.728) (-2084.002) (-2077.746) -- 0:00:58
Average standard deviation of split frequencies: 0.003400
796100 -- (-2079.091) (-2071.161) (-2086.354) [-2070.563] * (-2080.939) (-2077.516) (-2076.724) [-2079.103] -- 0:00:58
796200 -- (-2080.184) [-2075.944] (-2091.249) (-2069.677) * (-2090.313) (-2077.153) [-2078.196] (-2073.890) -- 0:00:58
796300 -- (-2088.574) (-2078.528) (-2083.069) [-2071.681] * (-2085.222) (-2075.253) (-2077.732) [-2072.961] -- 0:00:58
796400 -- (-2081.755) [-2080.894] (-2085.638) (-2068.452) * [-2077.944] (-2079.585) (-2082.858) (-2074.067) -- 0:00:58
796500 -- [-2076.990] (-2077.547) (-2087.641) (-2071.465) * (-2082.788) (-2082.357) (-2074.793) [-2076.979] -- 0:00:58
796600 -- [-2073.045] (-2075.740) (-2095.002) (-2082.896) * (-2082.499) [-2074.483] (-2077.850) (-2077.669) -- 0:00:58
796700 -- [-2073.214] (-2084.836) (-2084.269) (-2080.501) * (-2080.508) (-2076.554) [-2069.977] (-2077.669) -- 0:00:58
796800 -- (-2075.853) [-2082.269] (-2081.262) (-2079.638) * (-2081.068) [-2080.910] (-2073.494) (-2079.603) -- 0:00:58
796900 -- (-2088.368) (-2085.013) (-2085.416) [-2083.982] * (-2084.545) (-2084.866) [-2073.918] (-2079.454) -- 0:00:58
797000 -- (-2078.442) (-2080.834) (-2082.020) [-2073.411] * [-2076.739] (-2079.517) (-2074.238) (-2086.598) -- 0:00:58
Average standard deviation of split frequencies: 0.003447
797100 -- (-2081.250) (-2086.709) (-2077.159) [-2072.453] * (-2075.959) (-2084.662) [-2078.774] (-2091.247) -- 0:00:58
797200 -- (-2079.746) (-2079.150) (-2080.741) [-2068.920] * (-2083.884) [-2076.214] (-2072.921) (-2079.724) -- 0:00:58
797300 -- (-2076.499) (-2087.371) (-2086.068) [-2069.463] * (-2077.687) [-2074.027] (-2085.477) (-2077.836) -- 0:00:57
797400 -- (-2081.108) (-2080.327) [-2078.809] (-2070.023) * (-2082.011) (-2082.617) (-2081.258) [-2076.800] -- 0:00:57
797500 -- (-2098.661) [-2071.417] (-2078.948) (-2068.675) * [-2081.413] (-2077.945) (-2076.699) (-2073.695) -- 0:00:57
797600 -- (-2078.283) (-2078.746) (-2081.621) [-2073.302] * (-2083.329) (-2084.396) (-2077.682) [-2075.754] -- 0:00:57
797700 -- (-2075.583) [-2075.263] (-2081.249) (-2070.658) * (-2086.946) (-2087.437) [-2073.950] (-2081.555) -- 0:00:57
797800 -- (-2076.607) [-2072.824] (-2076.719) (-2071.130) * (-2077.530) (-2081.878) (-2072.139) [-2076.610] -- 0:00:57
797900 -- (-2081.007) (-2072.773) (-2079.864) [-2070.211] * [-2075.110] (-2075.694) (-2076.842) (-2085.117) -- 0:00:57
798000 -- [-2076.936] (-2071.211) (-2082.935) (-2071.697) * (-2086.662) [-2075.510] (-2074.735) (-2090.331) -- 0:00:57
Average standard deviation of split frequencies: 0.003308
798100 -- (-2087.470) (-2073.017) (-2077.701) [-2073.196] * (-2083.298) [-2077.916] (-2077.465) (-2087.669) -- 0:00:57
798200 -- (-2081.588) (-2077.558) (-2077.637) [-2067.809] * (-2085.009) (-2081.423) [-2070.516] (-2080.749) -- 0:00:57
798300 -- (-2079.411) (-2087.553) [-2081.078] (-2068.587) * (-2084.656) (-2079.171) [-2072.017] (-2082.885) -- 0:00:57
798400 -- (-2084.609) (-2087.064) (-2093.096) [-2071.169] * (-2073.330) [-2078.719] (-2073.146) (-2085.596) -- 0:00:57
798500 -- (-2085.944) (-2080.446) (-2079.467) [-2072.676] * [-2078.740] (-2082.700) (-2074.436) (-2087.193) -- 0:00:57
798600 -- (-2086.444) [-2079.084] (-2078.413) (-2074.831) * (-2078.537) (-2079.734) (-2079.350) [-2082.099] -- 0:00:57
798700 -- (-2087.882) (-2073.212) [-2076.315] (-2083.095) * (-2085.745) (-2078.047) (-2075.692) [-2082.752] -- 0:00:57
798800 -- (-2093.469) [-2074.179] (-2076.822) (-2082.984) * (-2075.262) [-2075.118] (-2071.096) (-2085.889) -- 0:00:57
798900 -- (-2092.483) (-2075.359) [-2080.783] (-2081.076) * (-2078.407) (-2080.384) [-2068.028] (-2077.975) -- 0:00:57
799000 -- (-2092.008) [-2078.157] (-2079.115) (-2084.661) * (-2076.164) (-2089.648) [-2079.276] (-2087.725) -- 0:00:57
Average standard deviation of split frequencies: 0.003320
799100 -- (-2083.831) [-2074.694] (-2080.775) (-2077.657) * (-2080.261) (-2090.859) [-2076.973] (-2088.883) -- 0:00:57
799200 -- (-2083.321) [-2074.388] (-2082.865) (-2088.344) * [-2080.024] (-2075.880) (-2077.185) (-2085.725) -- 0:00:57
799300 -- (-2083.074) [-2075.331] (-2076.625) (-2085.607) * (-2082.553) (-2075.411) (-2075.191) [-2076.995] -- 0:00:57
799400 -- (-2086.589) (-2072.153) [-2074.483] (-2083.792) * [-2073.838] (-2079.838) (-2078.689) (-2083.243) -- 0:00:57
799500 -- [-2081.012] (-2072.765) (-2075.557) (-2087.742) * (-2072.541) (-2080.448) [-2072.169] (-2077.097) -- 0:00:57
799600 -- (-2080.085) (-2074.166) [-2075.837] (-2089.500) * (-2073.217) (-2079.777) [-2077.353] (-2080.353) -- 0:00:57
799700 -- [-2084.555] (-2076.132) (-2082.351) (-2086.826) * (-2086.034) (-2080.070) [-2076.021] (-2078.292) -- 0:00:57
799800 -- (-2081.450) [-2072.999] (-2083.198) (-2089.629) * (-2083.225) [-2076.377] (-2075.635) (-2088.490) -- 0:00:57
799900 -- [-2077.667] (-2076.229) (-2081.320) (-2087.421) * (-2084.255) [-2076.022] (-2076.478) (-2095.361) -- 0:00:57
800000 -- [-2078.747] (-2073.466) (-2080.223) (-2086.872) * (-2091.769) [-2075.138] (-2077.076) (-2082.996) -- 0:00:57
Average standard deviation of split frequencies: 0.003383
800100 -- (-2077.818) (-2077.853) [-2073.116] (-2088.121) * (-2089.071) [-2076.854] (-2078.818) (-2079.402) -- 0:00:57
800200 -- (-2076.025) (-2075.804) [-2075.513] (-2084.819) * (-2090.760) (-2075.918) [-2070.835] (-2079.683) -- 0:00:57
800300 -- (-2078.782) (-2080.796) [-2072.902] (-2086.693) * (-2081.627) (-2075.672) [-2070.696] (-2084.861) -- 0:00:57
800400 -- (-2083.866) (-2073.701) [-2073.436] (-2084.478) * [-2077.698] (-2084.984) (-2075.156) (-2084.270) -- 0:00:57
800500 -- (-2079.341) [-2073.679] (-2075.957) (-2094.497) * [-2081.924] (-2081.571) (-2075.046) (-2083.455) -- 0:00:57
800600 -- (-2084.778) [-2073.315] (-2075.000) (-2092.139) * (-2081.529) (-2084.781) [-2072.033] (-2082.015) -- 0:00:57
800700 -- (-2079.461) [-2073.135] (-2074.002) (-2098.332) * (-2083.557) (-2078.231) [-2071.761] (-2082.959) -- 0:00:56
800800 -- (-2074.758) [-2077.454] (-2078.502) (-2093.057) * (-2082.210) (-2080.392) [-2070.018] (-2078.748) -- 0:00:56
800900 -- (-2081.643) [-2072.460] (-2081.980) (-2087.695) * (-2088.739) (-2080.209) [-2076.634] (-2081.597) -- 0:00:56
801000 -- (-2087.457) [-2076.626] (-2087.968) (-2106.833) * (-2076.989) (-2077.297) (-2080.514) [-2077.824] -- 0:00:56
Average standard deviation of split frequencies: 0.003261
801100 -- (-2093.488) [-2078.297] (-2087.344) (-2090.913) * (-2076.934) [-2076.325] (-2076.577) (-2084.223) -- 0:00:56
801200 -- (-2079.752) [-2081.167] (-2080.873) (-2091.298) * (-2077.379) (-2080.646) [-2073.178] (-2080.981) -- 0:00:56
801300 -- (-2079.464) (-2080.320) (-2084.223) [-2086.059] * (-2076.207) [-2083.439] (-2084.481) (-2078.654) -- 0:00:56
801400 -- (-2087.178) (-2072.563) [-2074.637] (-2083.347) * (-2077.061) (-2089.007) (-2089.208) [-2074.947] -- 0:00:56
801500 -- (-2090.381) [-2075.291] (-2081.867) (-2080.428) * (-2074.978) (-2092.326) [-2075.801] (-2081.758) -- 0:00:56
801600 -- (-2082.100) [-2076.970] (-2074.836) (-2088.736) * (-2080.300) (-2084.077) [-2067.402] (-2081.175) -- 0:00:56
801700 -- (-2078.137) [-2078.750] (-2080.815) (-2085.183) * (-2076.717) [-2074.252] (-2071.296) (-2082.741) -- 0:00:56
801800 -- (-2078.247) [-2069.783] (-2095.579) (-2086.142) * (-2076.684) (-2075.490) [-2072.793] (-2088.669) -- 0:00:56
801900 -- (-2079.324) [-2073.553] (-2086.483) (-2079.401) * (-2080.024) (-2083.165) [-2070.552] (-2081.141) -- 0:00:56
802000 -- (-2074.539) [-2070.389] (-2093.354) (-2083.057) * (-2082.740) [-2072.167] (-2071.963) (-2082.194) -- 0:00:56
Average standard deviation of split frequencies: 0.003358
802100 -- [-2074.265] (-2073.105) (-2082.947) (-2085.398) * (-2085.024) [-2074.743] (-2077.333) (-2086.878) -- 0:00:56
802200 -- [-2078.340] (-2074.121) (-2079.444) (-2075.892) * (-2074.013) (-2083.716) (-2078.868) [-2087.971] -- 0:00:56
802300 -- (-2080.607) [-2071.280] (-2091.971) (-2081.105) * [-2073.984] (-2074.916) (-2080.215) (-2082.494) -- 0:00:56
802400 -- (-2070.212) [-2074.598] (-2076.784) (-2074.736) * (-2080.079) [-2073.540] (-2074.549) (-2082.828) -- 0:00:56
802500 -- (-2070.737) [-2073.107] (-2079.840) (-2080.770) * (-2082.016) [-2076.277] (-2078.697) (-2088.167) -- 0:00:56
802600 -- [-2072.466] (-2077.007) (-2076.496) (-2082.760) * (-2087.097) [-2080.389] (-2077.966) (-2083.450) -- 0:00:56
802700 -- (-2074.404) (-2081.425) [-2073.316] (-2077.444) * [-2082.467] (-2076.831) (-2078.466) (-2086.792) -- 0:00:56
802800 -- (-2074.619) (-2074.812) [-2077.764] (-2078.005) * [-2073.840] (-2077.891) (-2081.305) (-2089.909) -- 0:00:56
802900 -- (-2070.495) [-2073.581] (-2086.475) (-2089.631) * (-2073.828) (-2083.938) [-2082.927] (-2088.557) -- 0:00:56
803000 -- (-2070.686) [-2069.896] (-2081.351) (-2083.336) * [-2077.251] (-2077.103) (-2079.403) (-2078.726) -- 0:00:56
Average standard deviation of split frequencies: 0.003404
803100 -- [-2072.279] (-2072.122) (-2076.256) (-2077.956) * [-2074.101] (-2072.609) (-2073.719) (-2083.387) -- 0:00:56
803200 -- (-2083.466) (-2072.421) (-2071.322) [-2079.732] * (-2081.277) (-2073.786) [-2074.229] (-2082.984) -- 0:00:56
803300 -- (-2082.320) [-2069.630] (-2070.890) (-2077.156) * (-2078.595) (-2073.421) [-2074.158] (-2084.024) -- 0:00:56
803400 -- (-2078.840) (-2068.074) [-2069.087] (-2081.310) * (-2077.287) (-2075.602) [-2073.877] (-2080.505) -- 0:00:56
803500 -- (-2083.056) (-2072.605) (-2070.285) [-2079.240] * (-2083.903) [-2071.548] (-2077.737) (-2085.139) -- 0:00:56
803600 -- (-2074.814) (-2071.880) [-2067.992] (-2080.892) * (-2085.629) [-2077.484] (-2083.136) (-2083.636) -- 0:00:56
803700 -- (-2072.926) (-2068.921) [-2071.366] (-2084.097) * (-2082.971) (-2072.696) [-2073.403] (-2092.540) -- 0:00:56
803800 -- (-2080.560) (-2071.482) (-2069.837) [-2074.806] * (-2085.047) [-2074.337] (-2072.139) (-2078.864) -- 0:00:56
803900 -- [-2077.545] (-2074.185) (-2076.392) (-2074.980) * (-2082.673) (-2085.109) [-2074.228] (-2084.046) -- 0:00:56
804000 -- (-2076.777) (-2079.427) [-2077.478] (-2078.327) * (-2087.522) (-2081.718) [-2077.288] (-2079.011) -- 0:00:56
Average standard deviation of split frequencies: 0.003383
804100 -- (-2075.425) (-2079.163) [-2074.679] (-2085.030) * (-2080.845) (-2078.845) [-2080.371] (-2083.224) -- 0:00:56
804200 -- (-2077.719) (-2074.574) [-2072.378] (-2089.901) * [-2081.994] (-2075.959) (-2080.370) (-2083.866) -- 0:00:55
804300 -- (-2075.663) (-2074.698) [-2071.097] (-2085.057) * (-2087.016) (-2082.784) [-2075.666] (-2091.111) -- 0:00:55
804400 -- (-2085.171) [-2075.861] (-2080.306) (-2096.597) * (-2084.495) (-2077.954) [-2073.461] (-2088.363) -- 0:00:55
804500 -- (-2084.954) (-2080.106) [-2074.522] (-2094.458) * (-2091.146) [-2080.245] (-2075.261) (-2078.284) -- 0:00:55
804600 -- (-2077.900) (-2073.657) [-2074.309] (-2078.567) * (-2083.389) [-2075.272] (-2079.644) (-2091.368) -- 0:00:55
804700 -- (-2073.786) [-2075.140] (-2078.975) (-2082.967) * (-2084.262) [-2080.320] (-2075.619) (-2089.330) -- 0:00:55
804800 -- [-2074.270] (-2077.860) (-2079.462) (-2075.964) * (-2080.379) (-2081.613) [-2076.156] (-2088.012) -- 0:00:55
804900 -- [-2077.351] (-2088.965) (-2078.182) (-2076.683) * (-2072.857) (-2075.933) [-2067.330] (-2076.182) -- 0:00:55
805000 -- (-2075.225) (-2080.765) [-2070.728] (-2078.179) * (-2085.984) (-2085.290) [-2066.808] (-2077.790) -- 0:00:55
Average standard deviation of split frequencies: 0.003312
805100 -- [-2074.045] (-2077.835) (-2088.107) (-2074.613) * (-2078.022) (-2085.055) [-2074.419] (-2080.016) -- 0:00:55
805200 -- (-2084.933) (-2067.665) (-2080.929) [-2077.934] * (-2073.528) [-2078.880] (-2075.518) (-2078.509) -- 0:00:55
805300 -- (-2072.393) [-2070.878] (-2080.956) (-2086.710) * (-2084.154) [-2077.268] (-2076.919) (-2083.824) -- 0:00:55
805400 -- [-2071.255] (-2083.669) (-2078.238) (-2079.461) * [-2074.984] (-2077.505) (-2076.183) (-2091.257) -- 0:00:55
805500 -- (-2072.757) (-2078.758) [-2072.350] (-2084.417) * [-2078.926] (-2079.718) (-2079.258) (-2088.324) -- 0:00:55
805600 -- [-2074.002] (-2080.505) (-2070.511) (-2075.045) * (-2076.393) [-2079.131] (-2083.073) (-2079.050) -- 0:00:55
805700 -- [-2073.692] (-2073.281) (-2067.265) (-2076.161) * (-2083.643) (-2079.964) (-2078.941) [-2080.468] -- 0:00:55
805800 -- (-2071.529) [-2081.056] (-2070.790) (-2076.773) * (-2085.022) (-2080.855) (-2079.466) [-2071.931] -- 0:00:55
805900 -- [-2072.351] (-2077.035) (-2072.317) (-2087.579) * [-2077.519] (-2072.932) (-2086.165) (-2076.408) -- 0:00:55
806000 -- (-2083.074) (-2086.542) [-2074.817] (-2085.777) * (-2077.267) (-2081.487) (-2084.032) [-2074.698] -- 0:00:55
Average standard deviation of split frequencies: 0.003258
806100 -- (-2081.232) (-2081.605) [-2073.131] (-2079.314) * (-2082.855) (-2075.209) (-2079.494) [-2078.076] -- 0:00:55
806200 -- (-2074.967) (-2077.640) [-2076.613] (-2077.575) * (-2083.524) (-2085.305) (-2077.452) [-2078.229] -- 0:00:55
806300 -- (-2080.102) (-2075.141) [-2072.615] (-2082.647) * (-2096.779) [-2077.423] (-2077.576) (-2081.008) -- 0:00:55
806400 -- (-2083.698) [-2073.470] (-2074.429) (-2085.497) * (-2089.021) (-2072.748) [-2071.104] (-2086.691) -- 0:00:55
806500 -- (-2085.057) [-2074.694] (-2074.537) (-2085.950) * (-2094.635) (-2077.294) [-2068.932] (-2075.088) -- 0:00:55
806600 -- (-2085.506) (-2071.176) [-2076.148] (-2086.267) * (-2083.597) (-2074.295) [-2074.359] (-2080.636) -- 0:00:55
806700 -- (-2085.644) (-2078.489) [-2074.634] (-2087.319) * (-2085.044) (-2077.467) (-2075.380) [-2074.068] -- 0:00:55
806800 -- (-2089.741) [-2078.703] (-2070.985) (-2087.207) * (-2092.030) (-2083.824) (-2074.653) [-2071.437] -- 0:00:55
806900 -- (-2094.374) (-2081.361) [-2073.194] (-2089.253) * (-2088.171) (-2081.192) (-2076.429) [-2075.175] -- 0:00:55
807000 -- [-2077.468] (-2080.781) (-2085.293) (-2090.602) * (-2087.767) (-2078.711) [-2076.234] (-2081.783) -- 0:00:55
Average standard deviation of split frequencies: 0.003304
807100 -- (-2078.760) [-2075.203] (-2076.145) (-2089.044) * (-2087.644) (-2080.590) [-2074.665] (-2085.113) -- 0:00:55
807200 -- (-2084.150) [-2071.655] (-2076.236) (-2091.583) * (-2087.001) (-2077.589) [-2072.231] (-2072.339) -- 0:00:55
807300 -- (-2077.538) [-2073.267] (-2073.983) (-2099.238) * [-2085.079] (-2079.636) (-2073.734) (-2083.651) -- 0:00:55
807400 -- (-2083.363) (-2071.873) [-2076.934] (-2086.685) * (-2085.032) (-2078.184) [-2071.152] (-2077.560) -- 0:00:55
807500 -- (-2089.302) [-2071.546] (-2077.834) (-2080.278) * (-2091.087) (-2079.043) [-2071.333] (-2079.805) -- 0:00:55
807600 -- (-2079.611) [-2072.063] (-2080.241) (-2083.981) * (-2092.667) (-2075.425) [-2075.767] (-2079.563) -- 0:00:55
807700 -- (-2079.229) [-2067.269] (-2083.129) (-2088.695) * (-2081.518) (-2077.241) [-2090.009] (-2082.562) -- 0:00:54
807800 -- (-2079.833) [-2073.583] (-2077.010) (-2085.161) * (-2085.894) (-2080.769) [-2074.867] (-2084.321) -- 0:00:54
807900 -- (-2090.515) [-2070.976] (-2084.573) (-2080.980) * (-2091.260) (-2075.841) (-2070.159) [-2075.256] -- 0:00:54
808000 -- (-2076.382) [-2075.315] (-2083.963) (-2084.442) * (-2090.199) (-2072.208) [-2070.533] (-2079.321) -- 0:00:54
Average standard deviation of split frequencies: 0.003333
808100 -- (-2081.688) [-2071.116] (-2074.574) (-2081.791) * (-2082.457) (-2074.449) [-2070.680] (-2082.773) -- 0:00:54
808200 -- (-2071.729) [-2070.526] (-2073.630) (-2084.570) * (-2086.974) (-2085.493) (-2072.528) [-2076.743] -- 0:00:54
808300 -- [-2073.854] (-2073.598) (-2077.420) (-2081.150) * (-2088.031) [-2085.107] (-2073.172) (-2083.007) -- 0:00:54
808400 -- (-2076.438) [-2072.504] (-2079.944) (-2089.300) * (-2103.318) (-2098.982) [-2076.518] (-2084.780) -- 0:00:54
808500 -- (-2076.697) [-2072.734] (-2083.897) (-2084.563) * (-2093.333) (-2085.822) [-2073.441] (-2082.866) -- 0:00:54
808600 -- [-2077.671] (-2072.890) (-2082.218) (-2083.890) * (-2080.173) (-2089.554) [-2071.047] (-2080.961) -- 0:00:54
808700 -- [-2082.203] (-2071.247) (-2074.898) (-2086.408) * (-2078.935) (-2080.110) [-2070.396] (-2084.148) -- 0:00:54
808800 -- (-2078.148) (-2072.550) [-2073.154] (-2091.476) * (-2079.401) (-2080.664) [-2068.858] (-2087.472) -- 0:00:54
808900 -- [-2084.309] (-2075.898) (-2070.379) (-2088.504) * (-2079.239) (-2077.197) [-2072.296] (-2076.334) -- 0:00:54
809000 -- (-2083.254) [-2068.807] (-2072.425) (-2085.655) * (-2079.485) (-2077.680) [-2071.782] (-2080.134) -- 0:00:54
Average standard deviation of split frequencies: 0.003512
809100 -- (-2085.492) [-2070.524] (-2073.823) (-2089.705) * (-2085.739) (-2087.690) [-2074.467] (-2098.128) -- 0:00:54
809200 -- (-2078.432) (-2077.113) [-2075.169] (-2088.022) * (-2091.972) (-2076.364) [-2073.163] (-2084.902) -- 0:00:54
809300 -- (-2088.992) [-2067.209] (-2079.707) (-2089.156) * (-2087.695) (-2076.499) [-2070.522] (-2086.569) -- 0:00:54
809400 -- (-2087.851) [-2071.183] (-2077.540) (-2083.222) * (-2088.665) [-2076.959] (-2073.527) (-2076.203) -- 0:00:54
809500 -- (-2080.926) [-2071.287] (-2083.386) (-2084.095) * (-2083.969) (-2075.324) [-2072.334] (-2079.863) -- 0:00:54
809600 -- [-2075.468] (-2072.824) (-2082.619) (-2079.474) * (-2086.475) (-2081.565) (-2075.240) [-2075.349] -- 0:00:54
809700 -- (-2079.890) [-2074.724] (-2077.276) (-2090.493) * (-2083.937) [-2074.749] (-2070.228) (-2083.305) -- 0:00:54
809800 -- (-2079.234) [-2069.130] (-2074.139) (-2083.397) * (-2077.616) [-2075.628] (-2073.668) (-2072.511) -- 0:00:54
809900 -- (-2080.969) [-2070.302] (-2081.601) (-2083.136) * (-2078.880) (-2075.503) [-2072.849] (-2078.814) -- 0:00:54
810000 -- (-2078.052) (-2072.655) [-2075.730] (-2083.478) * [-2075.095] (-2079.530) (-2074.024) (-2081.376) -- 0:00:54
Average standard deviation of split frequencies: 0.003591
810100 -- [-2073.706] (-2074.498) (-2078.687) (-2081.250) * (-2079.058) [-2071.749] (-2076.765) (-2081.751) -- 0:00:54
810200 -- (-2079.943) (-2070.716) [-2076.195] (-2080.202) * (-2079.352) (-2073.876) [-2075.183] (-2078.504) -- 0:00:54
810300 -- (-2080.309) [-2069.707] (-2075.394) (-2080.978) * [-2075.332] (-2074.788) (-2075.630) (-2077.032) -- 0:00:54
810400 -- (-2083.616) (-2075.883) [-2076.529] (-2087.809) * (-2080.403) (-2077.100) [-2071.242] (-2081.615) -- 0:00:54
810500 -- (-2078.930) (-2072.130) [-2073.846] (-2084.136) * (-2075.434) (-2073.929) [-2073.193] (-2087.933) -- 0:00:54
810600 -- (-2079.230) [-2076.020] (-2070.435) (-2082.581) * (-2077.158) [-2071.079] (-2075.107) (-2083.041) -- 0:00:54
810700 -- (-2085.277) [-2082.977] (-2072.579) (-2095.687) * [-2079.095] (-2078.253) (-2081.324) (-2084.080) -- 0:00:54
810800 -- (-2079.394) (-2083.770) [-2072.744] (-2085.452) * (-2080.654) (-2071.010) [-2080.807] (-2085.932) -- 0:00:54
810900 -- [-2075.975] (-2083.628) (-2085.229) (-2085.338) * (-2080.250) [-2070.996] (-2083.424) (-2085.420) -- 0:00:54
811000 -- (-2087.402) [-2074.723] (-2074.343) (-2083.242) * (-2075.359) [-2073.677] (-2086.477) (-2090.466) -- 0:00:54
Average standard deviation of split frequencies: 0.003503
811100 -- (-2088.035) [-2074.224] (-2082.582) (-2081.634) * (-2077.278) [-2070.018] (-2081.906) (-2078.715) -- 0:00:54
811200 -- (-2081.840) [-2076.052] (-2089.860) (-2081.663) * (-2082.412) [-2072.527] (-2076.109) (-2081.665) -- 0:00:53
811300 -- (-2090.213) [-2074.964] (-2078.003) (-2079.534) * (-2086.321) [-2075.995] (-2079.573) (-2080.353) -- 0:00:53
811400 -- (-2096.800) [-2076.303] (-2071.851) (-2079.075) * (-2087.858) [-2070.859] (-2075.174) (-2079.845) -- 0:00:53
811500 -- (-2093.050) (-2078.465) [-2071.334] (-2080.429) * (-2079.766) [-2070.588] (-2079.233) (-2080.974) -- 0:00:53
811600 -- (-2094.464) (-2085.189) [-2078.317] (-2081.861) * (-2083.323) [-2073.029] (-2093.060) (-2081.192) -- 0:00:53
811700 -- (-2097.433) (-2080.721) (-2077.138) [-2079.225] * (-2089.976) [-2069.008] (-2080.328) (-2079.588) -- 0:00:53
811800 -- (-2088.721) (-2076.178) (-2074.043) [-2080.138] * (-2080.575) (-2074.657) [-2075.427] (-2082.552) -- 0:00:53
811900 -- (-2087.221) (-2086.220) [-2074.653] (-2085.448) * (-2082.735) (-2074.832) (-2076.996) [-2072.549] -- 0:00:53
812000 -- (-2085.079) (-2078.131) [-2074.840] (-2079.326) * (-2093.131) (-2077.027) (-2077.753) [-2073.312] -- 0:00:53
Average standard deviation of split frequencies: 0.003317
812100 -- (-2083.539) (-2077.941) (-2069.719) [-2076.619] * (-2090.978) (-2068.722) (-2070.438) [-2074.426] -- 0:00:53
812200 -- (-2080.214) [-2074.649] (-2068.286) (-2083.405) * (-2087.332) (-2071.454) [-2075.238] (-2077.667) -- 0:00:53
812300 -- [-2076.242] (-2075.646) (-2073.187) (-2085.082) * (-2082.569) [-2073.100] (-2081.568) (-2077.194) -- 0:00:53
812400 -- (-2074.836) (-2080.008) [-2070.339] (-2079.096) * (-2082.543) (-2071.727) (-2077.856) [-2076.188] -- 0:00:53
812500 -- (-2079.620) [-2083.203] (-2078.005) (-2082.724) * (-2080.607) [-2069.238] (-2081.746) (-2078.931) -- 0:00:53
812600 -- (-2083.237) [-2077.428] (-2079.077) (-2073.086) * (-2084.404) [-2077.349] (-2087.624) (-2075.842) -- 0:00:53
812700 -- (-2089.035) (-2077.542) [-2074.186] (-2076.662) * (-2096.050) [-2079.509] (-2083.519) (-2081.382) -- 0:00:53
812800 -- (-2092.457) (-2074.469) [-2071.102] (-2079.501) * (-2098.307) (-2082.174) [-2079.786] (-2079.506) -- 0:00:53
812900 -- (-2092.615) [-2073.367] (-2076.167) (-2078.891) * (-2083.722) [-2071.852] (-2077.162) (-2081.875) -- 0:00:53
813000 -- (-2084.324) (-2078.275) (-2082.019) [-2079.934] * (-2083.638) [-2073.905] (-2078.254) (-2083.152) -- 0:00:53
Average standard deviation of split frequencies: 0.003230
813100 -- [-2079.664] (-2076.295) (-2080.340) (-2080.281) * (-2086.353) [-2075.684] (-2075.784) (-2090.210) -- 0:00:53
813200 -- [-2079.240] (-2082.021) (-2084.608) (-2080.515) * [-2081.170] (-2084.635) (-2079.466) (-2082.307) -- 0:00:53
813300 -- (-2083.746) [-2076.996] (-2082.940) (-2082.640) * (-2078.950) (-2082.658) [-2079.338] (-2083.871) -- 0:00:53
813400 -- (-2080.580) [-2073.730] (-2082.623) (-2077.776) * [-2074.710] (-2074.384) (-2079.068) (-2088.500) -- 0:00:53
813500 -- (-2077.079) (-2094.260) [-2074.889] (-2083.906) * [-2082.109] (-2074.838) (-2079.416) (-2088.703) -- 0:00:53
813600 -- (-2081.610) (-2078.125) [-2077.471] (-2081.656) * (-2081.966) [-2072.267] (-2076.638) (-2085.759) -- 0:00:53
813700 -- [-2081.752] (-2077.466) (-2077.625) (-2083.391) * (-2090.118) [-2075.889] (-2087.512) (-2084.508) -- 0:00:53
813800 -- (-2090.026) [-2077.017] (-2074.518) (-2083.903) * (-2086.577) [-2068.933] (-2083.336) (-2091.063) -- 0:00:53
813900 -- (-2083.267) (-2078.655) [-2080.740] (-2089.561) * (-2080.918) [-2070.061] (-2083.529) (-2087.200) -- 0:00:53
814000 -- [-2082.357] (-2081.986) (-2089.347) (-2082.956) * (-2081.164) [-2068.014] (-2084.583) (-2082.306) -- 0:00:53
Average standard deviation of split frequencies: 0.003243
814100 -- (-2090.568) (-2082.812) [-2076.177] (-2086.986) * (-2081.440) [-2071.743] (-2078.158) (-2091.173) -- 0:00:53
814200 -- (-2087.779) [-2081.466] (-2087.512) (-2083.989) * (-2073.778) [-2070.270] (-2079.682) (-2085.820) -- 0:00:53
814300 -- [-2077.075] (-2076.703) (-2073.985) (-2084.976) * [-2076.037] (-2077.504) (-2088.554) (-2081.049) -- 0:00:53
814400 -- (-2078.656) (-2075.212) [-2076.276] (-2083.427) * (-2086.370) [-2074.907] (-2084.411) (-2080.530) -- 0:00:53
814500 -- (-2083.421) [-2074.782] (-2078.682) (-2081.564) * (-2085.239) (-2075.430) (-2085.026) [-2078.605] -- 0:00:53
814600 -- (-2089.997) [-2073.850] (-2073.216) (-2080.453) * (-2087.724) [-2073.879] (-2079.352) (-2077.530) -- 0:00:53
814700 -- (-2076.041) [-2071.987] (-2073.738) (-2105.596) * (-2076.733) (-2073.707) (-2079.288) [-2076.779] -- 0:00:52
814800 -- (-2080.186) [-2068.920] (-2071.169) (-2092.419) * [-2072.040] (-2084.869) (-2077.721) (-2095.473) -- 0:00:52
814900 -- (-2080.856) [-2072.587] (-2073.289) (-2098.989) * [-2079.034] (-2075.001) (-2081.005) (-2086.676) -- 0:00:52
815000 -- (-2084.310) [-2072.673] (-2071.144) (-2093.126) * (-2076.780) (-2076.806) [-2077.488] (-2078.506) -- 0:00:52
Average standard deviation of split frequencies: 0.003271
815100 -- (-2082.938) (-2081.726) [-2070.878] (-2087.046) * (-2077.667) [-2076.458] (-2077.081) (-2081.764) -- 0:00:52
815200 -- (-2092.913) (-2071.805) [-2078.758] (-2085.542) * (-2079.107) [-2075.254] (-2083.812) (-2093.735) -- 0:00:52
815300 -- (-2103.221) (-2077.326) [-2077.269] (-2093.252) * (-2077.120) (-2075.500) [-2072.313] (-2080.120) -- 0:00:52
815400 -- (-2087.706) (-2082.245) [-2077.255] (-2091.108) * (-2077.172) (-2079.919) [-2076.780] (-2078.965) -- 0:00:52
815500 -- (-2087.150) [-2072.677] (-2076.178) (-2092.417) * (-2087.434) (-2088.691) (-2083.427) [-2078.027] -- 0:00:52
815600 -- (-2077.615) (-2075.617) [-2070.552] (-2094.798) * (-2092.544) (-2092.744) (-2083.439) [-2074.927] -- 0:00:52
815700 -- (-2079.179) [-2073.414] (-2076.354) (-2089.459) * (-2084.681) [-2078.588] (-2084.366) (-2084.278) -- 0:00:52
815800 -- (-2075.122) [-2069.436] (-2087.024) (-2086.704) * (-2080.470) (-2078.658) [-2073.862] (-2083.984) -- 0:00:52
815900 -- (-2075.711) [-2078.882] (-2076.104) (-2078.039) * (-2081.030) (-2077.832) (-2083.278) [-2082.995] -- 0:00:52
816000 -- (-2076.356) (-2080.412) [-2078.639] (-2092.589) * (-2080.146) [-2073.519] (-2083.594) (-2085.975) -- 0:00:52
Average standard deviation of split frequencies: 0.003070
816100 -- [-2074.254] (-2078.278) (-2078.133) (-2104.435) * (-2083.099) [-2076.283] (-2087.777) (-2087.273) -- 0:00:52
816200 -- [-2076.495] (-2075.604) (-2076.224) (-2088.648) * [-2080.846] (-2081.540) (-2087.171) (-2080.532) -- 0:00:52
816300 -- (-2085.604) [-2072.180] (-2077.942) (-2083.910) * (-2078.671) [-2073.013] (-2082.490) (-2089.202) -- 0:00:52
816400 -- (-2081.353) [-2075.289] (-2076.332) (-2081.812) * (-2077.635) [-2079.630] (-2079.874) (-2081.872) -- 0:00:52
816500 -- (-2083.071) [-2072.310] (-2075.120) (-2080.637) * [-2079.074] (-2074.506) (-2081.898) (-2086.622) -- 0:00:52
816600 -- (-2078.911) (-2073.572) [-2072.320] (-2081.839) * (-2080.116) (-2070.452) (-2084.712) [-2076.419] -- 0:00:52
816700 -- (-2080.534) (-2072.025) [-2068.876] (-2083.918) * (-2086.227) [-2071.329] (-2088.712) (-2076.039) -- 0:00:52
816800 -- (-2076.459) [-2072.444] (-2071.304) (-2103.791) * (-2080.868) [-2073.096] (-2085.379) (-2078.960) -- 0:00:52
816900 -- [-2071.132] (-2072.752) (-2081.144) (-2087.020) * (-2085.320) [-2076.229] (-2084.475) (-2075.468) -- 0:00:52
817000 -- (-2075.139) [-2066.944] (-2087.610) (-2080.060) * (-2077.825) [-2073.087] (-2081.797) (-2076.037) -- 0:00:52
Average standard deviation of split frequencies: 0.002868
817100 -- (-2076.135) (-2070.557) (-2087.090) [-2075.159] * [-2078.699] (-2077.691) (-2091.046) (-2085.369) -- 0:00:52
817200 -- (-2076.148) [-2071.540] (-2079.453) (-2081.629) * (-2087.787) (-2075.807) (-2079.216) [-2079.773] -- 0:00:52
817300 -- (-2080.084) (-2077.654) [-2076.136] (-2090.591) * (-2083.664) [-2079.732] (-2084.601) (-2090.238) -- 0:00:52
817400 -- (-2075.630) (-2072.945) [-2074.909] (-2084.021) * [-2082.264] (-2078.819) (-2084.944) (-2090.407) -- 0:00:52
817500 -- (-2082.757) [-2072.698] (-2079.632) (-2083.790) * (-2082.402) [-2074.837] (-2097.418) (-2087.375) -- 0:00:52
817600 -- (-2080.135) [-2073.448] (-2084.021) (-2096.113) * (-2076.691) [-2072.534] (-2077.100) (-2084.308) -- 0:00:52
817700 -- (-2077.793) [-2071.128] (-2085.829) (-2083.940) * [-2076.755] (-2081.089) (-2079.692) (-2080.594) -- 0:00:52
817800 -- (-2086.391) (-2073.942) (-2081.502) [-2075.730] * [-2080.359] (-2080.804) (-2080.785) (-2083.468) -- 0:00:52
817900 -- (-2088.295) [-2069.946] (-2076.060) (-2084.360) * [-2076.885] (-2086.424) (-2085.104) (-2079.649) -- 0:00:52
818000 -- (-2081.056) [-2070.223] (-2075.058) (-2072.352) * [-2075.534] (-2077.293) (-2082.157) (-2089.913) -- 0:00:52
Average standard deviation of split frequencies: 0.002980
818100 -- (-2088.700) (-2071.293) [-2076.919] (-2078.152) * (-2074.348) [-2074.905] (-2083.564) (-2083.335) -- 0:00:52
818200 -- (-2078.869) [-2072.069] (-2077.112) (-2074.723) * (-2075.100) (-2078.860) [-2079.046] (-2093.321) -- 0:00:51
818300 -- (-2082.834) [-2072.546] (-2076.131) (-2080.837) * [-2078.894] (-2077.582) (-2097.772) (-2088.436) -- 0:00:51
818400 -- (-2085.938) (-2084.990) (-2072.047) [-2078.244] * (-2076.543) [-2075.408] (-2094.247) (-2084.670) -- 0:00:51
818500 -- (-2083.616) (-2071.095) [-2069.188] (-2081.334) * [-2078.567] (-2080.651) (-2093.673) (-2084.724) -- 0:00:51
818600 -- (-2081.367) [-2070.345] (-2072.344) (-2082.653) * (-2078.961) (-2079.185) (-2077.349) [-2076.203] -- 0:00:51
818700 -- (-2084.951) [-2075.149] (-2068.507) (-2081.386) * (-2078.245) (-2084.269) [-2075.869] (-2081.721) -- 0:00:51
818800 -- (-2091.915) (-2073.600) [-2076.737] (-2082.099) * (-2082.793) (-2082.662) (-2081.227) [-2075.656] -- 0:00:51
818900 -- (-2087.204) (-2074.537) [-2073.286] (-2076.863) * (-2076.048) (-2090.497) [-2078.736] (-2077.818) -- 0:00:51
819000 -- (-2082.875) (-2072.010) (-2072.151) [-2074.916] * (-2074.702) (-2082.809) [-2079.091] (-2084.783) -- 0:00:51
Average standard deviation of split frequencies: 0.002976
819100 -- (-2080.637) (-2078.583) [-2072.011] (-2081.725) * [-2073.220] (-2080.242) (-2095.276) (-2083.936) -- 0:00:51
819200 -- (-2082.275) [-2071.022] (-2076.395) (-2085.276) * (-2084.923) (-2075.362) (-2088.154) [-2076.271] -- 0:00:51
819300 -- (-2077.706) (-2067.539) [-2072.648] (-2085.058) * [-2081.378] (-2081.192) (-2090.256) (-2078.851) -- 0:00:51
819400 -- (-2078.442) [-2068.150] (-2077.886) (-2096.687) * (-2081.725) [-2074.896] (-2085.710) (-2075.564) -- 0:00:51
819500 -- (-2090.063) (-2068.721) [-2073.169] (-2090.251) * (-2074.826) [-2073.503] (-2087.459) (-2075.682) -- 0:00:51
819600 -- (-2086.256) [-2071.873] (-2086.367) (-2093.491) * (-2079.379) [-2076.009] (-2088.340) (-2075.692) -- 0:00:51
819700 -- (-2078.311) [-2071.337] (-2084.896) (-2086.614) * (-2074.010) [-2077.136] (-2092.730) (-2085.785) -- 0:00:51
819800 -- (-2080.714) [-2069.363] (-2079.740) (-2085.997) * (-2079.320) [-2072.499] (-2093.254) (-2090.849) -- 0:00:51
819900 -- (-2083.572) (-2083.399) [-2076.703] (-2079.925) * (-2083.251) [-2073.156] (-2074.578) (-2083.779) -- 0:00:51
820000 -- (-2089.061) (-2078.339) [-2072.246] (-2081.835) * (-2089.859) (-2079.321) [-2078.775] (-2083.269) -- 0:00:51
Average standard deviation of split frequencies: 0.002956
820100 -- (-2088.383) (-2081.317) [-2070.668] (-2091.587) * (-2084.026) (-2086.528) (-2076.839) [-2076.725] -- 0:00:51
820200 -- (-2083.323) (-2074.983) [-2073.144] (-2087.553) * [-2077.873] (-2088.960) (-2089.442) (-2077.734) -- 0:00:51
820300 -- (-2079.275) (-2075.101) [-2075.842] (-2083.134) * [-2073.068] (-2088.862) (-2075.602) (-2081.519) -- 0:00:51
820400 -- [-2074.171] (-2076.839) (-2078.103) (-2090.112) * [-2076.255] (-2078.167) (-2076.100) (-2083.976) -- 0:00:51
820500 -- (-2082.958) [-2073.332] (-2077.082) (-2082.777) * (-2081.801) [-2079.269] (-2079.799) (-2083.759) -- 0:00:51
820600 -- (-2078.077) (-2074.232) [-2079.267] (-2085.133) * [-2081.900] (-2078.019) (-2081.205) (-2087.140) -- 0:00:51
820700 -- (-2080.856) (-2072.311) [-2071.040] (-2090.644) * [-2077.293] (-2073.126) (-2086.754) (-2088.906) -- 0:00:51
820800 -- (-2090.223) [-2072.391] (-2070.453) (-2084.638) * (-2079.587) [-2072.412] (-2085.392) (-2089.319) -- 0:00:51
820900 -- (-2087.186) (-2066.763) (-2069.499) [-2076.190] * (-2081.440) [-2074.839] (-2082.209) (-2086.347) -- 0:00:51
821000 -- (-2076.387) (-2072.863) (-2068.927) [-2075.320] * [-2077.935] (-2074.752) (-2082.003) (-2085.565) -- 0:00:51
Average standard deviation of split frequencies: 0.002952
821100 -- (-2079.713) (-2069.832) (-2091.026) [-2080.723] * [-2079.989] (-2077.791) (-2083.788) (-2088.875) -- 0:00:51
821200 -- (-2082.748) (-2076.736) (-2080.091) [-2075.817] * [-2074.348] (-2077.888) (-2092.573) (-2086.219) -- 0:00:51
821300 -- (-2086.797) (-2079.181) [-2073.106] (-2076.094) * (-2081.023) [-2075.586] (-2084.426) (-2081.330) -- 0:00:51
821400 -- (-2076.104) [-2073.660] (-2075.584) (-2074.565) * [-2076.728] (-2076.539) (-2073.462) (-2087.521) -- 0:00:51
821500 -- (-2079.079) (-2076.727) [-2071.821] (-2075.452) * [-2075.640] (-2074.960) (-2077.994) (-2084.283) -- 0:00:51
821600 -- [-2071.152] (-2076.898) (-2081.680) (-2080.503) * (-2076.639) [-2072.835] (-2081.769) (-2081.676) -- 0:00:51
821700 -- [-2072.400] (-2069.705) (-2078.230) (-2082.187) * (-2073.755) (-2071.471) [-2087.666] (-2082.829) -- 0:00:50
821800 -- (-2079.068) [-2072.045] (-2075.044) (-2078.767) * (-2072.279) [-2074.207] (-2080.670) (-2089.818) -- 0:00:50
821900 -- (-2080.460) (-2073.300) [-2072.583] (-2082.889) * (-2071.121) [-2071.884] (-2085.976) (-2087.131) -- 0:00:50
822000 -- (-2081.995) [-2073.774] (-2082.115) (-2090.793) * [-2073.079] (-2072.090) (-2090.182) (-2081.929) -- 0:00:50
Average standard deviation of split frequencies: 0.003162
822100 -- (-2083.703) (-2080.815) (-2082.972) [-2078.992] * (-2078.676) [-2069.119] (-2090.543) (-2082.043) -- 0:00:50
822200 -- [-2076.906] (-2077.120) (-2079.116) (-2079.372) * (-2072.215) [-2072.101] (-2096.200) (-2089.369) -- 0:00:50
822300 -- [-2074.908] (-2077.760) (-2080.067) (-2081.303) * (-2069.337) [-2078.711] (-2086.035) (-2085.341) -- 0:00:50
822400 -- [-2075.480] (-2070.624) (-2077.604) (-2071.813) * (-2070.376) (-2081.516) [-2075.570] (-2080.673) -- 0:00:50
822500 -- (-2086.491) (-2071.509) (-2079.469) [-2079.194] * [-2071.510] (-2077.142) (-2085.917) (-2085.077) -- 0:00:50
822600 -- (-2079.196) (-2075.726) (-2080.425) [-2077.737] * (-2072.466) [-2071.928] (-2076.211) (-2087.672) -- 0:00:50
822700 -- (-2087.134) (-2084.645) (-2085.648) [-2076.453] * (-2075.624) (-2074.007) [-2075.914] (-2079.200) -- 0:00:50
822800 -- (-2086.458) (-2079.169) (-2082.074) [-2073.605] * (-2073.477) [-2072.546] (-2076.341) (-2076.028) -- 0:00:50
822900 -- (-2085.061) [-2077.258] (-2083.028) (-2076.277) * (-2084.160) [-2071.649] (-2082.294) (-2080.724) -- 0:00:50
823000 -- (-2083.282) [-2077.985] (-2091.200) (-2076.650) * (-2076.302) [-2073.566] (-2092.942) (-2072.885) -- 0:00:50
Average standard deviation of split frequencies: 0.003125
823100 -- (-2077.370) [-2075.876] (-2083.761) (-2077.543) * (-2075.059) (-2085.939) (-2097.497) [-2073.440] -- 0:00:50
823200 -- (-2076.680) (-2078.465) (-2083.733) [-2077.895] * (-2078.859) [-2075.361] (-2081.274) (-2071.192) -- 0:00:50
823300 -- [-2081.826] (-2077.375) (-2077.939) (-2074.305) * (-2086.876) [-2071.602] (-2078.050) (-2080.116) -- 0:00:50
823400 -- (-2081.413) [-2077.618] (-2085.297) (-2075.050) * (-2081.788) [-2075.663] (-2072.137) (-2078.813) -- 0:00:50
823500 -- (-2080.187) (-2072.789) (-2077.387) [-2074.776] * (-2074.393) [-2073.490] (-2081.568) (-2075.989) -- 0:00:50
823600 -- (-2080.495) [-2075.092] (-2084.001) (-2075.636) * (-2081.865) [-2068.594] (-2077.093) (-2076.432) -- 0:00:50
823700 -- (-2079.929) [-2070.524] (-2079.633) (-2080.143) * (-2080.941) [-2069.213] (-2077.056) (-2082.127) -- 0:00:50
823800 -- (-2084.689) [-2073.215] (-2080.807) (-2080.555) * (-2074.557) (-2072.927) [-2070.717] (-2078.184) -- 0:00:50
823900 -- (-2081.953) [-2075.910] (-2079.421) (-2082.556) * (-2071.287) [-2072.114] (-2077.213) (-2080.560) -- 0:00:50
824000 -- (-2077.815) [-2079.270] (-2080.321) (-2089.901) * [-2080.233] (-2076.066) (-2081.726) (-2081.174) -- 0:00:50
Average standard deviation of split frequencies: 0.003138
824100 -- [-2073.133] (-2086.978) (-2083.184) (-2083.782) * [-2076.698] (-2076.526) (-2077.368) (-2081.582) -- 0:00:50
824200 -- [-2073.970] (-2078.582) (-2080.443) (-2086.254) * (-2075.328) (-2074.257) [-2078.001] (-2084.818) -- 0:00:50
824300 -- [-2073.073] (-2078.591) (-2073.516) (-2079.681) * (-2076.654) [-2068.391] (-2075.109) (-2078.559) -- 0:00:50
824400 -- [-2071.849] (-2083.734) (-2073.243) (-2078.477) * (-2082.441) [-2068.552] (-2072.312) (-2079.342) -- 0:00:50
824500 -- (-2074.244) [-2086.709] (-2072.873) (-2077.757) * (-2077.500) [-2078.515] (-2079.479) (-2087.160) -- 0:00:50
824600 -- (-2076.869) (-2094.052) [-2070.005] (-2083.788) * (-2075.526) [-2068.412] (-2074.366) (-2085.586) -- 0:00:50
824700 -- [-2076.055] (-2089.835) (-2082.710) (-2077.238) * (-2081.306) (-2068.209) [-2076.594] (-2098.794) -- 0:00:50
824800 -- (-2076.365) (-2084.061) (-2077.729) [-2079.977] * [-2081.786] (-2072.500) (-2072.272) (-2083.528) -- 0:00:50
824900 -- (-2074.272) (-2091.454) [-2076.584] (-2082.542) * (-2076.899) (-2076.524) [-2073.261] (-2086.863) -- 0:00:50
825000 -- [-2078.221] (-2085.813) (-2071.222) (-2078.700) * [-2079.138] (-2072.504) (-2078.807) (-2079.538) -- 0:00:50
Average standard deviation of split frequencies: 0.003134
825100 -- [-2080.150] (-2080.771) (-2074.714) (-2079.974) * (-2070.516) (-2073.308) [-2072.784] (-2078.073) -- 0:00:50
825200 -- (-2081.928) (-2082.978) [-2073.776] (-2080.341) * (-2073.113) (-2072.096) [-2070.125] (-2084.663) -- 0:00:49
825300 -- [-2079.968] (-2078.999) (-2072.896) (-2084.293) * (-2073.498) [-2069.802] (-2073.865) (-2083.099) -- 0:00:49
825400 -- (-2082.722) (-2075.549) (-2073.791) [-2076.972] * [-2067.745] (-2070.859) (-2073.783) (-2080.061) -- 0:00:49
825500 -- (-2088.519) (-2084.166) (-2073.516) [-2073.787] * [-2075.478] (-2078.201) (-2078.353) (-2078.115) -- 0:00:49
825600 -- (-2090.446) (-2082.829) [-2076.005] (-2083.801) * [-2073.189] (-2076.211) (-2074.658) (-2074.732) -- 0:00:49
825700 -- (-2086.332) (-2084.063) [-2070.834] (-2080.436) * (-2067.840) [-2076.176] (-2077.400) (-2079.869) -- 0:00:49
825800 -- (-2087.695) (-2083.132) [-2072.987] (-2080.513) * (-2076.666) [-2074.123] (-2079.326) (-2082.729) -- 0:00:49
825900 -- (-2084.335) (-2082.288) (-2076.598) [-2076.294] * [-2074.833] (-2075.607) (-2082.182) (-2092.505) -- 0:00:49
826000 -- (-2080.884) [-2080.304] (-2077.240) (-2080.169) * (-2072.528) (-2075.704) [-2078.033] (-2083.008) -- 0:00:49
Average standard deviation of split frequencies: 0.003081
826100 -- (-2079.883) (-2081.138) [-2070.866] (-2076.186) * [-2075.061] (-2074.939) (-2077.905) (-2088.527) -- 0:00:49
826200 -- (-2079.590) (-2082.278) [-2082.340] (-2077.571) * [-2075.641] (-2078.321) (-2077.194) (-2084.818) -- 0:00:49
826300 -- (-2081.636) [-2076.014] (-2081.762) (-2076.732) * (-2070.926) (-2085.316) [-2076.708] (-2083.039) -- 0:00:49
826400 -- (-2075.822) (-2075.017) [-2072.949] (-2082.069) * [-2070.502] (-2086.798) (-2086.993) (-2085.511) -- 0:00:49
826500 -- (-2072.208) [-2075.427] (-2082.100) (-2079.699) * [-2068.542] (-2089.952) (-2076.320) (-2099.573) -- 0:00:49
826600 -- (-2076.534) (-2078.026) (-2078.100) [-2076.835] * [-2068.966] (-2092.510) (-2085.508) (-2095.411) -- 0:00:49
826700 -- (-2083.282) (-2079.070) [-2078.059] (-2080.662) * [-2068.870] (-2083.568) (-2084.769) (-2085.801) -- 0:00:49
826800 -- (-2086.066) (-2081.066) [-2084.855] (-2083.725) * (-2076.635) (-2079.830) (-2080.719) [-2079.011] -- 0:00:49
826900 -- (-2088.864) [-2083.066] (-2076.898) (-2084.994) * [-2072.405] (-2076.133) (-2077.139) (-2085.396) -- 0:00:49
827000 -- (-2084.517) (-2077.219) (-2080.099) [-2078.470] * [-2068.473] (-2079.777) (-2083.309) (-2080.407) -- 0:00:49
Average standard deviation of split frequencies: 0.003094
827100 -- (-2081.582) (-2083.340) [-2075.058] (-2078.898) * [-2070.785] (-2072.260) (-2082.740) (-2089.621) -- 0:00:49
827200 -- (-2081.859) [-2083.609] (-2074.801) (-2079.699) * [-2069.794] (-2073.529) (-2079.393) (-2083.187) -- 0:00:49
827300 -- (-2079.185) (-2082.602) [-2074.615] (-2081.140) * [-2071.572] (-2073.656) (-2079.667) (-2081.673) -- 0:00:49
827400 -- (-2078.276) (-2084.291) [-2072.332] (-2076.221) * (-2077.997) [-2080.431] (-2088.256) (-2083.106) -- 0:00:49
827500 -- (-2079.786) (-2082.197) [-2076.966] (-2074.600) * [-2074.608] (-2080.241) (-2083.065) (-2083.609) -- 0:00:49
827600 -- [-2076.484] (-2095.838) (-2075.341) (-2077.768) * (-2075.269) (-2076.489) (-2088.391) [-2080.333] -- 0:00:49
827700 -- [-2079.226] (-2084.133) (-2081.356) (-2076.345) * (-2074.190) (-2081.668) [-2074.386] (-2086.032) -- 0:00:49
827800 -- (-2076.870) (-2086.266) [-2076.781] (-2078.537) * (-2077.314) [-2078.832] (-2079.285) (-2078.925) -- 0:00:49
827900 -- (-2083.571) (-2079.071) [-2076.821] (-2074.115) * (-2084.005) [-2077.813] (-2076.107) (-2077.065) -- 0:00:49
828000 -- (-2084.878) (-2081.610) [-2075.881] (-2076.107) * (-2078.077) [-2075.253] (-2079.738) (-2084.182) -- 0:00:49
Average standard deviation of split frequencies: 0.003155
828100 -- (-2080.631) (-2082.682) (-2081.209) [-2079.057] * (-2084.027) [-2074.114] (-2089.034) (-2077.137) -- 0:00:49
828200 -- (-2085.847) (-2081.080) (-2083.801) [-2072.109] * [-2081.058] (-2079.434) (-2079.541) (-2084.233) -- 0:00:49
828300 -- (-2076.550) [-2073.786] (-2079.715) (-2078.112) * (-2092.048) [-2074.381] (-2082.618) (-2086.986) -- 0:00:49
828400 -- [-2078.487] (-2078.415) (-2072.729) (-2074.122) * (-2084.612) [-2076.743] (-2083.501) (-2078.668) -- 0:00:49
828500 -- (-2083.112) (-2080.067) (-2073.669) [-2073.389] * (-2077.083) (-2078.902) (-2085.302) [-2074.908] -- 0:00:49
828600 -- [-2074.655] (-2078.213) (-2075.248) (-2075.879) * (-2079.959) (-2078.942) (-2090.783) [-2083.093] -- 0:00:49
828700 -- [-2077.797] (-2071.875) (-2079.327) (-2077.349) * (-2073.622) (-2080.170) [-2079.239] (-2088.146) -- 0:00:48
828800 -- (-2079.407) [-2071.808] (-2074.478) (-2091.845) * [-2070.643] (-2074.647) (-2089.136) (-2079.270) -- 0:00:48
828900 -- (-2077.126) (-2074.124) [-2076.095] (-2082.972) * [-2073.726] (-2078.192) (-2087.506) (-2081.357) -- 0:00:48
829000 -- (-2078.069) [-2074.104] (-2078.309) (-2087.633) * (-2070.022) (-2080.318) (-2085.541) [-2080.232] -- 0:00:48
Average standard deviation of split frequencies: 0.003330
829100 -- [-2076.876] (-2078.415) (-2084.170) (-2100.235) * [-2075.159] (-2078.627) (-2081.163) (-2084.716) -- 0:00:48
829200 -- (-2077.411) (-2083.174) [-2076.760] (-2095.510) * (-2074.357) [-2073.622] (-2080.338) (-2084.720) -- 0:00:48
829300 -- (-2085.789) (-2082.911) [-2079.951] (-2095.172) * (-2074.895) (-2077.564) (-2087.915) [-2081.850] -- 0:00:48
829400 -- (-2081.910) [-2075.049] (-2075.278) (-2081.427) * [-2073.862] (-2079.536) (-2076.360) (-2086.389) -- 0:00:48
829500 -- (-2080.648) [-2075.554] (-2077.917) (-2076.567) * (-2082.690) [-2073.949] (-2084.057) (-2081.581) -- 0:00:48
829600 -- [-2077.510] (-2074.885) (-2073.510) (-2078.155) * [-2069.904] (-2073.357) (-2086.265) (-2082.963) -- 0:00:48
829700 -- [-2074.751] (-2078.396) (-2073.947) (-2079.875) * [-2071.659] (-2076.612) (-2085.761) (-2080.663) -- 0:00:48
829800 -- (-2075.812) (-2074.083) [-2070.784] (-2086.907) * (-2072.958) (-2076.545) [-2079.606] (-2080.281) -- 0:00:48
829900 -- (-2080.155) (-2088.127) [-2075.046] (-2081.462) * [-2077.464] (-2081.306) (-2091.113) (-2079.234) -- 0:00:48
830000 -- (-2082.050) (-2089.042) [-2075.872] (-2091.293) * [-2074.268] (-2072.183) (-2079.207) (-2081.001) -- 0:00:48
Average standard deviation of split frequencies: 0.003537
830100 -- [-2078.320] (-2093.028) (-2076.468) (-2086.478) * [-2074.711] (-2079.119) (-2089.766) (-2075.814) -- 0:00:48
830200 -- (-2090.869) (-2091.161) [-2073.496] (-2085.461) * (-2075.409) (-2086.701) [-2077.895] (-2074.632) -- 0:00:48
830300 -- (-2084.538) (-2076.512) (-2072.894) [-2076.536] * (-2087.629) (-2088.223) (-2088.978) [-2069.100] -- 0:00:48
830400 -- (-2090.428) [-2071.911] (-2076.473) (-2086.190) * (-2079.926) (-2083.134) (-2084.097) [-2068.389] -- 0:00:48
830500 -- (-2084.328) (-2079.786) [-2075.332] (-2084.954) * (-2086.486) (-2078.499) (-2084.017) [-2077.748] -- 0:00:48
830600 -- [-2077.379] (-2081.969) (-2074.960) (-2081.294) * (-2076.759) [-2074.061] (-2084.018) (-2077.445) -- 0:00:48
830700 -- [-2074.550] (-2081.786) (-2084.551) (-2077.916) * (-2074.172) [-2077.670] (-2089.214) (-2082.634) -- 0:00:48
830800 -- (-2072.629) (-2080.185) [-2078.426] (-2083.700) * (-2083.078) (-2073.924) (-2086.133) [-2079.371] -- 0:00:48
830900 -- (-2074.416) [-2077.186] (-2072.260) (-2082.213) * (-2086.975) [-2075.907] (-2091.620) (-2070.330) -- 0:00:48
831000 -- (-2079.892) [-2076.669] (-2075.275) (-2078.907) * (-2079.106) (-2075.757) (-2080.426) [-2069.071] -- 0:00:48
Average standard deviation of split frequencies: 0.003678
831100 -- (-2088.755) (-2077.142) [-2074.552] (-2078.046) * (-2081.423) (-2074.895) (-2083.493) [-2075.005] -- 0:00:48
831200 -- (-2089.557) (-2080.632) (-2077.963) [-2078.971] * (-2085.431) [-2073.686] (-2091.639) (-2072.752) -- 0:00:48
831300 -- (-2081.986) (-2077.728) [-2069.120] (-2081.283) * (-2087.811) (-2078.116) (-2085.104) [-2072.911] -- 0:00:48
831400 -- (-2081.998) (-2095.758) [-2072.156] (-2080.428) * (-2076.377) [-2072.895] (-2087.079) (-2075.988) -- 0:00:48
831500 -- (-2084.595) (-2089.213) [-2066.948] (-2083.368) * (-2080.316) (-2079.052) (-2088.023) [-2070.788] -- 0:00:48
831600 -- (-2080.742) (-2078.720) [-2070.800] (-2082.673) * (-2080.059) (-2077.426) (-2087.689) [-2072.899] -- 0:00:48
831700 -- (-2079.942) (-2072.385) (-2078.404) [-2079.682] * (-2082.920) (-2077.006) (-2081.381) [-2072.434] -- 0:00:48
831800 -- (-2085.387) [-2072.711] (-2071.047) (-2076.097) * [-2073.475] (-2072.984) (-2085.298) (-2075.162) -- 0:00:48
831900 -- (-2090.203) (-2082.407) (-2075.804) [-2076.509] * (-2075.075) [-2075.430] (-2092.146) (-2073.454) -- 0:00:48
832000 -- (-2088.140) (-2077.845) [-2073.204] (-2080.623) * (-2078.513) (-2075.916) (-2093.519) [-2075.722] -- 0:00:48
Average standard deviation of split frequencies: 0.003658
832100 -- (-2090.400) [-2082.218] (-2072.320) (-2076.317) * (-2081.764) (-2080.532) (-2092.064) [-2075.639] -- 0:00:48
832200 -- (-2086.115) (-2080.771) [-2071.516] (-2074.584) * (-2076.538) (-2080.998) (-2085.667) [-2074.594] -- 0:00:47
832300 -- (-2094.302) (-2087.190) (-2074.309) [-2075.818] * (-2078.466) (-2077.650) (-2086.241) [-2071.256] -- 0:00:47
832400 -- (-2086.790) (-2090.483) (-2072.031) [-2076.932] * (-2076.153) (-2086.430) [-2083.725] (-2076.096) -- 0:00:47
832500 -- (-2088.984) (-2089.688) [-2074.476] (-2082.150) * [-2074.291] (-2085.111) (-2090.623) (-2074.275) -- 0:00:47
832600 -- (-2077.710) (-2083.925) [-2072.800] (-2079.616) * [-2072.435] (-2080.800) (-2090.009) (-2075.603) -- 0:00:47
832700 -- (-2084.045) (-2079.741) [-2071.122] (-2094.437) * [-2073.152] (-2079.012) (-2082.044) (-2077.897) -- 0:00:47
832800 -- (-2080.279) (-2083.611) [-2070.810] (-2082.074) * (-2079.084) (-2076.781) (-2080.030) [-2074.805] -- 0:00:47
832900 -- (-2089.012) (-2085.381) [-2069.260] (-2083.390) * [-2075.316] (-2079.384) (-2080.128) (-2074.048) -- 0:00:47
833000 -- (-2088.782) (-2083.452) [-2070.727] (-2083.291) * (-2078.079) [-2083.489] (-2076.635) (-2083.068) -- 0:00:47
Average standard deviation of split frequencies: 0.003556
833100 -- (-2085.534) (-2089.552) [-2069.182] (-2082.402) * (-2088.268) [-2075.310] (-2083.191) (-2081.310) -- 0:00:47
833200 -- (-2091.021) (-2084.612) [-2067.928] (-2076.989) * (-2084.286) [-2075.477] (-2088.685) (-2078.496) -- 0:00:47
833300 -- (-2077.352) (-2083.879) [-2067.956] (-2082.206) * (-2079.799) [-2069.857] (-2081.029) (-2081.562) -- 0:00:47
833400 -- (-2080.937) (-2082.360) [-2068.615] (-2093.801) * (-2080.100) (-2074.798) (-2082.347) [-2076.174] -- 0:00:47
833500 -- (-2079.956) (-2080.107) [-2073.500] (-2093.756) * (-2086.793) [-2073.494] (-2088.616) (-2089.879) -- 0:00:47
833600 -- [-2073.798] (-2084.063) (-2077.432) (-2088.019) * (-2076.740) (-2075.712) (-2084.616) [-2078.969] -- 0:00:47
833700 -- (-2074.907) (-2078.466) [-2069.063] (-2083.933) * (-2075.547) (-2081.532) (-2078.675) [-2079.117] -- 0:00:47
833800 -- (-2090.277) (-2092.868) [-2074.336] (-2077.412) * (-2081.770) [-2076.165] (-2082.010) (-2084.353) -- 0:00:47
833900 -- (-2085.212) (-2094.926) [-2073.178] (-2075.086) * (-2080.479) [-2075.163] (-2083.704) (-2086.147) -- 0:00:47
834000 -- (-2082.744) (-2086.086) [-2072.783] (-2082.563) * (-2079.637) (-2079.172) (-2086.864) [-2076.428] -- 0:00:47
Average standard deviation of split frequencies: 0.003633
834100 -- (-2081.686) (-2093.661) [-2076.460] (-2079.021) * [-2077.884] (-2070.221) (-2083.144) (-2075.512) -- 0:00:47
834200 -- (-2081.992) (-2086.738) [-2079.932] (-2075.126) * [-2074.737] (-2069.925) (-2077.362) (-2079.002) -- 0:00:47
834300 -- (-2076.215) (-2090.835) (-2075.464) [-2074.050] * [-2073.859] (-2078.980) (-2076.519) (-2074.300) -- 0:00:47
834400 -- (-2087.853) (-2079.111) (-2080.822) [-2080.729] * (-2078.365) (-2082.208) (-2084.836) [-2069.748] -- 0:00:47
834500 -- (-2089.504) (-2078.254) [-2071.168] (-2084.836) * (-2074.895) (-2075.928) (-2086.300) [-2069.247] -- 0:00:47
834600 -- (-2082.449) (-2084.882) [-2074.516] (-2077.367) * (-2073.005) (-2087.171) (-2087.167) [-2071.160] -- 0:00:47
834700 -- (-2077.893) (-2088.822) (-2079.467) [-2082.063] * (-2087.600) (-2083.687) [-2086.326] (-2070.110) -- 0:00:47
834800 -- [-2077.665] (-2085.852) (-2074.824) (-2083.990) * [-2067.551] (-2080.589) (-2082.628) (-2085.711) -- 0:00:47
834900 -- (-2082.008) (-2097.691) [-2074.721] (-2082.391) * [-2071.976] (-2084.419) (-2081.427) (-2081.059) -- 0:00:47
835000 -- (-2084.294) (-2096.741) (-2072.235) [-2083.165] * (-2076.216) (-2084.452) [-2076.130] (-2072.876) -- 0:00:47
Average standard deviation of split frequencies: 0.003435
835100 -- (-2085.171) (-2091.913) [-2077.542] (-2079.603) * (-2073.219) (-2088.693) (-2081.840) [-2073.132] -- 0:00:47
835200 -- (-2089.609) (-2076.021) (-2075.919) [-2076.187] * [-2071.765] (-2078.404) (-2080.016) (-2077.081) -- 0:00:47
835300 -- (-2094.291) (-2081.767) [-2071.561] (-2087.807) * [-2071.424] (-2076.787) (-2073.357) (-2078.178) -- 0:00:47
835400 -- (-2082.744) (-2078.000) (-2072.932) [-2078.064] * [-2074.325] (-2080.314) (-2075.509) (-2075.983) -- 0:00:47
835500 -- (-2083.559) (-2083.388) [-2069.223] (-2087.510) * [-2076.963] (-2079.127) (-2074.456) (-2075.327) -- 0:00:47
835600 -- (-2090.850) (-2083.837) [-2076.743] (-2081.500) * [-2075.122] (-2084.346) (-2085.049) (-2075.230) -- 0:00:47
835700 -- [-2079.060] (-2087.664) (-2073.233) (-2085.152) * (-2077.414) (-2088.311) (-2083.744) [-2070.270] -- 0:00:46
835800 -- [-2076.721] (-2087.783) (-2070.943) (-2085.126) * [-2066.441] (-2091.235) (-2083.423) (-2072.584) -- 0:00:46
835900 -- (-2083.120) (-2086.332) [-2074.752] (-2079.542) * (-2070.410) (-2079.644) (-2090.782) [-2073.537] -- 0:00:46
836000 -- (-2087.825) (-2083.235) [-2068.586] (-2080.373) * [-2068.649] (-2078.495) (-2081.091) (-2072.941) -- 0:00:46
Average standard deviation of split frequencies: 0.003383
836100 -- (-2088.301) (-2079.233) (-2070.081) [-2073.846] * (-2074.587) (-2072.737) (-2083.081) [-2069.867] -- 0:00:46
836200 -- (-2086.287) (-2081.161) [-2068.826] (-2077.502) * [-2070.535] (-2072.628) (-2079.630) (-2077.626) -- 0:00:47
836300 -- (-2083.548) (-2082.398) [-2070.127] (-2079.011) * (-2081.499) [-2076.289] (-2079.860) (-2074.219) -- 0:00:46
836400 -- (-2077.378) (-2083.730) [-2072.580] (-2074.619) * (-2072.257) (-2085.390) (-2080.745) [-2069.367] -- 0:00:46
836500 -- (-2077.549) (-2079.107) (-2081.151) [-2075.810] * (-2069.422) (-2078.106) (-2082.283) [-2072.271] -- 0:00:46
836600 -- (-2073.809) (-2075.414) [-2076.341] (-2077.866) * (-2070.933) [-2075.362] (-2076.774) (-2074.823) -- 0:00:46
836700 -- (-2074.404) (-2078.170) [-2073.138] (-2077.625) * (-2085.771) (-2075.488) (-2077.053) [-2073.374] -- 0:00:46
836800 -- (-2086.696) (-2092.596) [-2072.375] (-2082.157) * (-2079.215) (-2075.633) (-2073.907) [-2068.929] -- 0:00:46
836900 -- [-2076.843] (-2082.948) (-2077.830) (-2082.794) * (-2082.303) (-2070.458) [-2072.775] (-2076.084) -- 0:00:46
837000 -- (-2076.328) [-2077.401] (-2076.242) (-2088.854) * (-2077.600) (-2075.379) [-2075.927] (-2079.059) -- 0:00:46
Average standard deviation of split frequencies: 0.003443
837100 -- (-2076.579) (-2081.789) (-2089.786) [-2079.170] * [-2074.872] (-2075.860) (-2076.360) (-2075.883) -- 0:00:46
837200 -- (-2085.336) [-2078.550] (-2086.875) (-2080.160) * (-2078.281) (-2073.008) [-2078.446] (-2077.853) -- 0:00:46
837300 -- (-2083.033) (-2075.055) (-2078.760) [-2079.883] * (-2078.266) [-2071.604] (-2088.449) (-2075.078) -- 0:00:46
837400 -- (-2079.981) (-2081.793) (-2078.572) [-2077.688] * (-2072.725) (-2079.856) (-2091.077) [-2072.925] -- 0:00:46
837500 -- (-2083.124) (-2086.776) (-2080.159) [-2080.029] * (-2079.142) (-2081.624) (-2095.867) [-2068.474] -- 0:00:46
837600 -- (-2079.396) (-2084.552) (-2077.170) [-2074.072] * (-2084.702) (-2075.359) (-2081.106) [-2081.530] -- 0:00:46
837700 -- (-2089.193) (-2078.321) [-2072.555] (-2073.617) * (-2083.900) [-2071.434] (-2087.008) (-2077.717) -- 0:00:46
837800 -- (-2088.317) (-2083.652) [-2075.221] (-2077.788) * (-2077.581) (-2081.735) [-2082.060] (-2075.224) -- 0:00:46
837900 -- (-2087.289) (-2082.996) [-2076.989] (-2079.477) * (-2077.862) [-2073.327] (-2078.004) (-2078.743) -- 0:00:46
838000 -- (-2078.861) (-2080.310) [-2076.417] (-2089.381) * (-2076.900) [-2069.086] (-2079.291) (-2084.158) -- 0:00:46
Average standard deviation of split frequencies: 0.003391
838100 -- (-2075.158) (-2076.888) [-2077.046] (-2084.102) * (-2079.646) [-2072.463] (-2078.751) (-2081.531) -- 0:00:46
838200 -- (-2077.921) (-2084.723) (-2080.499) [-2080.439] * (-2082.914) [-2072.614] (-2085.628) (-2075.551) -- 0:00:46
838300 -- (-2080.980) [-2085.689] (-2075.785) (-2086.710) * (-2086.089) [-2076.308] (-2081.981) (-2074.151) -- 0:00:46
838400 -- (-2084.472) (-2078.632) (-2073.870) [-2076.154] * [-2076.830] (-2080.509) (-2089.540) (-2072.931) -- 0:00:46
838500 -- (-2103.288) (-2075.732) [-2067.007] (-2078.258) * (-2080.889) (-2076.618) (-2087.863) [-2074.543] -- 0:00:46
838600 -- (-2092.051) (-2080.519) [-2070.129] (-2079.770) * (-2086.125) (-2084.789) [-2081.448] (-2073.469) -- 0:00:46
838700 -- (-2086.321) (-2089.022) (-2073.988) [-2079.228] * (-2077.368) (-2073.760) (-2092.096) [-2073.043] -- 0:00:46
838800 -- (-2098.035) (-2086.276) [-2071.000] (-2077.152) * (-2078.927) (-2076.170) (-2085.562) [-2071.735] -- 0:00:46
838900 -- (-2089.998) (-2076.817) [-2071.958] (-2087.450) * (-2082.393) [-2074.990] (-2081.642) (-2075.511) -- 0:00:46
839000 -- (-2087.498) (-2081.599) [-2068.292] (-2079.393) * (-2084.897) (-2071.627) (-2088.205) [-2072.257] -- 0:00:46
Average standard deviation of split frequencies: 0.003242
839100 -- (-2083.410) (-2079.066) [-2069.102] (-2082.504) * (-2079.036) (-2072.357) (-2086.792) [-2070.327] -- 0:00:46
839200 -- (-2081.729) (-2077.032) [-2069.569] (-2074.615) * (-2074.845) [-2074.038] (-2086.922) (-2072.141) -- 0:00:45
839300 -- (-2082.466) (-2079.300) (-2076.510) [-2076.266] * (-2080.886) (-2083.033) [-2073.761] (-2069.430) -- 0:00:45
839400 -- (-2081.893) [-2074.918] (-2074.651) (-2075.667) * (-2081.514) (-2072.317) [-2076.173] (-2075.356) -- 0:00:45
839500 -- (-2077.591) (-2074.173) [-2088.278] (-2086.043) * (-2084.932) [-2074.760] (-2078.497) (-2071.412) -- 0:00:45
839600 -- (-2093.023) (-2078.235) [-2085.000] (-2093.356) * (-2081.913) [-2075.878] (-2085.578) (-2076.797) -- 0:00:46
839700 -- (-2083.628) (-2074.603) [-2080.548] (-2093.164) * [-2076.155] (-2084.558) (-2080.386) (-2073.064) -- 0:00:46
839800 -- [-2074.268] (-2074.545) (-2098.062) (-2089.136) * (-2077.604) (-2079.499) [-2076.220] (-2079.315) -- 0:00:45
839900 -- (-2077.722) [-2073.304] (-2080.279) (-2082.630) * (-2084.477) (-2081.247) [-2077.178] (-2082.366) -- 0:00:45
840000 -- (-2075.794) [-2080.655] (-2072.147) (-2088.143) * [-2076.784] (-2081.623) (-2080.048) (-2084.061) -- 0:00:45
Average standard deviation of split frequencies: 0.003190
840100 -- [-2080.433] (-2080.424) (-2070.277) (-2089.727) * [-2071.784] (-2083.284) (-2079.824) (-2079.842) -- 0:00:45
840200 -- (-2079.535) (-2082.833) [-2070.773] (-2092.948) * (-2079.688) [-2071.431] (-2086.214) (-2072.072) -- 0:00:45
840300 -- (-2082.458) (-2080.459) [-2072.553] (-2097.926) * (-2075.530) [-2070.255] (-2080.944) (-2073.919) -- 0:00:45
840400 -- (-2090.779) (-2076.504) [-2070.770] (-2095.879) * [-2077.610] (-2072.981) (-2086.595) (-2078.234) -- 0:00:45
840500 -- (-2086.584) (-2086.711) [-2071.305] (-2082.927) * (-2074.992) (-2073.476) (-2091.195) [-2072.524] -- 0:00:45
840600 -- (-2080.533) (-2084.233) [-2071.961] (-2083.906) * (-2077.484) (-2073.548) (-2090.084) [-2072.976] -- 0:00:45
840700 -- (-2079.534) (-2082.341) [-2074.450] (-2079.053) * (-2077.748) (-2073.914) (-2079.699) [-2075.009] -- 0:00:45
840800 -- (-2078.895) (-2089.969) [-2068.796] (-2088.625) * (-2081.511) [-2072.057] (-2092.239) (-2071.146) -- 0:00:45
840900 -- (-2083.706) (-2084.055) [-2076.603] (-2080.927) * (-2078.523) (-2073.300) (-2087.345) [-2071.975] -- 0:00:45
841000 -- [-2081.895] (-2082.771) (-2077.438) (-2078.279) * (-2072.459) (-2074.840) (-2079.003) [-2073.922] -- 0:00:45
Average standard deviation of split frequencies: 0.003250
841100 -- (-2077.419) [-2080.254] (-2083.636) (-2080.833) * [-2072.115] (-2082.201) (-2079.035) (-2079.241) -- 0:00:45
841200 -- (-2080.448) (-2077.632) [-2074.861] (-2093.538) * (-2071.767) (-2080.939) (-2079.273) [-2066.485] -- 0:00:45
841300 -- [-2077.807] (-2079.268) (-2082.367) (-2091.984) * (-2075.808) (-2074.261) (-2078.419) [-2072.083] -- 0:00:45
841400 -- (-2084.667) [-2074.234] (-2084.514) (-2075.976) * (-2076.530) (-2079.681) (-2085.449) [-2072.480] -- 0:00:45
841500 -- (-2079.784) [-2073.553] (-2079.989) (-2077.854) * [-2076.358] (-2072.378) (-2083.054) (-2071.972) -- 0:00:45
841600 -- (-2082.990) (-2078.188) (-2079.900) [-2074.639] * (-2075.267) (-2074.232) (-2077.511) [-2074.626] -- 0:00:45
841700 -- (-2081.613) (-2086.153) (-2084.740) [-2076.809] * (-2078.960) (-2075.236) (-2082.199) [-2075.134] -- 0:00:45
841800 -- (-2090.514) (-2085.087) (-2091.328) [-2074.211] * (-2089.180) (-2076.563) [-2082.498] (-2075.222) -- 0:00:45
841900 -- (-2087.753) (-2078.650) (-2088.350) [-2076.576] * (-2093.849) (-2081.729) (-2086.777) [-2074.308] -- 0:00:45
842000 -- (-2082.370) (-2078.935) (-2083.866) [-2076.852] * (-2090.276) (-2082.402) (-2084.048) [-2075.036] -- 0:00:45
Average standard deviation of split frequencies: 0.003151
842100 -- [-2076.216] (-2071.764) (-2086.532) (-2082.572) * (-2088.417) [-2074.615] (-2083.910) (-2079.987) -- 0:00:45
842200 -- (-2076.806) [-2070.868] (-2085.035) (-2080.853) * [-2079.366] (-2072.183) (-2087.054) (-2076.111) -- 0:00:45
842300 -- (-2083.746) [-2069.370] (-2081.373) (-2079.524) * (-2086.109) [-2075.713] (-2092.915) (-2071.752) -- 0:00:45
842400 -- (-2090.481) [-2071.936] (-2083.236) (-2078.501) * (-2090.237) [-2075.482] (-2088.835) (-2072.674) -- 0:00:45
842500 -- [-2075.286] (-2072.587) (-2079.823) (-2084.418) * (-2092.811) (-2079.718) (-2095.959) [-2072.903] -- 0:00:45
842600 -- (-2080.638) (-2068.736) [-2077.226] (-2084.739) * (-2075.047) [-2075.601] (-2095.981) (-2073.752) -- 0:00:45
842700 -- [-2076.498] (-2068.800) (-2075.348) (-2082.496) * (-2079.691) [-2074.384] (-2084.251) (-2072.647) -- 0:00:44
842800 -- (-2078.592) [-2075.088] (-2076.856) (-2097.054) * (-2084.071) (-2078.733) (-2099.348) [-2071.357] -- 0:00:44
842900 -- (-2073.933) (-2073.532) [-2075.142] (-2092.980) * [-2080.178] (-2079.357) (-2098.540) (-2071.909) -- 0:00:44
843000 -- (-2077.062) (-2075.921) [-2075.034] (-2088.131) * (-2072.516) (-2075.625) (-2087.720) [-2077.655] -- 0:00:45
Average standard deviation of split frequencies: 0.003163
843100 -- (-2075.435) (-2076.455) [-2078.504] (-2091.832) * (-2076.235) [-2067.339] (-2082.012) (-2082.666) -- 0:00:45
843200 -- (-2083.439) (-2078.335) [-2077.065] (-2092.112) * (-2070.846) [-2070.455] (-2088.179) (-2075.939) -- 0:00:45
843300 -- (-2086.618) (-2072.310) [-2079.975] (-2092.839) * (-2075.833) [-2067.746] (-2087.863) (-2072.984) -- 0:00:44
843400 -- [-2074.462] (-2073.281) (-2083.754) (-2087.644) * (-2071.636) [-2069.140] (-2085.661) (-2072.688) -- 0:00:44
843500 -- (-2082.068) [-2069.569] (-2078.720) (-2089.006) * (-2070.470) [-2075.160] (-2091.009) (-2078.940) -- 0:00:44
843600 -- (-2086.944) [-2072.142] (-2073.053) (-2081.318) * (-2071.753) (-2074.660) (-2085.037) [-2078.906] -- 0:00:44
843700 -- (-2081.802) [-2068.746] (-2078.573) (-2083.974) * [-2070.672] (-2074.225) (-2084.943) (-2085.168) -- 0:00:44
843800 -- [-2071.817] (-2073.198) (-2074.229) (-2078.888) * [-2075.139] (-2073.853) (-2085.782) (-2077.476) -- 0:00:44
843900 -- (-2073.423) (-2083.508) [-2080.992] (-2078.412) * [-2068.307] (-2070.125) (-2085.506) (-2073.346) -- 0:00:44
844000 -- (-2071.680) [-2071.973] (-2076.388) (-2081.766) * [-2073.194] (-2072.115) (-2085.153) (-2072.928) -- 0:00:44
Average standard deviation of split frequencies: 0.003223
844100 -- [-2069.322] (-2073.987) (-2082.520) (-2086.510) * (-2080.997) [-2068.203] (-2095.152) (-2080.435) -- 0:00:44
844200 -- [-2072.155] (-2074.135) (-2082.715) (-2080.958) * (-2085.848) [-2070.283] (-2082.312) (-2076.285) -- 0:00:44
844300 -- [-2068.533] (-2075.534) (-2076.508) (-2088.348) * (-2079.774) (-2069.997) [-2080.339] (-2082.961) -- 0:00:44
844400 -- (-2077.600) [-2074.792] (-2074.922) (-2084.401) * (-2083.746) [-2069.481] (-2083.401) (-2079.640) -- 0:00:44
844500 -- (-2078.934) [-2077.188] (-2075.238) (-2075.670) * (-2076.060) [-2070.771] (-2075.484) (-2075.924) -- 0:00:44
844600 -- (-2078.118) (-2072.679) [-2074.401] (-2075.457) * [-2072.593] (-2073.904) (-2088.629) (-2078.875) -- 0:00:44
844700 -- [-2073.292] (-2085.753) (-2072.092) (-2078.131) * (-2074.477) (-2077.168) (-2075.711) [-2070.467] -- 0:00:44
844800 -- [-2068.881] (-2082.859) (-2072.656) (-2081.865) * (-2068.804) (-2075.890) (-2083.991) [-2072.292] -- 0:00:44
844900 -- (-2074.288) (-2081.991) [-2075.147] (-2082.145) * (-2074.885) [-2073.186] (-2080.329) (-2076.147) -- 0:00:44
845000 -- (-2078.305) (-2082.870) [-2076.841] (-2085.437) * (-2081.840) [-2072.340] (-2078.432) (-2076.384) -- 0:00:44
Average standard deviation of split frequencies: 0.003267
845100 -- [-2070.598] (-2077.069) (-2072.904) (-2081.618) * (-2072.473) [-2068.925] (-2074.535) (-2082.510) -- 0:00:44
845200 -- (-2071.409) (-2075.895) [-2068.672] (-2086.114) * (-2073.071) [-2071.431] (-2079.111) (-2075.194) -- 0:00:44
845300 -- [-2073.281] (-2075.644) (-2075.925) (-2086.401) * (-2072.388) [-2073.251] (-2093.825) (-2071.354) -- 0:00:44
845400 -- [-2073.227] (-2083.891) (-2078.806) (-2094.417) * (-2074.068) (-2071.827) (-2088.951) [-2073.178] -- 0:00:44
845500 -- (-2074.506) [-2072.500] (-2075.582) (-2093.399) * (-2081.133) [-2074.403] (-2077.347) (-2077.722) -- 0:00:44
845600 -- (-2076.004) [-2075.495] (-2083.204) (-2084.248) * (-2078.485) (-2081.718) (-2074.807) [-2072.308] -- 0:00:44
845700 -- (-2075.039) [-2075.215] (-2084.069) (-2087.770) * (-2078.402) [-2075.128] (-2078.925) (-2075.395) -- 0:00:44
845800 -- [-2073.783] (-2073.566) (-2080.577) (-2084.909) * [-2071.729] (-2081.603) (-2080.154) (-2080.191) -- 0:00:44
845900 -- [-2072.234] (-2072.845) (-2076.505) (-2076.089) * [-2073.560] (-2086.506) (-2084.554) (-2085.269) -- 0:00:44
846000 -- [-2073.225] (-2069.172) (-2080.679) (-2082.581) * (-2069.479) (-2083.119) [-2082.904] (-2076.962) -- 0:00:44
Average standard deviation of split frequencies: 0.003215
846100 -- [-2078.617] (-2071.507) (-2077.568) (-2084.119) * [-2074.074] (-2079.668) (-2089.877) (-2083.530) -- 0:00:44
846200 -- [-2082.288] (-2081.615) (-2077.638) (-2089.424) * (-2076.383) [-2071.428] (-2079.006) (-2079.060) -- 0:00:43
846300 -- (-2085.752) [-2072.675] (-2070.274) (-2076.874) * (-2076.687) (-2073.704) [-2073.344] (-2078.895) -- 0:00:43
846400 -- (-2079.812) (-2074.320) [-2068.218] (-2079.872) * (-2081.767) [-2072.306] (-2074.317) (-2074.306) -- 0:00:44
846500 -- (-2077.063) (-2074.230) [-2074.856] (-2080.655) * (-2081.526) (-2072.078) (-2078.371) [-2067.426] -- 0:00:44
846600 -- (-2083.941) (-2078.388) [-2077.064] (-2090.729) * (-2080.257) (-2085.594) (-2080.900) [-2077.545] -- 0:00:44
846700 -- [-2075.503] (-2079.304) (-2081.791) (-2089.630) * (-2074.584) (-2074.310) [-2076.195] (-2073.312) -- 0:00:43
846800 -- (-2078.316) (-2078.254) [-2082.247] (-2086.527) * (-2076.239) (-2073.483) (-2087.245) [-2073.458] -- 0:00:43
846900 -- (-2076.097) (-2085.522) [-2073.650] (-2088.524) * (-2075.224) (-2077.790) (-2089.605) [-2070.450] -- 0:00:43
847000 -- (-2080.254) [-2082.792] (-2073.126) (-2090.707) * (-2081.807) (-2077.112) (-2082.014) [-2073.572] -- 0:00:43
Average standard deviation of split frequencies: 0.003195
847100 -- (-2079.807) (-2091.555) [-2074.782] (-2079.964) * (-2080.327) [-2068.836] (-2079.249) (-2078.387) -- 0:00:43
847200 -- [-2077.681] (-2083.783) (-2069.772) (-2078.452) * (-2075.389) [-2067.542] (-2079.458) (-2079.099) -- 0:00:43
847300 -- [-2074.278] (-2084.036) (-2078.348) (-2079.700) * (-2076.540) (-2068.973) [-2075.717] (-2071.688) -- 0:00:43
847400 -- (-2068.710) (-2075.465) [-2073.409] (-2084.949) * (-2072.685) (-2067.756) (-2081.741) [-2067.485] -- 0:00:43
847500 -- (-2071.755) (-2086.372) [-2069.942] (-2082.349) * [-2070.650] (-2078.032) (-2082.062) (-2075.322) -- 0:00:43
847600 -- [-2071.659] (-2075.782) (-2070.512) (-2079.780) * (-2071.890) (-2080.738) (-2084.784) [-2071.231] -- 0:00:43
847700 -- (-2071.112) (-2084.364) [-2070.376] (-2079.397) * [-2070.943] (-2068.113) (-2095.403) (-2070.026) -- 0:00:43
847800 -- (-2069.816) (-2079.551) [-2074.483] (-2088.744) * (-2072.451) (-2072.269) (-2084.336) [-2068.694] -- 0:00:43
847900 -- (-2070.499) (-2083.682) [-2071.776] (-2096.423) * (-2070.238) [-2077.421] (-2090.823) (-2080.098) -- 0:00:43
848000 -- (-2079.893) [-2074.712] (-2076.726) (-2088.228) * (-2081.111) [-2075.098] (-2098.596) (-2071.422) -- 0:00:43
Average standard deviation of split frequencies: 0.003303
848100 -- (-2071.999) (-2095.874) [-2069.252] (-2087.985) * (-2077.111) (-2071.344) (-2101.152) [-2072.162] -- 0:00:43
848200 -- (-2072.572) (-2080.644) [-2070.275] (-2087.083) * (-2080.952) (-2072.914) (-2086.743) [-2072.162] -- 0:00:43
848300 -- [-2077.322] (-2082.547) (-2077.288) (-2083.619) * [-2074.421] (-2072.817) (-2094.968) (-2074.720) -- 0:00:43
848400 -- (-2068.518) (-2073.764) [-2072.492] (-2080.419) * [-2073.341] (-2070.859) (-2088.064) (-2077.512) -- 0:00:43
848500 -- [-2071.591] (-2079.640) (-2075.628) (-2081.375) * (-2076.185) (-2081.815) (-2081.826) [-2072.028] -- 0:00:43
848600 -- (-2072.112) [-2075.728] (-2070.142) (-2084.220) * [-2076.570] (-2084.664) (-2079.229) (-2068.758) -- 0:00:43
848700 -- (-2081.664) [-2074.286] (-2069.168) (-2079.788) * (-2071.879) (-2081.422) (-2078.271) [-2069.484] -- 0:00:43
848800 -- (-2072.058) (-2078.248) [-2068.109] (-2085.580) * (-2068.468) [-2074.277] (-2081.881) (-2067.441) -- 0:00:43
848900 -- [-2071.369] (-2086.134) (-2069.988) (-2089.818) * (-2075.923) (-2073.358) (-2091.586) [-2072.638] -- 0:00:43
849000 -- [-2071.804] (-2082.726) (-2069.827) (-2085.657) * [-2074.602] (-2073.909) (-2088.000) (-2070.341) -- 0:00:43
Average standard deviation of split frequencies: 0.003410
849100 -- (-2073.700) (-2081.010) [-2073.413] (-2076.708) * [-2073.072] (-2074.993) (-2086.501) (-2071.761) -- 0:00:43
849200 -- (-2073.805) (-2079.563) (-2071.589) [-2075.871] * [-2070.432] (-2075.001) (-2086.663) (-2082.391) -- 0:00:43
849300 -- (-2079.613) (-2079.017) [-2070.447] (-2074.973) * [-2069.500] (-2091.445) (-2081.069) (-2076.938) -- 0:00:43
849400 -- (-2076.898) [-2073.994] (-2072.818) (-2078.509) * [-2069.454] (-2088.776) (-2078.565) (-2075.865) -- 0:00:43
849500 -- (-2077.650) (-2081.748) (-2072.541) [-2073.838] * (-2073.148) (-2085.835) (-2079.441) [-2070.588] -- 0:00:43
849600 -- (-2085.796) [-2078.139] (-2071.884) (-2070.223) * (-2072.373) (-2084.417) (-2080.153) [-2074.095] -- 0:00:43
849700 -- (-2091.602) (-2079.242) [-2070.303] (-2068.699) * (-2072.509) (-2077.714) (-2078.029) [-2074.868] -- 0:00:42
849800 -- (-2073.170) (-2073.563) (-2074.532) [-2069.601] * (-2082.041) (-2070.419) [-2075.157] (-2076.140) -- 0:00:43
849900 -- (-2073.101) (-2075.600) [-2074.451] (-2071.981) * (-2075.472) [-2071.201] (-2078.915) (-2082.256) -- 0:00:43
850000 -- (-2081.014) (-2081.009) (-2076.658) [-2069.803] * [-2076.761] (-2070.377) (-2081.484) (-2070.770) -- 0:00:43
Average standard deviation of split frequencies: 0.003517
850100 -- (-2075.535) (-2079.286) [-2068.818] (-2070.669) * [-2075.543] (-2073.549) (-2089.772) (-2067.356) -- 0:00:43
850200 -- (-2077.179) (-2081.966) [-2069.400] (-2074.978) * (-2088.112) (-2076.820) (-2085.924) [-2074.055] -- 0:00:42
850300 -- (-2077.634) [-2080.680] (-2078.771) (-2070.499) * (-2077.479) (-2074.993) (-2087.166) [-2074.408] -- 0:00:42
850400 -- (-2084.182) (-2081.031) (-2068.141) [-2070.531] * [-2074.266] (-2072.732) (-2073.818) (-2079.991) -- 0:00:42
850500 -- (-2081.640) (-2082.336) (-2069.430) [-2066.390] * (-2076.674) [-2071.000] (-2077.222) (-2079.025) -- 0:00:42
850600 -- [-2078.697] (-2076.853) (-2069.802) (-2072.270) * (-2082.795) [-2071.584] (-2078.532) (-2080.102) -- 0:00:42
850700 -- (-2079.672) (-2078.854) [-2069.023] (-2073.589) * (-2074.263) [-2070.540] (-2087.450) (-2078.276) -- 0:00:42
850800 -- (-2086.533) (-2089.938) [-2073.102] (-2071.114) * (-2076.248) (-2076.282) (-2082.883) [-2075.789] -- 0:00:42
850900 -- (-2083.760) (-2080.121) (-2075.091) [-2072.641] * (-2072.341) (-2085.212) (-2078.015) [-2073.985] -- 0:00:42
851000 -- (-2081.797) (-2087.357) [-2070.014] (-2074.940) * (-2073.493) (-2079.103) (-2082.489) [-2078.407] -- 0:00:42
Average standard deviation of split frequencies: 0.003560
851100 -- (-2075.559) (-2078.162) (-2079.593) [-2069.503] * [-2075.947] (-2076.151) (-2078.130) (-2084.020) -- 0:00:42
851200 -- [-2076.300] (-2081.374) (-2075.315) (-2075.769) * (-2083.355) [-2076.653] (-2077.984) (-2090.427) -- 0:00:42
851300 -- (-2079.224) (-2078.307) [-2069.789] (-2078.641) * (-2092.253) (-2077.856) [-2075.543] (-2089.132) -- 0:00:42
851400 -- [-2077.094] (-2083.392) (-2071.709) (-2074.942) * [-2080.126] (-2067.785) (-2078.431) (-2082.710) -- 0:00:42
851500 -- (-2075.696) (-2086.114) (-2070.533) [-2077.106] * (-2082.907) [-2074.096] (-2078.058) (-2082.227) -- 0:00:42
851600 -- [-2071.212] (-2077.301) (-2075.461) (-2075.779) * (-2084.599) [-2073.943] (-2081.861) (-2082.453) -- 0:00:42
851700 -- [-2072.108] (-2086.256) (-2073.922) (-2081.405) * (-2084.753) (-2082.100) [-2075.437] (-2075.171) -- 0:00:42
851800 -- [-2071.915] (-2084.441) (-2072.209) (-2077.145) * (-2094.673) [-2074.626] (-2082.558) (-2076.888) -- 0:00:42
851900 -- [-2074.449] (-2096.574) (-2069.553) (-2076.917) * (-2076.383) (-2083.792) [-2078.253] (-2078.884) -- 0:00:42
852000 -- (-2073.961) (-2092.207) [-2072.473] (-2083.285) * (-2085.256) (-2079.822) [-2078.720] (-2079.493) -- 0:00:42
Average standard deviation of split frequencies: 0.003604
852100 -- (-2080.066) (-2088.066) (-2075.497) [-2070.797] * (-2074.934) (-2077.241) [-2077.447] (-2080.238) -- 0:00:42
852200 -- (-2083.355) (-2085.088) (-2073.905) [-2070.349] * (-2079.124) (-2082.166) (-2079.713) [-2076.345] -- 0:00:42
852300 -- (-2081.719) (-2083.469) (-2070.424) [-2074.402] * (-2076.303) (-2073.930) (-2091.746) [-2072.984] -- 0:00:42
852400 -- (-2082.944) (-2084.330) (-2074.347) [-2073.622] * (-2080.613) (-2071.728) (-2086.751) [-2080.917] -- 0:00:42
852500 -- (-2078.130) (-2083.266) (-2083.927) [-2067.502] * (-2077.114) [-2070.955] (-2081.883) (-2083.412) -- 0:00:42
852600 -- (-2080.923) (-2081.995) [-2073.433] (-2071.512) * [-2076.263] (-2076.905) (-2079.413) (-2073.347) -- 0:00:42
852700 -- (-2078.449) (-2078.576) [-2073.206] (-2078.398) * (-2080.400) (-2074.409) (-2079.548) [-2073.398] -- 0:00:42
852800 -- [-2072.038] (-2083.069) (-2073.040) (-2086.490) * (-2079.722) [-2071.521] (-2081.237) (-2075.073) -- 0:00:42
852900 -- (-2074.033) (-2074.016) [-2067.590] (-2077.047) * (-2071.706) [-2077.365] (-2080.890) (-2073.101) -- 0:00:42
853000 -- (-2079.636) (-2085.902) [-2068.499] (-2076.255) * (-2083.923) [-2071.793] (-2088.459) (-2076.834) -- 0:00:42
Average standard deviation of split frequencies: 0.003378
853100 -- (-2074.965) (-2077.847) (-2070.362) [-2077.728] * (-2082.679) (-2074.935) (-2089.116) [-2074.254] -- 0:00:42
853200 -- (-2085.657) [-2075.514] (-2081.847) (-2075.891) * (-2088.546) (-2075.978) (-2084.165) [-2072.830] -- 0:00:42
853300 -- (-2084.717) [-2079.791] (-2085.772) (-2078.243) * (-2075.271) (-2084.986) (-2077.697) [-2077.153] -- 0:00:42
853400 -- [-2081.192] (-2078.297) (-2078.633) (-2081.438) * (-2080.889) (-2081.987) (-2093.434) [-2075.039] -- 0:00:42
853500 -- (-2079.309) (-2076.713) (-2082.055) [-2073.918] * (-2080.128) (-2087.922) (-2088.600) [-2073.749] -- 0:00:42
853600 -- [-2075.781] (-2077.933) (-2082.584) (-2076.262) * [-2077.010] (-2081.150) (-2080.091) (-2077.904) -- 0:00:42
853700 -- [-2074.252] (-2084.417) (-2075.870) (-2073.394) * (-2082.378) (-2074.666) (-2083.544) [-2075.386] -- 0:00:41
853800 -- (-2072.749) (-2087.373) [-2071.389] (-2077.091) * (-2081.888) (-2078.088) (-2081.755) [-2076.289] -- 0:00:41
853900 -- (-2075.493) (-2094.420) [-2070.679] (-2073.964) * (-2080.231) (-2081.729) (-2082.525) [-2074.953] -- 0:00:41
854000 -- (-2074.546) (-2074.543) [-2072.455] (-2074.937) * (-2074.943) [-2075.943] (-2077.872) (-2072.954) -- 0:00:41
Average standard deviation of split frequencies: 0.003611
854100 -- (-2073.537) (-2075.872) [-2081.300] (-2076.204) * (-2079.647) (-2076.509) (-2090.671) [-2068.872] -- 0:00:41
854200 -- [-2071.170] (-2077.063) (-2074.422) (-2075.246) * (-2075.518) (-2075.691) (-2086.497) [-2076.338] -- 0:00:41
854300 -- (-2070.791) (-2077.292) [-2067.937] (-2073.298) * (-2072.598) (-2077.880) (-2081.205) [-2075.154] -- 0:00:41
854400 -- (-2074.732) (-2076.207) (-2069.548) [-2076.412] * [-2073.890] (-2091.498) (-2084.254) (-2073.392) -- 0:00:41
854500 -- (-2075.088) (-2084.627) (-2072.468) [-2076.007] * [-2071.814] (-2101.012) (-2084.671) (-2071.196) -- 0:00:41
854600 -- [-2075.503] (-2083.537) (-2071.170) (-2081.928) * (-2076.017) (-2083.566) (-2087.235) [-2072.278] -- 0:00:41
854700 -- (-2082.962) (-2083.265) [-2070.181] (-2079.816) * [-2075.253] (-2090.990) (-2078.064) (-2075.200) -- 0:00:41
854800 -- (-2083.354) (-2072.991) [-2069.464] (-2074.852) * (-2073.534) (-2078.349) (-2084.247) [-2078.086] -- 0:00:41
854900 -- (-2077.133) (-2075.589) [-2070.182] (-2075.672) * (-2079.775) [-2075.424] (-2083.530) (-2088.100) -- 0:00:41
855000 -- [-2074.552] (-2074.077) (-2081.531) (-2075.466) * [-2072.886] (-2081.954) (-2085.100) (-2086.067) -- 0:00:41
Average standard deviation of split frequencies: 0.003717
855100 -- (-2076.662) (-2074.964) (-2076.549) [-2074.327] * (-2080.888) (-2083.074) [-2078.085] (-2082.178) -- 0:00:41
855200 -- (-2079.476) (-2076.008) [-2071.978] (-2077.017) * [-2074.315] (-2085.623) (-2076.137) (-2090.659) -- 0:00:41
855300 -- (-2074.208) (-2076.580) [-2071.322] (-2077.291) * (-2074.566) (-2082.684) [-2079.721] (-2091.194) -- 0:00:41
855400 -- (-2081.041) (-2075.988) [-2069.065] (-2074.557) * (-2072.899) (-2084.647) [-2088.701] (-2082.053) -- 0:00:41
855500 -- [-2071.680] (-2090.054) (-2072.302) (-2079.920) * (-2074.428) (-2086.364) [-2085.105] (-2081.582) -- 0:00:41
855600 -- (-2073.257) [-2078.918] (-2078.518) (-2073.781) * (-2077.878) [-2079.388] (-2085.305) (-2084.042) -- 0:00:41
855700 -- (-2076.322) (-2079.316) [-2070.394] (-2077.223) * (-2087.036) [-2081.079] (-2078.950) (-2084.203) -- 0:00:41
855800 -- (-2077.994) (-2081.736) [-2072.549] (-2079.084) * (-2079.999) (-2076.340) (-2080.189) [-2077.664] -- 0:00:41
855900 -- (-2079.502) (-2081.953) [-2069.406] (-2076.015) * (-2083.870) (-2080.776) [-2077.858] (-2078.848) -- 0:00:41
856000 -- (-2094.258) (-2078.115) (-2071.962) [-2077.206] * (-2085.817) [-2074.327] (-2081.259) (-2087.018) -- 0:00:41
Average standard deviation of split frequencies: 0.003508
856100 -- (-2087.343) (-2083.697) [-2072.126] (-2075.078) * (-2073.040) (-2071.517) [-2073.169] (-2089.970) -- 0:00:41
856200 -- (-2081.345) (-2088.367) (-2072.409) [-2073.933] * [-2070.051] (-2073.448) (-2079.543) (-2091.119) -- 0:00:41
856300 -- (-2074.697) (-2082.382) (-2074.480) [-2071.920] * (-2073.024) [-2072.190] (-2076.452) (-2088.297) -- 0:00:41
856400 -- (-2080.920) (-2085.957) [-2069.762] (-2071.204) * [-2075.251] (-2075.084) (-2080.784) (-2101.480) -- 0:00:41
856500 -- (-2074.616) (-2091.314) [-2070.149] (-2075.057) * (-2070.099) [-2069.697] (-2076.724) (-2083.553) -- 0:00:41
856600 -- (-2085.531) (-2089.010) [-2078.750] (-2073.245) * [-2070.990] (-2073.044) (-2085.157) (-2085.738) -- 0:00:41
856700 -- (-2078.152) (-2089.030) [-2068.715] (-2073.740) * (-2086.382) [-2074.594] (-2083.189) (-2076.207) -- 0:00:41
856800 -- (-2070.219) (-2077.803) (-2073.162) [-2067.394] * (-2079.837) [-2073.336] (-2080.073) (-2079.015) -- 0:00:41
856900 -- (-2070.126) (-2079.701) [-2073.149] (-2072.773) * (-2084.107) (-2076.579) [-2079.091] (-2078.266) -- 0:00:41
857000 -- [-2072.493] (-2076.392) (-2079.646) (-2068.849) * (-2084.899) (-2074.669) (-2078.098) [-2078.253] -- 0:00:41
Average standard deviation of split frequencies: 0.003457
857100 -- (-2078.354) [-2081.062] (-2079.822) (-2076.400) * (-2092.181) (-2073.420) (-2074.126) [-2072.040] -- 0:00:41
857200 -- (-2077.062) (-2077.872) (-2079.435) [-2078.078] * (-2093.928) [-2074.843] (-2073.530) (-2080.908) -- 0:00:40
857300 -- [-2075.088] (-2080.208) (-2074.395) (-2073.983) * (-2094.830) (-2078.005) [-2082.716] (-2095.775) -- 0:00:40
857400 -- (-2077.899) (-2073.982) (-2074.022) [-2071.678] * (-2090.581) [-2070.313] (-2094.898) (-2090.878) -- 0:00:40
857500 -- (-2081.789) [-2072.814] (-2084.219) (-2074.446) * (-2085.453) [-2070.420] (-2079.621) (-2084.302) -- 0:00:40
857600 -- (-2078.017) (-2079.963) (-2080.119) [-2070.081] * (-2084.094) [-2066.981] (-2089.766) (-2082.638) -- 0:00:40
857700 -- (-2076.229) (-2078.449) (-2077.625) [-2067.015] * (-2080.890) (-2080.321) (-2096.400) [-2082.005] -- 0:00:40
857800 -- (-2075.147) (-2075.040) (-2072.659) [-2068.781] * (-2082.069) [-2073.657] (-2083.193) (-2081.780) -- 0:00:40
857900 -- (-2074.463) (-2076.230) (-2070.314) [-2080.677] * [-2075.950] (-2077.200) (-2079.906) (-2084.952) -- 0:00:40
858000 -- (-2081.388) (-2079.791) [-2071.905] (-2074.781) * (-2080.525) [-2070.981] (-2084.647) (-2089.028) -- 0:00:40
Average standard deviation of split frequencies: 0.003484
858100 -- (-2073.580) (-2090.029) (-2074.419) [-2074.186] * (-2077.687) [-2073.619] (-2077.912) (-2081.373) -- 0:00:40
858200 -- (-2075.592) (-2080.627) [-2076.907] (-2076.979) * [-2071.355] (-2080.056) (-2086.797) (-2094.007) -- 0:00:40
858300 -- (-2072.507) (-2076.889) [-2072.013] (-2074.670) * [-2073.978] (-2077.248) (-2081.789) (-2079.178) -- 0:00:40
858400 -- (-2072.757) (-2073.848) [-2071.433] (-2070.905) * (-2081.006) (-2081.005) [-2076.649] (-2079.547) -- 0:00:40
858500 -- (-2076.075) (-2083.595) [-2069.614] (-2076.003) * [-2084.138] (-2091.045) (-2076.981) (-2089.549) -- 0:00:40
858600 -- (-2074.312) [-2075.156] (-2068.554) (-2077.400) * (-2079.576) (-2093.945) [-2075.866] (-2083.218) -- 0:00:40
858700 -- (-2070.348) (-2084.776) (-2069.584) [-2070.409] * (-2085.478) (-2084.463) [-2077.338] (-2092.756) -- 0:00:40
858800 -- (-2074.472) (-2082.460) [-2070.689] (-2077.636) * (-2082.169) (-2090.596) [-2073.401] (-2080.856) -- 0:00:40
858900 -- (-2075.139) (-2086.852) [-2070.995] (-2072.471) * (-2081.798) (-2083.880) [-2087.267] (-2078.125) -- 0:00:40
859000 -- [-2073.563] (-2088.557) (-2070.178) (-2078.637) * [-2077.844] (-2084.367) (-2091.912) (-2077.796) -- 0:00:40
Average standard deviation of split frequencies: 0.003496
859100 -- (-2077.682) (-2091.890) (-2075.239) [-2074.327] * (-2077.534) (-2086.677) (-2085.125) [-2078.128] -- 0:00:40
859200 -- [-2073.176] (-2078.251) (-2076.684) (-2082.244) * (-2073.247) (-2082.584) (-2078.453) [-2072.133] -- 0:00:40
859300 -- (-2073.556) [-2078.912] (-2077.576) (-2087.444) * (-2082.618) (-2086.645) (-2080.332) [-2071.252] -- 0:00:40
859400 -- [-2070.681] (-2082.830) (-2075.359) (-2074.284) * (-2077.562) (-2076.239) (-2080.384) [-2072.809] -- 0:00:40
859500 -- [-2075.792] (-2080.256) (-2082.420) (-2084.825) * (-2078.575) (-2086.450) [-2075.753] (-2067.428) -- 0:00:40
859600 -- (-2085.648) (-2087.061) [-2073.102] (-2078.215) * (-2082.789) (-2074.647) (-2079.541) [-2072.716] -- 0:00:40
859700 -- (-2086.229) (-2087.216) (-2071.522) [-2074.240] * (-2077.259) [-2077.997] (-2081.408) (-2082.481) -- 0:00:40
859800 -- (-2083.720) (-2083.809) [-2067.525] (-2078.142) * (-2082.979) (-2075.996) (-2079.422) [-2075.488] -- 0:00:40
859900 -- (-2081.310) (-2077.623) (-2071.373) [-2067.840] * (-2081.974) (-2076.088) [-2078.400] (-2075.492) -- 0:00:40
860000 -- (-2069.755) (-2081.247) (-2074.870) [-2068.844] * (-2079.967) [-2071.187] (-2078.384) (-2073.577) -- 0:00:40
Average standard deviation of split frequencies: 0.003367
860100 -- (-2075.342) (-2078.549) (-2078.172) [-2068.511] * (-2082.402) [-2070.022] (-2083.098) (-2073.301) -- 0:00:40
860200 -- (-2075.727) [-2075.733] (-2073.826) (-2072.470) * (-2088.353) (-2073.320) (-2083.691) [-2070.957] -- 0:00:40
860300 -- (-2078.297) (-2085.488) (-2084.624) [-2067.715] * (-2089.184) (-2073.624) (-2081.052) [-2074.188] -- 0:00:40
860400 -- (-2079.201) (-2086.583) (-2086.878) [-2067.277] * [-2075.170] (-2074.087) (-2078.495) (-2080.028) -- 0:00:40
860500 -- (-2076.420) (-2082.034) (-2079.911) [-2068.570] * (-2078.758) [-2073.732] (-2076.424) (-2072.230) -- 0:00:40
860600 -- (-2075.669) (-2086.369) (-2076.470) [-2072.767] * (-2080.742) (-2084.360) (-2079.372) [-2080.143] -- 0:00:40
860700 -- (-2074.643) [-2077.292] (-2080.371) (-2077.753) * (-2080.851) (-2078.749) (-2081.987) [-2073.743] -- 0:00:39
860800 -- (-2072.896) (-2079.861) (-2082.017) [-2075.376] * (-2083.384) (-2078.556) (-2080.084) [-2078.086] -- 0:00:39
860900 -- (-2076.628) (-2082.815) (-2078.877) [-2070.397] * (-2073.171) (-2079.054) [-2075.334] (-2070.489) -- 0:00:39
861000 -- (-2076.077) (-2091.363) [-2068.087] (-2078.804) * (-2079.396) [-2075.460] (-2077.851) (-2078.000) -- 0:00:39
Average standard deviation of split frequencies: 0.003409
861100 -- (-2086.811) (-2080.189) [-2072.913] (-2073.728) * (-2081.505) (-2072.908) (-2078.053) [-2072.854] -- 0:00:39
861200 -- (-2086.373) (-2078.468) [-2074.050] (-2075.033) * (-2086.848) (-2074.231) (-2078.952) [-2072.917] -- 0:00:39
861300 -- (-2082.066) (-2082.921) (-2073.439) [-2075.576] * (-2074.827) (-2088.786) (-2082.343) [-2075.668] -- 0:00:39
861400 -- (-2076.779) (-2077.974) [-2069.220] (-2073.218) * [-2076.551] (-2089.085) (-2084.856) (-2074.087) -- 0:00:39
861500 -- (-2079.007) (-2089.181) [-2072.514] (-2077.799) * [-2074.371] (-2095.984) (-2086.068) (-2074.762) -- 0:00:39
861600 -- (-2080.085) (-2088.229) (-2073.730) [-2071.878] * [-2073.541] (-2103.381) (-2083.365) (-2070.469) -- 0:00:39
861700 -- (-2077.806) (-2081.677) (-2073.191) [-2072.635] * (-2078.654) (-2091.450) (-2091.409) [-2070.306] -- 0:00:39
861800 -- (-2087.949) (-2079.078) [-2071.501] (-2077.092) * (-2091.463) [-2077.417] (-2087.547) (-2068.281) -- 0:00:39
861900 -- (-2077.335) (-2079.266) [-2071.407] (-2076.305) * (-2086.338) (-2092.713) (-2087.275) [-2069.079] -- 0:00:39
862000 -- [-2074.591] (-2075.948) (-2072.832) (-2079.178) * (-2086.796) (-2089.703) (-2083.725) [-2072.185] -- 0:00:39
Average standard deviation of split frequencies: 0.003312
862100 -- (-2076.741) [-2074.659] (-2073.828) (-2095.446) * (-2083.952) (-2082.358) (-2082.015) [-2070.044] -- 0:00:39
862200 -- (-2082.005) (-2077.565) [-2072.376] (-2091.784) * (-2086.143) (-2080.655) (-2086.494) [-2070.661] -- 0:00:39
862300 -- (-2079.813) (-2077.700) [-2073.434] (-2080.410) * (-2094.694) (-2078.542) (-2081.309) [-2077.400] -- 0:00:39
862400 -- (-2073.520) (-2082.417) [-2074.670] (-2079.522) * (-2086.085) (-2075.913) [-2081.884] (-2081.499) -- 0:00:39
862500 -- (-2074.239) (-2074.311) [-2067.812] (-2084.182) * (-2092.331) (-2074.714) (-2081.545) [-2079.245] -- 0:00:39
862600 -- [-2077.503] (-2074.354) (-2078.238) (-2088.696) * (-2097.337) [-2075.309] (-2079.476) (-2075.066) -- 0:00:39
862700 -- (-2077.946) (-2087.768) [-2076.421] (-2086.939) * (-2093.990) [-2074.505] (-2082.510) (-2073.070) -- 0:00:39
862800 -- (-2075.566) [-2079.743] (-2080.183) (-2089.385) * (-2088.620) (-2083.484) (-2084.733) [-2076.924] -- 0:00:39
862900 -- [-2078.840] (-2076.392) (-2077.084) (-2090.850) * (-2091.986) (-2077.382) (-2087.431) [-2073.930] -- 0:00:39
863000 -- (-2074.144) (-2080.587) [-2081.324] (-2081.607) * (-2091.175) (-2079.085) (-2088.359) [-2072.021] -- 0:00:39
Average standard deviation of split frequencies: 0.003167
863100 -- (-2076.995) (-2076.505) [-2084.526] (-2080.569) * (-2084.902) [-2079.362] (-2094.073) (-2073.183) -- 0:00:39
863200 -- [-2075.151] (-2073.238) (-2083.171) (-2083.938) * (-2089.224) (-2082.788) (-2105.352) [-2075.259] -- 0:00:39
863300 -- [-2075.782] (-2082.318) (-2084.023) (-2080.108) * (-2081.421) (-2083.861) (-2093.532) [-2073.481] -- 0:00:39
863400 -- [-2073.657] (-2080.363) (-2079.800) (-2078.397) * (-2086.315) (-2090.100) (-2082.495) [-2076.275] -- 0:00:39
863500 -- [-2075.642] (-2079.869) (-2083.727) (-2078.391) * (-2089.420) (-2086.879) (-2081.787) [-2076.687] -- 0:00:39
863600 -- (-2088.134) (-2081.354) (-2078.463) [-2083.981] * (-2089.804) [-2081.614] (-2078.871) (-2073.529) -- 0:00:39
863700 -- (-2081.243) [-2079.275] (-2068.801) (-2088.282) * (-2089.249) (-2078.009) (-2081.511) [-2075.556] -- 0:00:39
863800 -- (-2077.165) (-2077.645) [-2077.179] (-2083.435) * (-2086.934) [-2080.009] (-2082.560) (-2081.495) -- 0:00:39
863900 -- (-2073.901) (-2074.880) [-2072.009] (-2086.089) * [-2080.271] (-2084.303) (-2078.425) (-2084.437) -- 0:00:39
864000 -- (-2075.721) (-2073.420) (-2072.112) [-2082.514] * (-2086.006) (-2092.584) [-2079.404] (-2082.379) -- 0:00:39
Average standard deviation of split frequencies: 0.003055
864100 -- (-2085.666) [-2074.592] (-2079.816) (-2080.450) * (-2078.241) (-2084.606) [-2076.090] (-2083.049) -- 0:00:39
864200 -- (-2079.788) (-2077.592) (-2070.086) [-2078.023] * [-2076.382] (-2093.944) (-2077.413) (-2081.953) -- 0:00:38
864300 -- (-2073.115) (-2088.540) (-2074.240) [-2076.814] * [-2077.040] (-2087.490) (-2082.333) (-2085.914) -- 0:00:38
864400 -- [-2069.930] (-2080.395) (-2070.722) (-2081.983) * [-2075.955] (-2079.327) (-2080.623) (-2077.461) -- 0:00:38
864500 -- [-2075.865] (-2083.331) (-2071.170) (-2094.534) * (-2079.505) (-2079.624) (-2080.771) [-2074.763] -- 0:00:38
864600 -- (-2080.879) (-2084.545) [-2074.114] (-2086.247) * [-2090.468] (-2084.181) (-2080.061) (-2075.854) -- 0:00:38
864700 -- (-2076.122) [-2079.129] (-2067.910) (-2086.406) * (-2090.008) (-2083.658) [-2081.534] (-2074.377) -- 0:00:38
864800 -- (-2075.910) (-2083.015) (-2072.049) [-2082.728] * (-2085.147) (-2085.208) (-2087.979) [-2071.733] -- 0:00:38
864900 -- (-2084.199) (-2082.060) [-2070.279] (-2090.484) * (-2082.118) (-2089.569) (-2084.759) [-2070.110] -- 0:00:38
865000 -- [-2069.787] (-2082.532) (-2070.279) (-2086.904) * (-2088.151) (-2082.912) (-2084.633) [-2075.308] -- 0:00:38
Average standard deviation of split frequencies: 0.003098
865100 -- (-2071.878) (-2079.913) [-2076.460] (-2081.179) * (-2082.454) (-2078.698) [-2075.633] (-2075.864) -- 0:00:38
865200 -- [-2071.085] (-2080.574) (-2072.970) (-2081.314) * (-2078.465) (-2080.435) (-2075.624) [-2070.375] -- 0:00:38
865300 -- (-2076.789) (-2075.386) (-2075.625) [-2082.164] * (-2081.949) (-2083.338) [-2075.772] (-2084.411) -- 0:00:38
865400 -- (-2075.090) (-2077.224) [-2078.000] (-2081.279) * [-2073.686] (-2090.172) (-2076.708) (-2080.264) -- 0:00:38
865500 -- (-2073.489) (-2079.240) [-2071.470] (-2081.607) * [-2071.242] (-2090.964) (-2078.224) (-2078.565) -- 0:00:38
865600 -- (-2075.663) [-2077.156] (-2083.420) (-2084.534) * (-2076.593) (-2091.189) (-2076.369) [-2076.973] -- 0:00:38
865700 -- [-2072.302] (-2074.956) (-2080.268) (-2076.725) * [-2081.554] (-2086.468) (-2076.032) (-2081.103) -- 0:00:38
865800 -- [-2075.452] (-2082.678) (-2091.248) (-2084.401) * (-2073.380) (-2081.377) [-2078.545] (-2090.393) -- 0:00:38
865900 -- (-2080.798) [-2075.612] (-2088.462) (-2085.082) * (-2075.769) (-2081.369) [-2076.678] (-2078.967) -- 0:00:38
866000 -- (-2080.997) [-2076.068] (-2074.993) (-2082.184) * (-2080.720) (-2082.568) (-2076.241) [-2071.359] -- 0:00:38
Average standard deviation of split frequencies: 0.002939
866100 -- [-2073.688] (-2077.510) (-2078.164) (-2081.007) * (-2084.843) (-2077.737) (-2080.980) [-2073.873] -- 0:00:38
866200 -- (-2078.634) (-2076.030) [-2072.624] (-2078.023) * (-2087.168) (-2084.063) (-2080.395) [-2075.970] -- 0:00:38
866300 -- (-2074.808) [-2075.474] (-2079.496) (-2082.284) * (-2081.284) (-2095.786) (-2083.270) [-2079.898] -- 0:00:38
866400 -- (-2079.551) [-2078.632] (-2072.215) (-2090.599) * [-2082.550] (-2096.070) (-2083.458) (-2079.199) -- 0:00:38
866500 -- [-2080.155] (-2078.738) (-2072.625) (-2087.542) * (-2083.003) (-2085.268) [-2077.176] (-2076.988) -- 0:00:38
866600 -- (-2081.059) (-2076.804) [-2068.155] (-2095.064) * (-2079.022) (-2083.941) [-2076.856] (-2081.423) -- 0:00:38
866700 -- (-2078.349) (-2075.208) [-2070.042] (-2086.540) * (-2079.305) (-2079.537) [-2078.357] (-2075.884) -- 0:00:38
866800 -- (-2079.372) (-2076.948) [-2072.729] (-2080.480) * (-2073.445) (-2079.068) (-2077.293) [-2075.387] -- 0:00:38
866900 -- (-2082.052) (-2079.485) [-2072.540] (-2080.875) * (-2080.291) (-2078.818) (-2075.455) [-2078.306] -- 0:00:38
867000 -- (-2080.749) (-2077.138) [-2071.098] (-2086.141) * [-2073.595] (-2081.020) (-2081.695) (-2076.826) -- 0:00:38
Average standard deviation of split frequencies: 0.002904
867100 -- [-2077.265] (-2073.229) (-2090.562) (-2083.482) * (-2075.683) [-2074.268] (-2078.253) (-2080.558) -- 0:00:38
867200 -- (-2080.972) (-2076.230) (-2094.611) [-2073.080] * (-2076.756) (-2075.603) [-2074.290] (-2076.665) -- 0:00:38
867300 -- (-2075.128) (-2079.485) (-2090.552) [-2075.925] * (-2075.784) (-2071.408) (-2074.274) [-2071.743] -- 0:00:38
867400 -- [-2072.873] (-2075.002) (-2087.159) (-2079.268) * (-2079.694) [-2073.312] (-2083.357) (-2076.529) -- 0:00:38
867500 -- [-2076.879] (-2074.687) (-2084.592) (-2085.680) * (-2080.390) (-2080.069) (-2082.382) [-2073.562] -- 0:00:38
867600 -- [-2075.690] (-2076.214) (-2099.146) (-2079.526) * (-2079.497) [-2075.820] (-2085.829) (-2077.903) -- 0:00:37
867700 -- [-2074.179] (-2080.588) (-2083.990) (-2082.393) * (-2079.356) [-2069.558] (-2088.409) (-2076.659) -- 0:00:37
867800 -- (-2078.166) (-2079.728) [-2083.142] (-2094.166) * (-2081.862) [-2067.541] (-2083.845) (-2076.435) -- 0:00:37
867900 -- (-2076.741) (-2077.368) [-2083.009] (-2091.944) * (-2080.126) [-2071.235] (-2082.333) (-2076.759) -- 0:00:37
868000 -- [-2076.454] (-2078.197) (-2076.453) (-2089.815) * (-2080.507) [-2069.228] (-2089.786) (-2082.333) -- 0:00:37
Average standard deviation of split frequencies: 0.003134
868100 -- (-2076.427) [-2076.839] (-2078.604) (-2080.080) * (-2081.826) (-2074.031) (-2079.244) [-2075.828] -- 0:00:37
868200 -- [-2072.297] (-2081.740) (-2075.211) (-2087.845) * (-2074.448) [-2072.878] (-2082.427) (-2077.133) -- 0:00:37
868300 -- [-2073.080] (-2081.937) (-2074.385) (-2088.334) * (-2073.081) [-2072.427] (-2082.195) (-2080.709) -- 0:00:37
868400 -- (-2083.244) (-2085.735) [-2076.179] (-2082.076) * [-2075.345] (-2078.041) (-2081.410) (-2079.325) -- 0:00:37
868500 -- [-2083.744] (-2075.626) (-2082.453) (-2090.912) * (-2075.903) (-2076.124) [-2079.721] (-2079.705) -- 0:00:37
868600 -- (-2080.897) [-2071.862] (-2078.790) (-2083.906) * (-2078.349) [-2071.195] (-2081.596) (-2087.645) -- 0:00:37
868700 -- (-2081.090) (-2079.232) [-2074.027] (-2081.241) * (-2078.100) (-2071.569) [-2078.343] (-2092.687) -- 0:00:37
868800 -- [-2076.337] (-2086.650) (-2074.943) (-2087.023) * (-2082.385) (-2076.415) [-2074.501] (-2085.123) -- 0:00:37
868900 -- [-2075.684] (-2089.655) (-2079.525) (-2081.587) * (-2081.987) [-2074.360] (-2079.094) (-2087.338) -- 0:00:37
869000 -- [-2074.871] (-2085.513) (-2079.419) (-2080.452) * (-2088.446) [-2070.376] (-2080.990) (-2077.444) -- 0:00:37
Average standard deviation of split frequencies: 0.003208
869100 -- (-2073.581) (-2080.459) (-2083.895) [-2078.404] * [-2078.849] (-2080.888) (-2076.781) (-2084.474) -- 0:00:37
869200 -- [-2077.739] (-2087.616) (-2084.713) (-2083.566) * (-2085.831) (-2081.785) [-2074.943] (-2076.418) -- 0:00:37
869300 -- (-2086.612) [-2076.504] (-2089.473) (-2082.897) * (-2081.213) (-2088.579) [-2081.588] (-2085.449) -- 0:00:37
869400 -- (-2078.965) [-2074.449] (-2089.502) (-2090.565) * (-2083.437) (-2084.923) [-2079.159] (-2080.504) -- 0:00:37
869500 -- [-2085.271] (-2077.346) (-2078.888) (-2083.863) * (-2080.987) (-2082.543) (-2077.179) [-2072.140] -- 0:00:37
869600 -- (-2091.119) (-2079.759) (-2080.440) [-2073.245] * [-2077.553] (-2079.751) (-2077.677) (-2071.900) -- 0:00:37
869700 -- (-2094.371) (-2084.513) [-2085.630] (-2085.282) * (-2080.570) (-2082.172) (-2073.760) [-2077.650] -- 0:00:37
869800 -- (-2094.262) [-2076.943] (-2087.832) (-2084.451) * (-2079.356) (-2081.492) [-2076.368] (-2079.313) -- 0:00:37
869900 -- (-2087.218) (-2077.375) (-2093.501) [-2077.379] * (-2078.545) (-2080.009) [-2076.851] (-2089.895) -- 0:00:37
870000 -- (-2097.394) (-2086.749) (-2098.979) [-2080.415] * (-2075.474) (-2075.583) [-2077.173] (-2080.771) -- 0:00:37
Average standard deviation of split frequencies: 0.003142
870100 -- (-2086.757) (-2079.872) (-2090.148) [-2080.881] * (-2079.633) [-2069.948] (-2077.900) (-2086.677) -- 0:00:37
870200 -- (-2083.164) (-2087.106) (-2081.183) [-2080.537] * (-2081.397) (-2073.576) [-2076.377] (-2078.988) -- 0:00:37
870300 -- [-2073.765] (-2090.950) (-2081.775) (-2083.941) * [-2076.537] (-2072.333) (-2079.970) (-2084.569) -- 0:00:37
870400 -- [-2074.489] (-2080.260) (-2075.021) (-2077.735) * (-2074.440) (-2071.020) (-2083.719) [-2077.341] -- 0:00:37
870500 -- [-2073.831] (-2079.200) (-2081.488) (-2079.033) * (-2077.334) (-2070.390) [-2087.568] (-2080.696) -- 0:00:37
870600 -- (-2076.974) [-2083.935] (-2078.700) (-2081.879) * (-2084.245) [-2075.937] (-2080.401) (-2077.740) -- 0:00:37
870700 -- (-2082.156) (-2083.108) [-2075.809] (-2079.808) * (-2081.699) (-2078.152) (-2081.390) [-2079.933] -- 0:00:37
870800 -- (-2078.529) (-2092.405) [-2072.480] (-2088.241) * (-2077.831) (-2078.495) (-2081.179) [-2074.163] -- 0:00:37
870900 -- (-2076.487) (-2081.288) (-2078.275) [-2082.031] * (-2085.238) [-2077.055] (-2086.163) (-2078.853) -- 0:00:37
871000 -- (-2082.200) [-2083.620] (-2078.912) (-2082.270) * [-2081.421] (-2082.334) (-2082.877) (-2078.353) -- 0:00:37
Average standard deviation of split frequencies: 0.003123
871100 -- (-2082.923) [-2081.963] (-2089.284) (-2079.211) * (-2080.369) (-2079.762) (-2081.264) [-2070.662] -- 0:00:36
871200 -- (-2077.055) [-2080.477] (-2085.523) (-2077.146) * (-2074.632) (-2073.609) (-2082.675) [-2070.495] -- 0:00:36
871300 -- [-2074.211] (-2084.777) (-2077.963) (-2080.993) * (-2079.915) (-2074.269) (-2089.744) [-2076.125] -- 0:00:36
871400 -- (-2076.939) (-2082.343) [-2077.287] (-2077.878) * (-2081.359) (-2075.573) (-2083.685) [-2074.386] -- 0:00:36
871500 -- (-2074.229) (-2081.823) (-2077.683) [-2077.987] * (-2086.405) [-2072.504] (-2086.582) (-2069.899) -- 0:00:36
871600 -- (-2084.402) [-2074.834] (-2079.415) (-2081.241) * (-2089.909) [-2078.036] (-2086.785) (-2071.792) -- 0:00:36
871700 -- (-2087.970) (-2080.125) (-2084.957) [-2078.059] * (-2091.219) (-2075.862) (-2082.840) [-2074.538] -- 0:00:36
871800 -- (-2084.261) (-2081.453) (-2079.821) [-2080.462] * (-2085.755) (-2077.341) [-2075.157] (-2086.632) -- 0:00:36
871900 -- (-2081.954) (-2086.816) [-2078.215] (-2074.992) * (-2084.862) (-2078.344) [-2074.779] (-2087.524) -- 0:00:36
872000 -- (-2081.989) (-2081.724) (-2083.023) [-2075.915] * (-2088.642) (-2074.202) (-2076.446) [-2082.899] -- 0:00:36
Average standard deviation of split frequencies: 0.002934
872100 -- (-2084.274) (-2080.978) [-2083.505] (-2077.620) * (-2091.735) [-2072.010] (-2075.866) (-2078.067) -- 0:00:36
872200 -- (-2081.695) (-2080.314) [-2074.301] (-2080.041) * (-2082.298) (-2076.351) (-2079.521) [-2074.499] -- 0:00:36
872300 -- [-2085.398] (-2087.019) (-2072.908) (-2072.509) * [-2076.307] (-2076.587) (-2078.072) (-2076.808) -- 0:00:36
872400 -- (-2080.078) (-2088.860) [-2073.907] (-2076.357) * (-2087.473) (-2081.324) [-2077.581] (-2080.248) -- 0:00:36
872500 -- (-2083.347) (-2081.469) (-2090.994) [-2078.904] * (-2085.928) (-2076.563) [-2077.852] (-2083.061) -- 0:00:36
872600 -- (-2087.486) [-2077.690] (-2083.779) (-2077.015) * (-2078.809) (-2081.864) [-2076.838] (-2086.892) -- 0:00:36
872700 -- (-2092.556) (-2079.972) (-2079.588) [-2081.413] * (-2089.082) (-2077.617) [-2074.029] (-2082.375) -- 0:00:36
872800 -- (-2088.654) (-2076.699) [-2080.601] (-2089.286) * (-2084.515) [-2076.092] (-2078.129) (-2079.756) -- 0:00:36
872900 -- (-2094.782) [-2075.459] (-2079.493) (-2083.308) * (-2081.651) (-2073.168) (-2081.566) [-2078.606] -- 0:00:36
873000 -- [-2085.082] (-2091.315) (-2081.120) (-2076.756) * (-2083.665) (-2074.804) [-2081.393] (-2070.328) -- 0:00:36
Average standard deviation of split frequencies: 0.002931
873100 -- (-2087.433) [-2074.507] (-2078.438) (-2079.112) * (-2078.969) (-2085.591) [-2078.425] (-2072.408) -- 0:00:36
873200 -- (-2089.286) (-2074.828) (-2080.100) [-2076.264] * (-2081.806) [-2079.675] (-2093.321) (-2080.243) -- 0:00:36
873300 -- (-2099.239) (-2082.857) [-2076.263] (-2077.890) * (-2076.132) (-2073.325) (-2097.309) [-2077.490] -- 0:00:36
873400 -- (-2089.972) (-2086.757) (-2077.038) [-2072.281] * [-2073.978] (-2081.682) (-2094.099) (-2078.637) -- 0:00:36
873500 -- (-2091.536) [-2079.591] (-2077.888) (-2081.052) * [-2071.570] (-2072.899) (-2087.339) (-2080.481) -- 0:00:36
873600 -- (-2084.591) [-2077.767] (-2082.460) (-2091.095) * [-2071.297] (-2075.470) (-2077.684) (-2081.653) -- 0:00:36
873700 -- (-2089.809) (-2078.325) (-2079.401) [-2081.770] * (-2075.397) [-2072.572] (-2078.430) (-2087.594) -- 0:00:36
873800 -- (-2090.036) (-2090.179) [-2072.667] (-2075.063) * (-2079.990) [-2071.582] (-2076.876) (-2081.840) -- 0:00:36
873900 -- [-2081.764] (-2086.926) (-2079.387) (-2083.220) * (-2082.073) [-2067.989] (-2078.154) (-2077.789) -- 0:00:36
874000 -- (-2087.469) [-2084.824] (-2074.614) (-2088.312) * (-2082.797) [-2076.503] (-2077.834) (-2072.135) -- 0:00:36
Average standard deviation of split frequencies: 0.002866
874100 -- (-2076.011) (-2079.754) (-2083.762) [-2078.695] * [-2078.540] (-2076.139) (-2080.940) (-2076.086) -- 0:00:36
874200 -- (-2073.885) (-2086.302) (-2074.017) [-2077.846] * [-2075.109] (-2083.693) (-2076.735) (-2074.380) -- 0:00:36
874300 -- [-2074.912] (-2079.146) (-2089.822) (-2078.017) * [-2076.421] (-2081.509) (-2079.236) (-2077.355) -- 0:00:36
874400 -- [-2072.326] (-2086.052) (-2083.220) (-2085.012) * (-2081.893) (-2073.291) (-2077.063) [-2067.657] -- 0:00:36
874500 -- [-2075.896] (-2086.744) (-2081.321) (-2084.628) * (-2076.071) [-2071.207] (-2077.036) (-2073.634) -- 0:00:36
874600 -- (-2082.989) (-2090.168) [-2084.310] (-2075.870) * (-2071.417) [-2069.072] (-2076.320) (-2083.968) -- 0:00:35
874700 -- (-2081.445) (-2092.294) (-2081.271) [-2078.092] * (-2072.330) (-2071.142) (-2083.337) [-2071.979] -- 0:00:35
874800 -- [-2081.962] (-2085.438) (-2077.597) (-2073.960) * (-2082.402) (-2076.538) (-2086.058) [-2070.126] -- 0:00:35
874900 -- [-2076.497] (-2084.672) (-2077.621) (-2079.741) * (-2084.207) [-2077.278] (-2083.074) (-2081.679) -- 0:00:35
875000 -- [-2079.814] (-2081.663) (-2080.182) (-2080.370) * (-2091.490) [-2070.817] (-2077.257) (-2078.860) -- 0:00:35
Average standard deviation of split frequencies: 0.002832
875100 -- (-2077.342) [-2078.466] (-2081.993) (-2087.293) * (-2083.954) [-2069.116] (-2080.182) (-2081.558) -- 0:00:35
875200 -- (-2082.303) (-2081.781) [-2077.915] (-2091.761) * (-2079.715) [-2074.814] (-2076.188) (-2077.263) -- 0:00:35
875300 -- [-2072.559] (-2085.206) (-2088.588) (-2081.991) * (-2074.890) (-2072.422) [-2075.492] (-2079.555) -- 0:00:35
875400 -- [-2075.627] (-2079.115) (-2090.225) (-2078.780) * [-2070.039] (-2073.954) (-2076.582) (-2080.657) -- 0:00:35
875500 -- [-2082.496] (-2076.235) (-2105.338) (-2075.902) * [-2074.387] (-2083.163) (-2074.483) (-2071.024) -- 0:00:35
875600 -- [-2075.790] (-2081.919) (-2094.471) (-2084.198) * (-2079.181) (-2088.305) [-2077.419] (-2075.579) -- 0:00:35
875700 -- [-2080.923] (-2080.889) (-2095.850) (-2084.020) * (-2078.754) (-2090.825) (-2072.323) [-2071.162] -- 0:00:35
875800 -- (-2081.141) (-2080.233) (-2089.056) [-2083.973] * (-2086.426) (-2082.512) (-2078.733) [-2068.804] -- 0:00:35
875900 -- [-2084.858] (-2082.832) (-2081.033) (-2091.082) * (-2090.079) (-2083.095) (-2076.826) [-2069.264] -- 0:00:35
876000 -- [-2074.174] (-2085.283) (-2073.993) (-2072.205) * (-2079.435) (-2082.570) (-2075.607) [-2069.433] -- 0:00:35
Average standard deviation of split frequencies: 0.002998
876100 -- (-2076.583) [-2079.015] (-2079.389) (-2075.510) * [-2079.196] (-2077.187) (-2080.578) (-2071.584) -- 0:00:35
876200 -- (-2084.914) (-2083.454) (-2081.909) [-2078.765] * (-2083.982) [-2076.348] (-2086.926) (-2072.428) -- 0:00:35
876300 -- (-2087.232) (-2084.227) (-2085.637) [-2069.236] * (-2079.897) (-2078.207) [-2081.980] (-2073.708) -- 0:00:35
876400 -- (-2081.223) (-2091.830) [-2076.365] (-2072.073) * (-2076.238) [-2079.466] (-2083.524) (-2072.899) -- 0:00:35
876500 -- [-2077.209] (-2079.551) (-2091.258) (-2074.220) * [-2073.676] (-2081.794) (-2081.141) (-2082.058) -- 0:00:35
876600 -- (-2077.986) (-2078.505) (-2089.281) [-2074.608] * (-2077.981) (-2075.810) [-2075.018] (-2073.707) -- 0:00:35
876700 -- (-2081.125) (-2079.933) (-2087.460) [-2074.636] * (-2079.437) (-2079.279) (-2085.531) [-2072.081] -- 0:00:35
876800 -- (-2082.457) (-2080.408) (-2082.068) [-2074.689] * (-2080.499) (-2081.060) (-2080.919) [-2069.512] -- 0:00:35
876900 -- (-2082.413) (-2081.499) (-2081.954) [-2069.292] * (-2078.851) [-2071.828] (-2078.961) (-2073.130) -- 0:00:35
877000 -- (-2086.531) (-2075.454) (-2078.124) [-2070.748] * (-2075.571) (-2077.270) (-2080.249) [-2072.999] -- 0:00:35
Average standard deviation of split frequencies: 0.003132
877100 -- (-2081.453) [-2075.576] (-2082.210) (-2076.007) * (-2084.080) (-2077.758) [-2074.621] (-2070.217) -- 0:00:35
877200 -- [-2075.257] (-2076.065) (-2077.924) (-2080.126) * [-2076.179] (-2079.653) (-2078.397) (-2072.694) -- 0:00:35
877300 -- (-2079.488) (-2078.862) (-2085.350) [-2079.721] * (-2076.683) (-2074.574) (-2081.808) [-2069.795] -- 0:00:35
877400 -- (-2080.912) (-2085.820) (-2078.244) [-2073.858] * [-2079.918] (-2077.603) (-2086.074) (-2075.245) -- 0:00:35
877500 -- [-2075.823] (-2087.774) (-2075.734) (-2081.743) * (-2085.500) [-2074.273] (-2075.779) (-2071.813) -- 0:00:35
877600 -- (-2080.403) (-2089.630) [-2079.282] (-2086.086) * (-2086.174) [-2071.539] (-2086.960) (-2075.834) -- 0:00:35
877700 -- (-2075.846) (-2077.482) (-2077.532) [-2081.399] * (-2091.419) (-2077.747) (-2079.175) [-2072.759] -- 0:00:35
877800 -- (-2074.997) [-2073.937] (-2073.482) (-2082.838) * (-2072.062) [-2073.589] (-2082.912) (-2071.654) -- 0:00:35
877900 -- (-2081.245) (-2079.628) [-2072.572] (-2091.264) * (-2071.615) [-2075.437] (-2084.914) (-2076.284) -- 0:00:35
878000 -- (-2085.617) (-2075.118) [-2074.898] (-2082.998) * (-2081.589) (-2076.887) (-2084.391) [-2073.383] -- 0:00:35
Average standard deviation of split frequencies: 0.003267
878100 -- (-2091.492) (-2076.432) [-2073.370] (-2089.428) * (-2096.014) (-2075.275) (-2075.915) [-2072.567] -- 0:00:34
878200 -- (-2090.389) [-2086.790] (-2073.769) (-2075.130) * (-2083.316) (-2072.441) (-2078.979) [-2072.737] -- 0:00:34
878300 -- (-2077.620) (-2088.059) [-2074.692] (-2074.740) * [-2076.819] (-2075.671) (-2082.404) (-2069.190) -- 0:00:34
878400 -- (-2078.787) (-2078.590) [-2072.455] (-2078.457) * (-2077.866) (-2077.747) [-2085.750] (-2072.297) -- 0:00:34
878500 -- [-2076.932] (-2087.602) (-2084.719) (-2079.257) * [-2083.090] (-2071.643) (-2075.006) (-2083.348) -- 0:00:34
878600 -- (-2077.354) (-2077.408) (-2080.395) [-2073.590] * (-2077.864) [-2078.831] (-2081.460) (-2081.587) -- 0:00:34
878700 -- (-2086.333) (-2078.743) [-2081.459] (-2073.366) * (-2086.303) [-2074.642] (-2079.046) (-2077.022) -- 0:00:34
878800 -- (-2086.414) (-2077.099) (-2080.645) [-2073.646] * (-2078.402) [-2070.180] (-2083.401) (-2083.346) -- 0:00:34
878900 -- (-2083.833) (-2074.798) (-2077.658) [-2079.232] * (-2072.899) [-2074.646] (-2080.084) (-2075.468) -- 0:00:34
879000 -- (-2081.155) (-2076.487) [-2081.439] (-2080.031) * (-2073.362) [-2067.204] (-2084.226) (-2084.530) -- 0:00:34
Average standard deviation of split frequencies: 0.003416
879100 -- (-2080.285) [-2074.054] (-2089.942) (-2076.883) * [-2074.053] (-2070.581) (-2075.440) (-2083.609) -- 0:00:34
879200 -- [-2080.207] (-2076.711) (-2083.160) (-2070.868) * (-2078.508) [-2069.514] (-2077.579) (-2079.852) -- 0:00:34
879300 -- (-2083.452) (-2074.879) (-2079.907) [-2071.320] * (-2080.613) (-2074.706) (-2078.210) [-2078.848] -- 0:00:34
879400 -- (-2078.908) (-2074.836) [-2074.816] (-2075.879) * (-2078.717) [-2075.223] (-2073.709) (-2080.324) -- 0:00:34
879500 -- (-2076.300) (-2083.732) [-2076.925] (-2078.291) * (-2078.136) (-2071.109) [-2072.521] (-2076.901) -- 0:00:34
879600 -- [-2076.733] (-2076.751) (-2080.956) (-2082.609) * (-2080.664) [-2072.686] (-2076.061) (-2072.473) -- 0:00:34
879700 -- [-2076.609] (-2081.407) (-2081.656) (-2091.141) * (-2083.612) (-2073.376) (-2079.957) [-2073.749] -- 0:00:34
879800 -- [-2076.163] (-2079.955) (-2078.108) (-2086.764) * (-2080.050) (-2073.061) (-2080.594) [-2073.471] -- 0:00:34
879900 -- (-2086.171) (-2078.590) (-2088.652) [-2082.921] * (-2079.357) [-2077.958] (-2087.175) (-2074.120) -- 0:00:34
880000 -- (-2097.536) (-2078.039) (-2087.938) [-2077.632] * (-2080.578) [-2070.133] (-2081.375) (-2070.086) -- 0:00:34
Average standard deviation of split frequencies: 0.003520
880100 -- (-2086.575) (-2086.123) (-2083.972) [-2080.170] * (-2080.232) [-2070.545] (-2082.387) (-2074.892) -- 0:00:34
880200 -- [-2077.214] (-2079.696) (-2083.910) (-2079.968) * (-2082.995) (-2069.928) (-2078.243) [-2071.524] -- 0:00:34
880300 -- (-2075.819) (-2076.353) (-2085.152) [-2074.750] * (-2081.632) (-2074.579) [-2071.817] (-2070.352) -- 0:00:34
880400 -- (-2081.693) (-2081.093) (-2082.137) [-2076.017] * (-2080.308) [-2078.645] (-2077.572) (-2071.819) -- 0:00:34
880500 -- (-2082.575) (-2086.343) [-2081.544] (-2078.494) * [-2081.132] (-2075.262) (-2077.881) (-2075.096) -- 0:00:34
880600 -- [-2084.395] (-2089.538) (-2086.640) (-2073.470) * (-2084.758) (-2078.728) (-2084.477) [-2077.448] -- 0:00:34
880700 -- (-2080.548) [-2082.302] (-2094.542) (-2084.627) * (-2076.789) (-2077.849) (-2075.306) [-2078.313] -- 0:00:34
880800 -- [-2074.225] (-2088.225) (-2100.936) (-2085.417) * (-2077.098) (-2083.415) [-2080.229] (-2075.564) -- 0:00:34
880900 -- [-2080.239] (-2087.383) (-2085.038) (-2082.998) * (-2079.956) (-2076.324) (-2073.199) [-2075.072] -- 0:00:34
881000 -- (-2080.712) (-2086.922) [-2080.858] (-2080.358) * (-2079.587) (-2071.263) (-2078.587) [-2074.438] -- 0:00:34
Average standard deviation of split frequencies: 0.003546
881100 -- [-2077.387] (-2089.163) (-2085.458) (-2077.686) * (-2080.087) (-2074.429) (-2073.314) [-2070.405] -- 0:00:34
881200 -- (-2082.571) [-2079.720] (-2085.507) (-2072.538) * (-2078.499) [-2079.392] (-2077.909) (-2072.735) -- 0:00:34
881300 -- (-2077.325) (-2084.792) [-2081.636] (-2072.417) * (-2073.209) (-2072.173) [-2068.873] (-2078.748) -- 0:00:34
881400 -- (-2082.747) (-2080.581) (-2094.044) [-2073.023] * (-2072.629) (-2070.340) [-2073.113] (-2077.694) -- 0:00:34
881500 -- (-2089.427) (-2083.247) (-2081.435) [-2068.803] * (-2077.912) (-2083.462) [-2068.917] (-2085.601) -- 0:00:34
881600 -- (-2081.140) (-2079.715) (-2075.932) [-2067.492] * (-2076.287) (-2075.506) [-2069.708] (-2088.011) -- 0:00:33
881700 -- (-2082.353) (-2081.349) (-2078.909) [-2070.955] * (-2078.249) (-2074.336) [-2068.508] (-2085.423) -- 0:00:33
881800 -- [-2079.699] (-2088.931) (-2077.093) (-2071.656) * [-2077.162] (-2078.601) (-2075.199) (-2074.695) -- 0:00:33
881900 -- (-2079.330) (-2082.285) (-2078.974) [-2071.341] * (-2078.516) (-2084.077) [-2068.787] (-2072.562) -- 0:00:33
882000 -- (-2075.036) (-2094.374) (-2074.898) [-2069.226] * (-2078.212) (-2084.520) (-2069.470) [-2070.791] -- 0:00:33
Average standard deviation of split frequencies: 0.003542
882100 -- (-2078.795) (-2089.967) (-2077.942) [-2068.686] * (-2080.390) (-2090.961) (-2073.210) [-2073.481] -- 0:00:33
882200 -- (-2080.392) (-2082.534) (-2074.952) [-2073.423] * [-2071.899] (-2092.520) (-2067.627) (-2079.390) -- 0:00:33
882300 -- (-2080.977) (-2090.219) [-2078.112] (-2073.438) * (-2076.317) (-2092.456) [-2067.756] (-2076.191) -- 0:00:33
882400 -- [-2077.581] (-2079.554) (-2074.297) (-2073.556) * (-2080.315) (-2095.144) [-2070.348] (-2075.018) -- 0:00:33
882500 -- (-2091.999) (-2080.123) (-2080.008) [-2073.126] * (-2085.527) (-2088.758) [-2071.869] (-2073.622) -- 0:00:33
882600 -- (-2083.186) (-2080.588) (-2078.493) [-2071.041] * (-2085.286) (-2077.570) (-2079.051) [-2075.649] -- 0:00:33
882700 -- (-2078.346) (-2082.572) (-2074.590) [-2074.670] * (-2078.762) (-2075.628) [-2071.247] (-2084.199) -- 0:00:33
882800 -- [-2075.290] (-2079.092) (-2078.784) (-2072.026) * (-2080.759) (-2077.075) [-2071.835] (-2074.917) -- 0:00:33
882900 -- (-2075.061) (-2079.765) (-2079.951) [-2074.342] * (-2078.324) (-2086.715) (-2071.044) [-2081.977] -- 0:00:33
883000 -- (-2079.574) (-2083.481) (-2092.200) [-2070.325] * (-2078.317) (-2084.027) [-2070.744] (-2086.690) -- 0:00:33
Average standard deviation of split frequencies: 0.003828
883100 -- (-2076.460) (-2081.563) [-2086.344] (-2075.273) * (-2078.470) (-2076.118) [-2073.857] (-2077.290) -- 0:00:33
883200 -- (-2096.362) (-2076.843) [-2078.381] (-2081.266) * (-2087.446) (-2078.753) [-2075.867] (-2076.784) -- 0:00:33
883300 -- (-2087.866) [-2078.979] (-2085.074) (-2089.920) * [-2085.475] (-2081.188) (-2079.344) (-2076.788) -- 0:00:33
883400 -- (-2091.551) [-2073.254] (-2084.708) (-2085.532) * (-2077.140) (-2077.097) (-2078.335) [-2074.436] -- 0:00:33
883500 -- (-2084.365) (-2080.660) [-2083.468] (-2076.510) * (-2081.444) (-2075.438) (-2073.462) [-2072.540] -- 0:00:33
883600 -- (-2082.711) [-2078.942] (-2079.551) (-2076.586) * (-2078.369) [-2072.031] (-2073.300) (-2070.374) -- 0:00:33
883700 -- [-2077.982] (-2085.735) (-2077.116) (-2076.619) * (-2080.679) (-2073.535) [-2074.854] (-2074.405) -- 0:00:33
883800 -- (-2078.187) (-2082.083) [-2075.477] (-2078.308) * (-2082.260) (-2076.320) [-2077.187] (-2080.248) -- 0:00:33
883900 -- (-2080.855) (-2078.858) (-2082.416) [-2076.663] * (-2092.273) (-2070.529) (-2076.893) [-2083.335] -- 0:00:33
884000 -- (-2096.954) (-2081.320) [-2081.066] (-2077.867) * (-2087.006) (-2074.819) (-2089.683) [-2076.658] -- 0:00:33
Average standard deviation of split frequencies: 0.003824
884100 -- (-2086.585) [-2080.046] (-2074.809) (-2085.260) * (-2074.322) [-2072.035] (-2080.748) (-2085.197) -- 0:00:33
884200 -- (-2079.587) (-2079.106) [-2073.829] (-2084.918) * (-2078.676) [-2078.597] (-2072.086) (-2091.772) -- 0:00:33
884300 -- (-2090.910) (-2075.586) (-2079.114) [-2076.436] * (-2077.945) (-2073.724) (-2070.364) [-2072.787] -- 0:00:33
884400 -- (-2087.953) (-2083.999) [-2075.152] (-2074.486) * (-2089.363) (-2076.192) [-2070.875] (-2083.446) -- 0:00:33
884500 -- (-2091.643) (-2079.091) [-2076.537] (-2074.185) * (-2075.704) [-2071.178] (-2079.609) (-2089.285) -- 0:00:33
884600 -- (-2080.627) (-2079.723) (-2073.130) [-2069.491] * (-2074.654) [-2070.817] (-2078.292) (-2093.194) -- 0:00:33
884700 -- (-2083.081) (-2084.500) (-2078.943) [-2069.821] * (-2079.694) [-2069.482] (-2084.025) (-2088.009) -- 0:00:33
884800 -- (-2091.680) (-2080.395) (-2085.301) [-2071.952] * (-2081.756) [-2071.008] (-2076.516) (-2090.839) -- 0:00:33
884900 -- (-2085.960) [-2074.953] (-2079.024) (-2077.088) * (-2085.886) [-2075.525] (-2080.163) (-2082.729) -- 0:00:33
885000 -- (-2080.158) (-2081.881) (-2079.034) [-2078.205] * (-2077.911) [-2068.774] (-2073.509) (-2077.250) -- 0:00:33
Average standard deviation of split frequencies: 0.003713
885100 -- (-2077.698) (-2077.208) [-2075.676] (-2080.373) * [-2076.188] (-2074.032) (-2075.252) (-2074.042) -- 0:00:32
885200 -- (-2074.245) [-2072.421] (-2081.477) (-2086.500) * (-2077.930) (-2081.423) (-2073.803) [-2078.617] -- 0:00:32
885300 -- [-2075.718] (-2074.142) (-2088.019) (-2094.634) * (-2078.680) [-2071.723] (-2073.603) (-2090.262) -- 0:00:32
885400 -- [-2076.579] (-2075.115) (-2091.550) (-2086.618) * (-2085.097) [-2075.567] (-2073.381) (-2076.225) -- 0:00:32
885500 -- (-2075.085) [-2080.986] (-2077.645) (-2080.489) * (-2084.800) (-2072.963) (-2076.200) [-2071.690] -- 0:00:32
885600 -- (-2075.051) [-2076.296] (-2081.369) (-2078.404) * (-2076.881) [-2074.027] (-2077.472) (-2077.653) -- 0:00:32
885700 -- (-2081.060) (-2070.996) (-2091.438) [-2079.446] * [-2074.167] (-2078.802) (-2076.372) (-2074.740) -- 0:00:32
885800 -- (-2083.484) [-2072.727] (-2080.089) (-2076.223) * [-2075.946] (-2076.449) (-2072.318) (-2071.046) -- 0:00:32
885900 -- [-2078.206] (-2077.362) (-2077.406) (-2071.339) * [-2080.462] (-2070.482) (-2084.795) (-2074.905) -- 0:00:32
886000 -- (-2078.276) (-2080.024) (-2073.572) [-2071.878] * (-2083.807) (-2073.902) (-2085.023) [-2075.495] -- 0:00:32
Average standard deviation of split frequencies: 0.003511
886100 -- (-2084.152) [-2076.484] (-2078.255) (-2076.352) * (-2086.883) [-2076.904] (-2085.318) (-2079.920) -- 0:00:32
886200 -- (-2093.293) [-2077.438] (-2084.211) (-2078.791) * [-2078.553] (-2075.223) (-2081.625) (-2066.532) -- 0:00:32
886300 -- (-2085.730) (-2083.804) (-2083.167) [-2071.722] * (-2084.171) [-2077.162] (-2079.588) (-2073.446) -- 0:00:32
886400 -- (-2079.690) (-2083.824) (-2089.140) [-2072.024] * [-2074.983] (-2084.469) (-2078.047) (-2073.995) -- 0:00:32
886500 -- (-2089.236) [-2081.703] (-2083.628) (-2075.561) * [-2083.806] (-2085.984) (-2082.990) (-2070.049) -- 0:00:32
886600 -- (-2091.376) (-2089.176) (-2086.969) [-2073.403] * (-2084.850) (-2077.414) (-2084.060) [-2067.670] -- 0:00:32
886700 -- (-2110.609) (-2080.371) (-2080.983) [-2080.454] * (-2082.445) [-2076.732] (-2083.135) (-2074.159) -- 0:00:32
886800 -- (-2100.406) (-2080.843) (-2080.550) [-2080.695] * (-2085.436) (-2078.590) (-2084.475) [-2071.192] -- 0:00:32
886900 -- (-2083.839) (-2081.404) [-2077.026] (-2081.348) * (-2084.852) (-2073.486) [-2079.036] (-2074.928) -- 0:00:32
887000 -- (-2082.273) (-2086.600) [-2078.946] (-2075.170) * (-2078.937) [-2069.185] (-2083.970) (-2089.161) -- 0:00:32
Average standard deviation of split frequencies: 0.003416
887100 -- (-2095.814) (-2089.493) (-2080.971) [-2073.591] * (-2089.427) [-2071.387] (-2077.922) (-2091.871) -- 0:00:32
887200 -- (-2092.990) [-2081.409] (-2080.097) (-2077.920) * (-2084.552) [-2071.453] (-2078.601) (-2093.322) -- 0:00:32
887300 -- (-2090.599) (-2086.124) [-2076.764] (-2072.425) * (-2098.099) [-2070.118] (-2076.844) (-2074.676) -- 0:00:32
887400 -- (-2081.984) (-2085.332) (-2077.459) [-2070.941] * (-2083.224) [-2071.399] (-2082.899) (-2073.242) -- 0:00:32
887500 -- (-2083.505) [-2079.360] (-2084.070) (-2071.756) * (-2076.448) [-2073.804] (-2081.094) (-2072.004) -- 0:00:32
887600 -- (-2081.090) (-2078.425) (-2082.942) [-2075.446] * (-2084.513) [-2072.092] (-2087.873) (-2075.099) -- 0:00:32
887700 -- (-2079.904) [-2078.364] (-2076.416) (-2074.252) * (-2075.537) [-2068.900] (-2093.708) (-2074.290) -- 0:00:32
887800 -- (-2076.900) (-2084.782) (-2086.802) [-2077.612] * (-2082.660) [-2070.610] (-2087.264) (-2074.078) -- 0:00:32
887900 -- (-2077.490) [-2080.182] (-2081.622) (-2074.069) * [-2075.202] (-2073.891) (-2082.807) (-2075.668) -- 0:00:32
888000 -- (-2080.801) (-2075.724) (-2089.313) [-2070.630] * (-2079.759) (-2077.345) (-2081.885) [-2074.149] -- 0:00:32
Average standard deviation of split frequencies: 0.003291
888100 -- (-2075.752) (-2081.195) (-2086.802) [-2075.026] * (-2086.201) (-2079.807) [-2073.910] (-2076.369) -- 0:00:32
888200 -- (-2077.337) (-2080.134) (-2082.538) [-2078.212] * (-2080.790) (-2073.683) (-2077.255) [-2080.421] -- 0:00:32
888300 -- [-2073.358] (-2081.904) (-2076.886) (-2069.211) * (-2086.386) [-2079.520] (-2078.442) (-2095.586) -- 0:00:32
888400 -- [-2072.463] (-2085.973) (-2076.073) (-2068.984) * (-2083.263) [-2076.606] (-2077.011) (-2091.806) -- 0:00:32
888500 -- [-2075.159] (-2081.482) (-2080.703) (-2070.360) * (-2086.992) (-2076.798) (-2078.807) [-2071.336] -- 0:00:32
888600 -- [-2077.344] (-2084.715) (-2091.383) (-2074.215) * (-2081.234) (-2078.388) (-2084.441) [-2072.480] -- 0:00:31
888700 -- (-2075.181) (-2093.564) (-2079.715) [-2074.296] * [-2083.514] (-2078.951) (-2085.909) (-2076.168) -- 0:00:31
888800 -- (-2078.342) (-2083.282) (-2080.464) [-2074.460] * [-2080.741] (-2073.751) (-2083.415) (-2078.018) -- 0:00:31
888900 -- (-2081.075) (-2088.158) (-2083.331) [-2075.623] * (-2086.272) [-2076.108] (-2078.343) (-2077.402) -- 0:00:31
889000 -- (-2085.341) [-2082.215] (-2075.020) (-2081.344) * (-2089.321) (-2085.208) (-2085.279) [-2078.825] -- 0:00:31
Average standard deviation of split frequencies: 0.003302
889100 -- (-2077.884) (-2079.242) (-2081.231) [-2076.296] * (-2082.034) (-2083.863) (-2082.865) [-2073.425] -- 0:00:31
889200 -- [-2076.246] (-2079.937) (-2090.584) (-2075.238) * (-2080.172) (-2085.076) [-2084.701] (-2072.962) -- 0:00:31
889300 -- [-2072.723] (-2087.203) (-2080.531) (-2084.552) * (-2088.477) (-2083.389) (-2088.189) [-2076.744] -- 0:00:31
889400 -- [-2080.246] (-2077.858) (-2078.771) (-2084.391) * (-2083.474) (-2076.861) (-2090.492) [-2074.795] -- 0:00:31
889500 -- (-2089.273) [-2075.026] (-2080.652) (-2085.032) * (-2086.629) (-2078.646) (-2091.196) [-2074.390] -- 0:00:31
889600 -- (-2081.794) [-2074.569] (-2087.372) (-2080.511) * (-2080.701) [-2074.330] (-2094.742) (-2078.344) -- 0:00:31
889700 -- (-2082.112) [-2073.430] (-2084.171) (-2079.127) * (-2077.879) [-2069.210] (-2091.786) (-2079.318) -- 0:00:31
889800 -- (-2084.364) [-2077.475] (-2084.467) (-2077.609) * (-2088.090) (-2069.779) [-2075.252] (-2083.092) -- 0:00:31
889900 -- [-2075.269] (-2079.808) (-2079.487) (-2077.126) * (-2088.652) (-2075.627) [-2078.789] (-2079.628) -- 0:00:31
890000 -- (-2079.557) [-2075.655] (-2079.641) (-2076.816) * (-2088.098) [-2072.336] (-2084.854) (-2075.272) -- 0:00:31
Average standard deviation of split frequencies: 0.003253
890100 -- (-2082.521) (-2084.166) [-2076.928] (-2084.967) * (-2076.861) [-2067.397] (-2087.369) (-2079.391) -- 0:00:31
890200 -- [-2076.358] (-2080.536) (-2075.598) (-2078.139) * (-2083.053) (-2070.169) (-2093.741) [-2077.263] -- 0:00:31
890300 -- (-2082.782) (-2085.592) [-2082.244] (-2075.265) * (-2080.987) [-2074.889] (-2089.800) (-2072.108) -- 0:00:31
890400 -- (-2079.908) (-2080.866) (-2087.434) [-2076.119] * (-2076.642) (-2068.884) (-2079.405) [-2074.587] -- 0:00:31
890500 -- (-2077.468) [-2078.837] (-2085.297) (-2075.824) * (-2078.672) [-2070.728] (-2080.474) (-2081.262) -- 0:00:31
890600 -- (-2081.453) [-2073.522] (-2084.938) (-2081.070) * [-2074.147] (-2080.188) (-2074.047) (-2085.512) -- 0:00:31
890700 -- (-2081.933) [-2081.434] (-2081.476) (-2079.243) * (-2081.729) [-2069.291] (-2081.348) (-2088.195) -- 0:00:31
890800 -- (-2083.209) (-2084.060) (-2080.985) [-2078.645] * (-2092.298) [-2072.335] (-2081.598) (-2086.004) -- 0:00:31
890900 -- (-2078.645) (-2084.666) (-2082.204) [-2075.822] * (-2089.100) [-2071.674] (-2089.900) (-2084.560) -- 0:00:31
891000 -- [-2071.261] (-2098.056) (-2081.663) (-2077.628) * (-2090.653) [-2079.830] (-2088.535) (-2079.675) -- 0:00:31
Average standard deviation of split frequencies: 0.003249
891100 -- (-2083.110) [-2078.437] (-2081.278) (-2084.381) * (-2087.426) [-2075.611] (-2085.310) (-2080.240) -- 0:00:31
891200 -- (-2076.727) (-2079.074) (-2091.827) [-2078.710] * (-2083.706) [-2071.665] (-2078.006) (-2093.629) -- 0:00:31
891300 -- (-2080.063) (-2076.690) (-2093.504) [-2076.047] * (-2078.974) (-2072.695) [-2077.692] (-2077.949) -- 0:00:31
891400 -- [-2078.446] (-2092.554) (-2095.196) (-2077.957) * (-2081.242) [-2069.410] (-2077.695) (-2084.546) -- 0:00:31
891500 -- [-2080.575] (-2085.401) (-2090.048) (-2071.877) * [-2077.843] (-2079.417) (-2080.728) (-2077.680) -- 0:00:31
891600 -- (-2079.437) (-2084.258) (-2082.917) [-2073.209] * (-2081.193) (-2073.617) (-2078.300) [-2073.664] -- 0:00:31
891700 -- (-2085.721) (-2079.699) (-2076.015) [-2071.372] * (-2087.874) (-2080.427) (-2081.039) [-2079.612] -- 0:00:31
891800 -- (-2085.606) (-2080.133) [-2078.396] (-2073.817) * (-2077.155) (-2073.563) (-2090.012) [-2078.546] -- 0:00:31
891900 -- (-2088.683) (-2088.043) (-2077.040) [-2077.894] * (-2078.146) [-2070.190] (-2082.590) (-2082.633) -- 0:00:31
892000 -- (-2095.452) (-2092.148) (-2079.209) [-2071.023] * (-2075.106) [-2071.615] (-2084.801) (-2071.708) -- 0:00:30
Average standard deviation of split frequencies: 0.003231
892100 -- (-2082.861) (-2084.910) (-2078.739) [-2070.442] * (-2074.987) [-2071.488] (-2083.104) (-2085.982) -- 0:00:30
892200 -- (-2076.759) (-2075.837) (-2083.653) [-2069.618] * (-2076.527) [-2071.875] (-2090.547) (-2081.694) -- 0:00:30
892300 -- (-2090.690) [-2074.105] (-2080.132) (-2081.251) * [-2075.337] (-2074.585) (-2074.927) (-2083.912) -- 0:00:30
892400 -- (-2086.200) (-2080.964) (-2078.671) [-2079.137] * (-2080.016) (-2075.622) (-2087.471) [-2074.157] -- 0:00:30
892500 -- (-2086.515) (-2087.882) (-2086.792) [-2074.486] * (-2088.975) [-2071.300] (-2077.351) (-2075.879) -- 0:00:30
892600 -- (-2085.775) (-2078.843) (-2084.794) [-2072.281] * (-2082.895) [-2075.057] (-2078.285) (-2075.656) -- 0:00:30
892700 -- (-2086.487) [-2074.471] (-2077.894) (-2075.688) * (-2093.895) [-2076.236] (-2080.277) (-2077.341) -- 0:00:30
892800 -- (-2085.328) (-2081.401) (-2080.849) [-2073.206] * (-2093.051) (-2069.718) [-2075.779] (-2080.478) -- 0:00:30
892900 -- (-2086.452) (-2080.392) [-2079.736] (-2082.021) * (-2083.286) [-2078.323] (-2074.773) (-2076.998) -- 0:00:30
893000 -- [-2079.064] (-2082.173) (-2078.541) (-2077.431) * (-2091.403) (-2072.605) (-2073.233) [-2070.534] -- 0:00:30
Average standard deviation of split frequencies: 0.003317
893100 -- (-2076.263) (-2083.463) (-2081.606) [-2078.303] * (-2080.796) [-2075.477] (-2079.180) (-2073.093) -- 0:00:30
893200 -- (-2071.759) [-2082.068] (-2089.736) (-2085.953) * (-2084.282) (-2075.976) (-2085.920) [-2072.054] -- 0:00:30
893300 -- (-2075.106) [-2078.368] (-2077.777) (-2077.461) * (-2082.841) (-2080.791) (-2090.504) [-2075.897] -- 0:00:30
893400 -- (-2077.921) [-2079.506] (-2083.169) (-2079.374) * (-2075.486) (-2084.191) (-2081.551) [-2070.460] -- 0:00:30
893500 -- (-2078.087) (-2083.759) [-2079.949] (-2076.080) * (-2074.908) (-2083.587) (-2087.520) [-2074.773] -- 0:00:30
893600 -- (-2076.335) [-2079.635] (-2080.089) (-2075.396) * (-2087.493) (-2080.781) (-2080.105) [-2072.045] -- 0:00:30
893700 -- (-2080.516) (-2083.292) (-2081.804) [-2071.361] * (-2079.656) [-2085.092] (-2084.940) (-2077.101) -- 0:00:30
893800 -- (-2080.514) (-2077.532) (-2086.083) [-2077.313] * [-2070.468] (-2090.085) (-2084.771) (-2076.754) -- 0:00:30
893900 -- (-2077.395) (-2090.982) (-2081.696) [-2076.572] * [-2073.779] (-2088.247) (-2084.600) (-2075.840) -- 0:00:30
894000 -- (-2079.916) (-2082.188) [-2076.243] (-2073.122) * (-2071.277) (-2086.374) (-2082.186) [-2076.935] -- 0:00:30
Average standard deviation of split frequencies: 0.003314
894100 -- [-2079.378] (-2085.119) (-2077.369) (-2074.818) * [-2074.073] (-2079.112) (-2082.504) (-2073.547) -- 0:00:30
894200 -- [-2076.469] (-2090.216) (-2080.557) (-2077.437) * (-2074.003) (-2079.782) (-2085.144) [-2075.680] -- 0:00:30
894300 -- (-2076.880) (-2083.940) (-2077.831) [-2072.616] * (-2080.065) (-2082.416) (-2084.963) [-2072.589] -- 0:00:30
894400 -- [-2077.794] (-2089.646) (-2075.011) (-2078.259) * [-2073.765] (-2085.917) (-2084.176) (-2076.184) -- 0:00:30
894500 -- (-2081.421) (-2087.501) [-2074.333] (-2078.009) * (-2074.047) (-2091.406) [-2083.060] (-2080.800) -- 0:00:30
894600 -- (-2081.459) (-2096.290) [-2074.466] (-2078.888) * (-2074.593) (-2095.177) (-2083.399) [-2070.875] -- 0:00:30
894700 -- [-2075.552] (-2082.438) (-2078.366) (-2073.664) * (-2077.319) (-2098.485) (-2078.907) [-2072.855] -- 0:00:30
894800 -- (-2076.248) (-2086.751) (-2072.544) [-2071.972] * [-2076.591] (-2088.438) (-2087.458) (-2072.077) -- 0:00:30
894900 -- [-2079.535] (-2082.938) (-2078.109) (-2072.813) * (-2079.039) (-2086.229) (-2086.001) [-2071.742] -- 0:00:30
895000 -- (-2086.166) (-2084.800) (-2086.229) [-2071.860] * (-2081.656) (-2079.159) (-2077.031) [-2076.440] -- 0:00:30
Average standard deviation of split frequencies: 0.003460
895100 -- (-2088.151) (-2078.541) (-2076.282) [-2071.862] * (-2075.123) [-2080.714] (-2078.464) (-2073.159) -- 0:00:30
895200 -- (-2079.676) (-2080.522) (-2077.982) [-2072.419] * (-2077.922) (-2076.592) (-2081.804) [-2071.120] -- 0:00:30
895300 -- (-2083.222) (-2079.392) [-2080.257] (-2077.760) * [-2074.327] (-2075.350) (-2079.247) (-2076.097) -- 0:00:30
895400 -- (-2080.293) (-2081.226) (-2076.809) [-2072.618] * (-2075.718) [-2076.543] (-2083.899) (-2085.836) -- 0:00:30
895500 -- (-2083.196) [-2077.022] (-2083.660) (-2074.235) * (-2078.060) [-2073.246] (-2090.622) (-2080.097) -- 0:00:29
895600 -- (-2078.431) (-2082.230) (-2090.218) [-2076.054] * (-2076.017) [-2073.791] (-2089.382) (-2083.530) -- 0:00:29
895700 -- (-2082.095) (-2078.748) [-2079.106] (-2082.472) * (-2075.462) [-2077.609] (-2082.218) (-2086.238) -- 0:00:29
895800 -- (-2088.626) (-2077.411) [-2082.348] (-2084.636) * [-2077.951] (-2085.212) (-2089.165) (-2089.303) -- 0:00:29
895900 -- (-2083.813) (-2076.306) [-2076.866] (-2081.137) * (-2078.873) [-2080.249] (-2081.832) (-2085.108) -- 0:00:29
896000 -- (-2085.038) [-2075.883] (-2080.476) (-2077.755) * [-2075.475] (-2080.125) (-2088.178) (-2081.432) -- 0:00:29
Average standard deviation of split frequencies: 0.003562
896100 -- (-2084.433) [-2077.107] (-2078.602) (-2069.314) * [-2079.962] (-2081.962) (-2087.395) (-2084.034) -- 0:00:29
896200 -- (-2080.427) (-2088.581) (-2080.379) [-2069.696] * (-2073.640) (-2080.871) (-2085.418) [-2080.097] -- 0:00:29
896300 -- (-2082.330) (-2081.841) (-2082.711) [-2069.542] * (-2075.083) (-2082.781) (-2082.520) [-2078.175] -- 0:00:29
896400 -- (-2083.335) [-2076.411] (-2085.008) (-2070.017) * (-2084.164) (-2085.165) (-2089.004) [-2077.081] -- 0:00:29
896500 -- (-2081.554) (-2086.495) (-2093.671) [-2074.205] * (-2086.733) (-2088.598) (-2081.995) [-2078.027] -- 0:00:29
896600 -- (-2083.535) (-2084.431) [-2078.653] (-2074.210) * (-2074.178) (-2089.524) [-2076.068] (-2076.862) -- 0:00:29
896700 -- (-2084.051) (-2083.261) (-2079.745) [-2069.852] * (-2086.031) (-2083.719) [-2078.574] (-2078.005) -- 0:00:29
896800 -- (-2080.723) (-2085.311) (-2084.104) [-2071.018] * (-2093.845) (-2084.766) (-2074.602) [-2074.281] -- 0:00:29
896900 -- [-2077.353] (-2099.541) (-2079.330) (-2073.091) * (-2079.905) (-2084.879) [-2072.972] (-2079.111) -- 0:00:29
897000 -- (-2077.593) (-2080.931) (-2081.888) [-2080.076] * (-2081.219) (-2085.830) [-2079.224] (-2083.557) -- 0:00:29
Average standard deviation of split frequencies: 0.003693
897100 -- (-2079.640) (-2086.656) (-2084.715) [-2073.788] * (-2090.746) (-2079.929) [-2072.845] (-2086.991) -- 0:00:29
897200 -- (-2083.192) (-2079.888) (-2084.644) [-2074.084] * (-2085.516) (-2081.494) (-2076.289) [-2080.406] -- 0:00:29
897300 -- (-2080.820) (-2076.005) [-2077.720] (-2082.173) * (-2086.231) (-2084.988) [-2071.855] (-2079.950) -- 0:00:29
897400 -- (-2086.862) (-2080.238) [-2075.686] (-2076.845) * (-2094.440) (-2080.277) [-2070.174] (-2083.379) -- 0:00:29
897500 -- [-2086.131] (-2083.205) (-2083.159) (-2074.782) * (-2082.250) (-2087.343) [-2074.188] (-2079.512) -- 0:00:29
897600 -- (-2087.722) (-2082.495) (-2083.274) [-2075.691] * (-2094.450) (-2084.894) (-2077.675) [-2078.527] -- 0:00:29
897700 -- (-2088.102) (-2076.494) (-2082.680) [-2070.659] * (-2087.390) (-2092.006) [-2076.913] (-2080.442) -- 0:00:29
897800 -- (-2082.429) (-2085.873) [-2078.277] (-2080.062) * [-2076.237] (-2084.086) (-2083.005) (-2076.624) -- 0:00:29
897900 -- (-2077.937) (-2074.399) (-2079.062) [-2074.450] * (-2076.356) (-2077.222) [-2081.774] (-2073.032) -- 0:00:29
898000 -- (-2080.311) [-2074.755] (-2078.344) (-2076.640) * (-2078.344) (-2082.724) (-2079.987) [-2074.474] -- 0:00:29
Average standard deviation of split frequencies: 0.003734
898100 -- (-2080.439) [-2067.813] (-2079.238) (-2075.106) * (-2077.355) (-2087.967) [-2079.345] (-2078.772) -- 0:00:29
898200 -- (-2094.733) [-2071.113] (-2080.283) (-2070.453) * (-2078.245) (-2084.827) (-2083.204) [-2073.186] -- 0:00:29
898300 -- (-2090.286) (-2073.293) (-2078.697) [-2070.585] * (-2086.844) (-2082.091) (-2073.456) [-2072.357] -- 0:00:29
898400 -- (-2085.739) (-2079.405) [-2079.726] (-2067.562) * (-2081.670) (-2083.712) (-2084.447) [-2078.608] -- 0:00:29
898500 -- (-2085.961) (-2076.511) [-2072.011] (-2075.889) * (-2083.841) [-2084.272] (-2078.729) (-2081.401) -- 0:00:29
898600 -- [-2084.955] (-2076.284) (-2082.734) (-2073.984) * [-2073.668] (-2080.036) (-2079.211) (-2078.381) -- 0:00:29
898700 -- (-2077.925) (-2076.008) (-2073.528) [-2071.442] * (-2078.013) [-2072.210] (-2086.211) (-2085.292) -- 0:00:29
898800 -- (-2078.335) [-2078.560] (-2074.401) (-2082.019) * (-2072.018) [-2078.310] (-2085.575) (-2085.388) -- 0:00:29
898900 -- (-2079.331) (-2078.201) [-2076.055] (-2074.847) * (-2084.062) (-2074.775) [-2075.996] (-2082.777) -- 0:00:29
899000 -- (-2080.105) (-2076.188) (-2077.813) [-2072.699] * (-2081.310) [-2077.990] (-2079.078) (-2082.994) -- 0:00:28
Average standard deviation of split frequencies: 0.003775
899100 -- (-2079.270) (-2080.451) (-2080.396) [-2068.139] * (-2085.161) (-2081.110) [-2077.513] (-2087.537) -- 0:00:28
899200 -- (-2083.752) (-2084.184) (-2079.568) [-2070.359] * (-2079.348) (-2078.975) [-2076.616] (-2083.064) -- 0:00:28
899300 -- (-2086.140) (-2084.921) (-2087.287) [-2068.733] * [-2079.665] (-2084.882) (-2078.976) (-2085.600) -- 0:00:28
899400 -- (-2088.307) (-2082.478) [-2073.123] (-2071.660) * (-2081.721) (-2080.157) [-2079.412] (-2079.141) -- 0:00:28
899500 -- (-2079.964) (-2084.638) [-2077.276] (-2074.713) * (-2083.761) [-2084.288] (-2083.744) (-2082.655) -- 0:00:28
899600 -- (-2081.337) (-2083.350) (-2075.787) [-2070.819] * (-2084.893) [-2079.676] (-2093.067) (-2082.549) -- 0:00:28
899700 -- (-2078.775) [-2075.789] (-2085.809) (-2076.387) * [-2079.937] (-2077.521) (-2083.658) (-2080.119) -- 0:00:28
899800 -- (-2082.964) (-2078.917) (-2081.747) [-2071.577] * [-2075.291] (-2080.842) (-2087.106) (-2077.436) -- 0:00:28
899900 -- (-2083.873) (-2083.120) [-2086.418] (-2071.862) * (-2077.755) (-2075.212) [-2079.388] (-2079.698) -- 0:00:28
900000 -- (-2078.399) (-2083.245) (-2081.741) [-2075.770] * [-2077.974] (-2073.718) (-2093.080) (-2081.684) -- 0:00:28
Average standard deviation of split frequencies: 0.003741
900100 -- (-2093.307) [-2076.672] (-2092.718) (-2075.361) * (-2079.621) [-2074.343] (-2081.742) (-2078.544) -- 0:00:28
900200 -- (-2082.889) [-2078.597] (-2087.153) (-2073.005) * (-2083.393) (-2082.347) (-2079.983) [-2074.629] -- 0:00:28
900300 -- (-2080.361) (-2084.353) [-2077.553] (-2075.399) * [-2080.444] (-2091.516) (-2085.386) (-2075.160) -- 0:00:28
900400 -- (-2084.950) (-2088.188) [-2075.385] (-2077.497) * [-2080.810] (-2085.798) (-2088.375) (-2076.999) -- 0:00:28
900500 -- (-2093.040) (-2077.434) (-2078.818) [-2075.726] * [-2083.489] (-2080.703) (-2087.787) (-2076.818) -- 0:00:28
900600 -- (-2092.610) (-2075.395) (-2080.526) [-2075.534] * (-2087.856) [-2077.106] (-2082.236) (-2078.145) -- 0:00:28
900700 -- (-2087.161) [-2077.645] (-2080.786) (-2077.989) * (-2089.863) [-2079.020] (-2083.738) (-2083.008) -- 0:00:28
900800 -- (-2081.037) (-2080.738) (-2081.262) [-2075.258] * (-2077.206) [-2084.320] (-2079.601) (-2082.502) -- 0:00:28
900900 -- (-2097.511) (-2080.730) (-2088.863) [-2073.752] * (-2077.969) (-2083.786) [-2081.721] (-2079.894) -- 0:00:28
901000 -- (-2094.461) (-2076.618) (-2082.517) [-2075.799] * (-2078.195) [-2080.722] (-2082.899) (-2088.121) -- 0:00:28
Average standard deviation of split frequencies: 0.003677
901100 -- [-2087.832] (-2081.518) (-2093.586) (-2071.669) * (-2077.907) [-2077.629] (-2076.743) (-2087.891) -- 0:00:28
901200 -- (-2083.444) (-2075.439) (-2079.734) [-2073.574] * (-2078.807) [-2077.672] (-2076.944) (-2089.198) -- 0:00:28
901300 -- (-2084.364) (-2073.003) (-2082.322) [-2072.286] * (-2077.916) [-2075.520] (-2073.411) (-2090.658) -- 0:00:28
901400 -- (-2086.226) (-2075.858) (-2079.268) [-2071.240] * (-2079.298) (-2078.487) [-2081.669] (-2078.032) -- 0:00:28
901500 -- (-2082.213) (-2074.907) (-2081.912) [-2073.281] * (-2090.307) (-2073.925) (-2080.026) [-2077.814] -- 0:00:28
901600 -- (-2077.517) [-2076.019] (-2082.559) (-2077.293) * (-2082.775) (-2078.701) (-2079.119) [-2075.893] -- 0:00:28
901700 -- (-2076.887) [-2069.911] (-2084.504) (-2071.651) * (-2083.090) (-2074.173) (-2082.185) [-2075.411] -- 0:00:28
901800 -- (-2088.851) [-2071.401] (-2085.907) (-2069.755) * [-2082.765] (-2078.895) (-2078.811) (-2077.378) -- 0:00:28
901900 -- (-2087.948) [-2070.304] (-2084.640) (-2071.598) * (-2082.659) (-2072.508) (-2078.557) [-2079.568] -- 0:00:28
902000 -- (-2081.080) [-2074.303] (-2086.935) (-2072.338) * (-2079.031) (-2077.876) [-2075.966] (-2080.431) -- 0:00:28
Average standard deviation of split frequencies: 0.003613
902100 -- (-2084.403) [-2080.745] (-2084.416) (-2081.061) * (-2078.102) (-2087.077) (-2075.472) [-2079.097] -- 0:00:28
902200 -- (-2082.366) (-2081.634) (-2080.747) [-2075.746] * (-2087.281) (-2085.603) (-2080.894) [-2078.491] -- 0:00:28
902300 -- [-2079.410] (-2081.091) (-2082.564) (-2070.687) * (-2079.593) (-2076.430) [-2076.110] (-2076.923) -- 0:00:28
902400 -- (-2076.452) [-2075.391] (-2079.393) (-2081.012) * [-2077.115] (-2085.237) (-2082.575) (-2081.357) -- 0:00:28
902500 -- (-2081.258) [-2078.020] (-2085.587) (-2075.704) * (-2082.588) (-2083.410) (-2079.944) [-2083.738] -- 0:00:27
902600 -- (-2085.996) (-2084.649) (-2094.117) [-2069.983] * (-2079.089) [-2076.615] (-2082.404) (-2086.469) -- 0:00:27
902700 -- [-2078.807] (-2079.462) (-2079.695) (-2078.025) * (-2077.618) [-2077.304] (-2082.012) (-2090.524) -- 0:00:27
902800 -- (-2078.943) (-2079.715) (-2077.236) [-2069.698] * (-2081.652) (-2079.864) (-2084.935) [-2074.934] -- 0:00:27
902900 -- (-2083.126) (-2084.984) [-2077.331] (-2074.451) * (-2088.596) (-2081.943) (-2085.864) [-2080.554] -- 0:00:27
903000 -- (-2087.261) [-2077.510] (-2082.602) (-2078.964) * (-2097.570) [-2075.335] (-2079.624) (-2075.543) -- 0:00:27
Average standard deviation of split frequencies: 0.003609
903100 -- (-2087.427) (-2071.988) [-2081.674] (-2080.641) * (-2080.382) [-2076.467] (-2078.714) (-2085.819) -- 0:00:27
903200 -- (-2089.576) [-2076.164] (-2078.213) (-2081.829) * (-2088.121) (-2081.896) [-2082.263] (-2079.412) -- 0:00:27
903300 -- (-2092.714) (-2073.662) [-2072.552] (-2075.805) * (-2089.332) (-2074.565) (-2084.751) [-2075.453] -- 0:00:27
903400 -- (-2094.041) [-2070.407] (-2079.430) (-2079.180) * [-2071.575] (-2084.658) (-2079.522) (-2078.055) -- 0:00:27
903500 -- (-2096.766) (-2071.213) (-2074.240) [-2070.719] * (-2077.923) (-2082.048) (-2085.143) [-2075.998] -- 0:00:27
903600 -- (-2086.417) (-2071.366) (-2081.745) [-2068.524] * (-2079.338) (-2085.183) [-2088.584] (-2088.957) -- 0:00:27
903700 -- (-2085.273) (-2071.118) [-2073.397] (-2073.117) * (-2077.315) (-2089.110) (-2098.339) [-2077.178] -- 0:00:27
903800 -- (-2090.406) (-2072.896) [-2067.526] (-2074.070) * (-2084.965) (-2082.218) (-2080.075) [-2075.288] -- 0:00:27
903900 -- (-2091.448) [-2071.949] (-2073.485) (-2069.625) * (-2082.286) (-2086.348) (-2087.676) [-2074.496] -- 0:00:27
904000 -- (-2079.584) [-2072.001] (-2075.496) (-2078.352) * (-2084.007) (-2083.126) [-2076.979] (-2075.721) -- 0:00:27
Average standard deviation of split frequencies: 0.003560
904100 -- (-2081.733) (-2078.489) [-2070.341] (-2078.274) * (-2085.177) (-2082.470) (-2084.599) [-2076.685] -- 0:00:27
904200 -- (-2078.209) [-2075.127] (-2072.384) (-2085.209) * (-2093.291) (-2080.209) [-2082.727] (-2078.141) -- 0:00:27
904300 -- (-2083.153) [-2073.626] (-2072.424) (-2077.359) * (-2083.528) [-2083.304] (-2080.770) (-2078.627) -- 0:00:27
904400 -- [-2083.380] (-2082.725) (-2071.974) (-2075.718) * (-2087.246) (-2082.766) [-2079.332] (-2077.045) -- 0:00:27
904500 -- (-2081.374) (-2084.348) (-2083.282) [-2071.534] * (-2088.274) (-2079.627) (-2081.417) [-2077.738] -- 0:00:27
904600 -- (-2078.162) (-2075.215) [-2070.624] (-2075.336) * (-2086.500) [-2082.943] (-2091.427) (-2081.151) -- 0:00:27
904700 -- (-2079.399) [-2075.733] (-2074.163) (-2079.027) * (-2096.786) [-2089.037] (-2082.989) (-2076.729) -- 0:00:27
904800 -- (-2083.147) [-2074.324] (-2072.126) (-2086.459) * (-2088.299) (-2094.386) [-2083.506] (-2080.355) -- 0:00:27
904900 -- [-2075.653] (-2079.839) (-2077.610) (-2091.462) * (-2092.508) (-2089.591) [-2079.568] (-2075.285) -- 0:00:27
905000 -- [-2074.655] (-2078.352) (-2078.101) (-2090.421) * (-2077.821) (-2089.704) [-2072.702] (-2076.205) -- 0:00:27
Average standard deviation of split frequencies: 0.003497
905100 -- [-2081.732] (-2077.136) (-2083.115) (-2084.196) * (-2079.635) (-2088.021) (-2074.602) [-2074.980] -- 0:00:27
905200 -- (-2085.315) [-2073.383] (-2081.387) (-2075.471) * [-2080.623] (-2089.191) (-2076.857) (-2076.287) -- 0:00:27
905300 -- (-2090.298) [-2073.311] (-2076.410) (-2073.223) * (-2081.267) (-2090.844) [-2082.321] (-2077.089) -- 0:00:27
905400 -- (-2077.741) (-2072.147) (-2074.525) [-2075.101] * [-2076.993] (-2084.975) (-2082.298) (-2085.021) -- 0:00:27
905500 -- (-2074.842) [-2076.411] (-2074.641) (-2074.656) * [-2073.609] (-2093.859) (-2082.640) (-2081.463) -- 0:00:27
905600 -- (-2074.542) [-2076.618] (-2084.385) (-2074.704) * [-2072.520] (-2080.825) (-2086.088) (-2081.452) -- 0:00:27
905700 -- (-2074.933) [-2072.407] (-2079.661) (-2071.052) * (-2077.072) [-2079.059] (-2086.912) (-2086.427) -- 0:00:27
905800 -- (-2074.666) [-2070.089] (-2071.077) (-2074.027) * (-2078.710) [-2072.078] (-2082.140) (-2093.702) -- 0:00:27
905900 -- (-2075.715) (-2080.475) (-2074.735) [-2072.316] * (-2077.635) [-2072.791] (-2077.843) (-2097.130) -- 0:00:27
906000 -- (-2075.961) (-2077.149) [-2075.087] (-2070.279) * (-2082.730) (-2073.238) [-2077.370] (-2076.827) -- 0:00:26
Average standard deviation of split frequencies: 0.003686
906100 -- [-2072.782] (-2074.079) (-2077.926) (-2069.393) * [-2089.431] (-2085.819) (-2078.166) (-2076.830) -- 0:00:26
906200 -- [-2072.887] (-2075.948) (-2083.216) (-2070.814) * (-2083.349) (-2091.377) [-2076.103] (-2084.453) -- 0:00:26
906300 -- (-2075.209) (-2077.969) (-2079.487) [-2071.441] * (-2081.834) (-2094.184) (-2078.109) [-2081.679] -- 0:00:26
906400 -- [-2078.026] (-2081.043) (-2081.699) (-2086.053) * [-2083.032] (-2082.655) (-2079.930) (-2081.238) -- 0:00:26
906500 -- [-2076.420] (-2076.717) (-2082.672) (-2089.903) * (-2079.739) (-2083.120) [-2084.378] (-2082.425) -- 0:00:26
906600 -- (-2076.525) (-2090.613) [-2069.786] (-2077.787) * (-2081.303) (-2080.193) [-2075.294] (-2081.880) -- 0:00:26
906700 -- (-2077.395) (-2085.680) (-2078.823) [-2071.129] * (-2088.706) [-2076.339] (-2083.917) (-2086.369) -- 0:00:26
906800 -- (-2079.660) (-2079.904) [-2069.482] (-2071.883) * (-2087.510) (-2080.564) [-2077.868] (-2085.037) -- 0:00:26
906900 -- (-2077.911) (-2075.328) (-2075.692) [-2074.063] * (-2084.450) [-2074.633] (-2084.148) (-2085.948) -- 0:00:26
907000 -- (-2081.453) [-2077.320] (-2070.943) (-2074.055) * [-2076.995] (-2077.369) (-2077.690) (-2079.410) -- 0:00:26
Average standard deviation of split frequencies: 0.003608
907100 -- (-2080.991) (-2076.843) (-2073.645) [-2071.730] * (-2083.775) (-2084.034) (-2075.002) [-2078.804] -- 0:00:26
907200 -- (-2085.557) (-2070.584) [-2071.676] (-2072.275) * (-2083.446) (-2080.990) [-2073.194] (-2077.998) -- 0:00:26
907300 -- (-2083.761) (-2076.896) [-2074.337] (-2074.938) * (-2092.085) (-2076.295) [-2075.148] (-2081.365) -- 0:00:26
907400 -- (-2076.861) (-2077.045) (-2088.698) [-2076.409] * (-2084.493) [-2074.373] (-2076.472) (-2076.818) -- 0:00:26
907500 -- (-2076.888) (-2075.964) [-2075.971] (-2075.422) * (-2089.164) [-2071.014] (-2081.909) (-2079.169) -- 0:00:26
907600 -- (-2080.504) (-2076.293) [-2075.443] (-2075.979) * (-2089.352) [-2076.294] (-2084.146) (-2079.753) -- 0:00:26
907700 -- (-2079.907) (-2079.798) [-2080.028] (-2074.045) * [-2081.632] (-2076.699) (-2080.878) (-2080.301) -- 0:00:26
907800 -- (-2080.485) (-2084.277) (-2073.913) [-2073.722] * [-2073.358] (-2083.238) (-2079.531) (-2078.442) -- 0:00:26
907900 -- (-2078.030) (-2086.231) (-2079.723) [-2073.381] * (-2083.183) (-2076.139) (-2084.595) [-2076.907] -- 0:00:26
908000 -- (-2075.150) (-2083.540) (-2076.764) [-2080.495] * (-2077.722) (-2076.447) (-2081.065) [-2081.355] -- 0:00:26
Average standard deviation of split frequencies: 0.003530
908100 -- (-2084.730) (-2083.493) (-2071.547) [-2074.640] * (-2078.382) [-2072.940] (-2077.919) (-2084.465) -- 0:00:26
908200 -- (-2077.884) (-2087.376) [-2073.797] (-2082.043) * (-2085.653) [-2076.813] (-2076.111) (-2085.474) -- 0:00:26
908300 -- (-2074.287) (-2088.107) (-2076.095) [-2073.748] * (-2084.741) [-2073.556] (-2075.019) (-2083.673) -- 0:00:26
908400 -- (-2080.436) (-2080.294) (-2073.422) [-2068.106] * (-2085.839) (-2072.939) [-2077.825] (-2089.345) -- 0:00:26
908500 -- (-2078.383) (-2086.053) (-2077.120) [-2070.034] * [-2085.573] (-2078.978) (-2077.391) (-2093.616) -- 0:00:26
908600 -- (-2081.167) (-2086.286) [-2079.410] (-2073.197) * (-2087.008) (-2078.563) [-2075.034] (-2084.645) -- 0:00:26
908700 -- (-2081.077) (-2082.559) (-2075.892) [-2070.315] * [-2075.428] (-2073.019) (-2078.294) (-2089.001) -- 0:00:26
908800 -- [-2079.926] (-2087.658) (-2074.440) (-2076.120) * [-2078.815] (-2077.107) (-2078.165) (-2088.810) -- 0:00:26
908900 -- (-2079.827) (-2083.276) [-2074.446] (-2077.711) * (-2090.212) (-2077.458) (-2086.984) [-2082.178] -- 0:00:26
909000 -- (-2088.792) (-2083.076) (-2073.985) [-2069.632] * (-2094.001) [-2070.323] (-2083.244) (-2087.651) -- 0:00:26
Average standard deviation of split frequencies: 0.003585
909100 -- (-2091.471) (-2080.317) (-2077.768) [-2066.446] * (-2091.603) [-2074.413] (-2081.956) (-2086.856) -- 0:00:26
909200 -- (-2085.552) (-2076.187) (-2079.070) [-2068.497] * (-2098.170) [-2080.903] (-2082.289) (-2086.561) -- 0:00:26
909300 -- (-2098.249) (-2078.475) (-2081.476) [-2070.038] * (-2084.159) (-2072.351) [-2082.497] (-2094.447) -- 0:00:26
909400 -- (-2084.518) (-2092.628) (-2076.801) [-2069.726] * (-2079.513) [-2071.913] (-2083.131) (-2093.997) -- 0:00:26
909500 -- (-2075.190) (-2077.832) (-2073.190) [-2074.666] * (-2080.100) [-2073.272] (-2077.386) (-2093.361) -- 0:00:25
909600 -- (-2084.894) (-2079.616) [-2069.135] (-2076.149) * (-2081.185) [-2075.241] (-2080.135) (-2080.452) -- 0:00:25
909700 -- (-2080.128) (-2079.415) [-2070.918] (-2075.613) * (-2075.093) (-2077.476) (-2091.521) [-2076.805] -- 0:00:25
909800 -- (-2076.730) (-2087.148) (-2077.642) [-2074.673] * (-2077.453) (-2078.982) (-2084.554) [-2077.422] -- 0:00:25
909900 -- (-2079.175) (-2079.596) [-2076.100] (-2072.828) * (-2074.840) (-2077.658) [-2081.485] (-2078.422) -- 0:00:25
910000 -- (-2076.261) (-2077.681) (-2076.392) [-2072.874] * [-2079.785] (-2077.521) (-2078.128) (-2079.379) -- 0:00:25
Average standard deviation of split frequencies: 0.003581
910100 -- (-2074.569) [-2077.214] (-2075.505) (-2071.471) * (-2080.624) (-2084.847) (-2081.192) [-2075.777] -- 0:00:25
910200 -- (-2078.544) [-2084.029] (-2078.606) (-2086.856) * (-2076.120) [-2077.010] (-2089.274) (-2073.610) -- 0:00:25
910300 -- (-2087.961) (-2086.152) [-2074.510] (-2079.511) * (-2083.197) (-2076.023) (-2084.280) [-2085.774] -- 0:00:25
910400 -- (-2080.997) (-2091.560) (-2073.848) [-2074.799] * [-2075.123] (-2082.280) (-2081.172) (-2080.613) -- 0:00:25
910500 -- (-2086.435) (-2082.699) [-2078.773] (-2080.231) * (-2084.022) [-2067.691] (-2078.178) (-2080.825) -- 0:00:25
910600 -- (-2090.765) [-2073.580] (-2082.020) (-2081.869) * (-2083.320) [-2069.776] (-2079.915) (-2079.717) -- 0:00:25
910700 -- (-2083.772) (-2077.195) [-2079.481] (-2087.354) * (-2090.413) [-2072.016] (-2077.402) (-2078.123) -- 0:00:25
910800 -- [-2074.101] (-2075.934) (-2081.860) (-2076.320) * (-2086.894) [-2074.968] (-2080.063) (-2085.043) -- 0:00:25
910900 -- [-2075.290] (-2078.835) (-2089.112) (-2078.495) * [-2075.422] (-2081.205) (-2082.658) (-2081.477) -- 0:00:25
911000 -- [-2076.172] (-2077.415) (-2075.996) (-2081.661) * (-2077.827) (-2086.023) [-2077.779] (-2082.724) -- 0:00:25
Average standard deviation of split frequencies: 0.003548
911100 -- [-2078.076] (-2076.947) (-2077.270) (-2079.630) * [-2080.030] (-2080.713) (-2079.738) (-2085.306) -- 0:00:25
911200 -- (-2079.839) [-2071.956] (-2072.631) (-2079.782) * [-2077.718] (-2091.035) (-2082.455) (-2086.965) -- 0:00:25
911300 -- [-2074.933] (-2083.539) (-2073.182) (-2077.781) * [-2075.412] (-2087.451) (-2077.513) (-2082.565) -- 0:00:25
911400 -- (-2076.373) (-2082.524) (-2077.454) [-2079.830] * (-2083.190) [-2078.402] (-2079.319) (-2085.291) -- 0:00:25
911500 -- (-2077.876) (-2083.056) [-2076.751] (-2070.798) * (-2084.913) (-2083.024) (-2086.358) [-2086.233] -- 0:00:25
911600 -- (-2082.860) (-2079.137) (-2082.313) [-2085.827] * (-2090.531) (-2077.622) [-2078.485] (-2085.057) -- 0:00:25
911700 -- (-2084.441) [-2076.753] (-2077.861) (-2092.922) * (-2080.376) (-2074.816) [-2074.710] (-2078.279) -- 0:00:25
911800 -- [-2079.112] (-2077.307) (-2078.122) (-2086.125) * (-2085.062) (-2075.330) [-2078.923] (-2081.820) -- 0:00:25
911900 -- (-2081.311) [-2076.433] (-2078.788) (-2088.452) * (-2082.836) [-2072.373] (-2079.619) (-2084.064) -- 0:00:25
912000 -- (-2086.775) (-2083.010) [-2072.044] (-2085.360) * (-2087.797) [-2072.206] (-2078.549) (-2084.595) -- 0:00:25
Average standard deviation of split frequencies: 0.003485
912100 -- (-2075.951) (-2078.899) [-2066.258] (-2082.176) * (-2078.667) [-2075.874] (-2078.548) (-2081.494) -- 0:00:25
912200 -- (-2077.776) [-2084.588] (-2070.741) (-2084.274) * (-2081.101) (-2073.652) (-2079.932) [-2076.505] -- 0:00:25
912300 -- (-2083.666) (-2088.916) [-2067.827] (-2080.035) * (-2084.336) (-2072.662) (-2082.144) [-2073.086] -- 0:00:25
912400 -- (-2080.945) (-2080.597) [-2072.164] (-2082.515) * (-2085.193) [-2071.717] (-2078.729) (-2073.737) -- 0:00:25
912500 -- (-2078.569) (-2075.077) [-2070.298] (-2084.807) * (-2083.011) (-2080.342) (-2074.799) [-2077.205] -- 0:00:25
912600 -- (-2093.408) [-2080.114] (-2080.574) (-2084.487) * (-2079.719) (-2075.996) (-2084.235) [-2078.096] -- 0:00:25
912700 -- [-2075.310] (-2095.454) (-2072.577) (-2080.464) * (-2086.509) [-2071.745] (-2078.769) (-2086.817) -- 0:00:25
912800 -- [-2074.659] (-2081.205) (-2075.063) (-2085.839) * (-2087.173) [-2075.657] (-2079.439) (-2085.028) -- 0:00:25
912900 -- (-2078.316) (-2084.058) [-2070.407] (-2088.886) * (-2080.893) (-2072.814) (-2082.720) [-2077.946] -- 0:00:24
913000 -- (-2074.906) (-2076.172) [-2072.865] (-2086.482) * (-2082.366) [-2073.808] (-2092.201) (-2082.940) -- 0:00:24
Average standard deviation of split frequencies: 0.003333
913100 -- (-2080.303) (-2076.747) [-2076.959] (-2091.325) * (-2078.252) [-2075.410] (-2089.966) (-2083.362) -- 0:00:24
913200 -- (-2075.186) [-2074.717] (-2077.507) (-2086.133) * (-2096.835) (-2074.073) [-2081.778] (-2080.967) -- 0:00:24
913300 -- (-2078.505) (-2082.355) [-2073.617] (-2082.458) * (-2097.468) [-2075.571] (-2091.549) (-2086.933) -- 0:00:24
913400 -- (-2077.670) (-2090.239) [-2074.303] (-2083.538) * (-2084.098) [-2072.519] (-2078.621) (-2084.833) -- 0:00:24
913500 -- (-2085.747) (-2086.416) [-2074.082] (-2089.322) * (-2086.263) [-2072.996] (-2072.938) (-2090.280) -- 0:00:24
913600 -- (-2087.512) (-2086.695) [-2072.783] (-2079.716) * (-2090.792) [-2074.133] (-2079.354) (-2087.076) -- 0:00:24
913700 -- (-2083.630) (-2084.338) [-2074.309] (-2081.721) * (-2092.983) [-2072.127] (-2089.666) (-2078.133) -- 0:00:24
913800 -- [-2073.846] (-2078.509) (-2072.512) (-2087.331) * (-2085.337) [-2071.183] (-2088.758) (-2086.615) -- 0:00:24
913900 -- [-2075.144] (-2088.569) (-2072.370) (-2084.724) * (-2079.303) [-2068.434] (-2085.542) (-2085.050) -- 0:00:24
914000 -- (-2073.192) (-2082.420) [-2074.156] (-2084.622) * (-2081.424) [-2071.472] (-2084.164) (-2080.076) -- 0:00:24
Average standard deviation of split frequencies: 0.003580
914100 -- (-2071.776) [-2082.213] (-2074.182) (-2082.260) * (-2078.657) [-2074.268] (-2080.850) (-2085.860) -- 0:00:24
914200 -- (-2075.650) (-2077.628) [-2072.903] (-2076.998) * (-2083.490) [-2071.507] (-2076.142) (-2093.250) -- 0:00:24
914300 -- (-2073.676) (-2075.927) [-2075.839] (-2088.697) * (-2074.485) (-2074.709) (-2083.403) [-2086.466] -- 0:00:24
914400 -- (-2077.585) (-2080.831) [-2071.680] (-2085.837) * (-2081.463) [-2072.263] (-2082.953) (-2085.548) -- 0:00:24
914500 -- (-2077.930) (-2079.374) [-2072.219] (-2094.515) * (-2081.263) (-2072.710) [-2072.776] (-2091.954) -- 0:00:24
914600 -- (-2077.596) (-2079.829) [-2071.453] (-2086.023) * (-2084.761) [-2070.575] (-2074.304) (-2080.690) -- 0:00:24
914700 -- (-2087.656) (-2076.242) [-2073.794] (-2088.723) * (-2089.198) [-2071.373] (-2080.035) (-2084.442) -- 0:00:24
914800 -- (-2083.469) [-2082.875] (-2077.221) (-2085.124) * (-2087.077) (-2072.133) [-2076.397] (-2086.077) -- 0:00:24
914900 -- (-2085.381) [-2075.493] (-2074.932) (-2087.067) * (-2090.930) [-2069.728] (-2078.130) (-2084.249) -- 0:00:24
915000 -- (-2081.866) (-2074.862) [-2073.950] (-2086.347) * (-2086.996) (-2076.958) [-2075.452] (-2079.588) -- 0:00:24
Average standard deviation of split frequencies: 0.003532
915100 -- (-2085.088) (-2079.414) [-2074.665] (-2082.020) * (-2085.485) [-2072.090] (-2075.408) (-2083.609) -- 0:00:24
915200 -- (-2076.070) (-2078.142) [-2075.454] (-2089.981) * (-2088.898) (-2069.647) [-2072.181] (-2086.300) -- 0:00:24
915300 -- (-2082.945) (-2086.328) (-2079.775) [-2077.977] * (-2098.261) [-2071.973] (-2077.302) (-2090.855) -- 0:00:24
915400 -- (-2079.816) (-2081.041) [-2078.015] (-2076.255) * (-2083.922) [-2070.625] (-2075.929) (-2086.110) -- 0:00:24
915500 -- [-2080.217] (-2087.989) (-2081.467) (-2078.199) * (-2089.457) [-2070.076] (-2075.730) (-2080.825) -- 0:00:24
915600 -- (-2079.588) [-2079.984] (-2075.680) (-2081.164) * (-2092.375) (-2071.191) [-2078.327] (-2077.133) -- 0:00:24
915700 -- [-2079.418] (-2077.734) (-2076.659) (-2084.877) * (-2091.050) [-2074.730] (-2079.885) (-2081.769) -- 0:00:24
915800 -- [-2081.551] (-2086.446) (-2073.585) (-2087.330) * (-2083.049) [-2073.727] (-2078.648) (-2076.855) -- 0:00:24
915900 -- (-2076.539) (-2081.827) [-2070.002] (-2077.798) * (-2080.395) [-2076.223] (-2076.218) (-2078.979) -- 0:00:24
916000 -- (-2077.690) (-2080.619) (-2071.144) [-2077.356] * (-2082.496) (-2078.233) [-2078.683] (-2076.618) -- 0:00:24
Average standard deviation of split frequencies: 0.003514
916100 -- (-2081.266) [-2079.606] (-2069.396) (-2078.322) * (-2091.956) [-2077.111] (-2076.648) (-2080.195) -- 0:00:24
916200 -- (-2084.292) (-2074.995) [-2070.476] (-2081.124) * (-2085.469) [-2078.542] (-2073.564) (-2084.217) -- 0:00:24
916300 -- (-2082.484) (-2076.066) [-2074.890] (-2082.794) * (-2076.872) (-2076.244) [-2072.962] (-2082.374) -- 0:00:24
916400 -- [-2081.948] (-2085.129) (-2085.157) (-2087.912) * (-2082.157) (-2068.868) (-2079.366) [-2078.748] -- 0:00:23
916500 -- [-2073.609] (-2085.317) (-2073.366) (-2082.038) * (-2081.858) (-2080.776) [-2073.145] (-2076.538) -- 0:00:23
916600 -- (-2074.803) [-2074.583] (-2080.049) (-2080.616) * [-2080.030] (-2084.599) (-2072.124) (-2081.581) -- 0:00:23
916700 -- [-2074.453] (-2077.247) (-2077.226) (-2077.073) * (-2076.616) (-2084.064) [-2072.451] (-2078.964) -- 0:00:23
916800 -- (-2083.280) (-2077.334) (-2082.714) [-2076.368] * [-2075.677] (-2089.148) (-2079.700) (-2087.768) -- 0:00:23
916900 -- [-2077.013] (-2078.093) (-2073.949) (-2091.677) * (-2084.557) (-2078.344) [-2078.534] (-2083.747) -- 0:00:23
917000 -- (-2075.417) (-2080.583) [-2073.955] (-2083.586) * (-2090.454) (-2068.705) [-2076.171] (-2079.621) -- 0:00:23
Average standard deviation of split frequencies: 0.003436
917100 -- [-2076.911] (-2082.350) (-2077.491) (-2089.188) * (-2081.500) [-2077.361] (-2081.148) (-2083.981) -- 0:00:23
917200 -- [-2081.477] (-2083.398) (-2074.972) (-2082.644) * (-2082.957) (-2082.575) [-2074.518] (-2076.633) -- 0:00:23
917300 -- (-2088.456) (-2085.315) (-2073.796) [-2078.691] * (-2079.571) (-2077.364) [-2077.109] (-2077.888) -- 0:00:23
917400 -- (-2085.691) (-2082.885) [-2072.818] (-2082.265) * (-2081.369) [-2076.619] (-2076.554) (-2072.017) -- 0:00:23
917500 -- (-2085.081) (-2082.514) (-2073.021) [-2076.047] * (-2087.635) [-2072.177] (-2078.759) (-2073.741) -- 0:00:23
917600 -- (-2083.070) (-2079.228) (-2077.452) [-2076.451] * (-2093.878) (-2070.996) (-2077.417) [-2075.169] -- 0:00:23
917700 -- (-2083.723) (-2080.201) [-2077.265] (-2075.493) * (-2087.204) (-2078.127) [-2077.670] (-2077.196) -- 0:00:23
917800 -- (-2080.638) (-2077.619) [-2075.714] (-2076.462) * (-2093.961) [-2072.536] (-2076.875) (-2083.146) -- 0:00:23
917900 -- (-2083.288) (-2076.708) [-2073.790] (-2083.066) * (-2089.460) [-2067.347] (-2081.059) (-2080.321) -- 0:00:23
918000 -- (-2080.377) (-2074.783) [-2077.519] (-2082.313) * (-2084.556) [-2071.904] (-2081.057) (-2087.953) -- 0:00:23
Average standard deviation of split frequencies: 0.003403
918100 -- [-2077.283] (-2078.766) (-2082.567) (-2080.607) * (-2085.391) (-2075.228) (-2083.406) [-2073.918] -- 0:00:23
918200 -- (-2080.633) [-2076.467] (-2079.430) (-2086.018) * (-2086.096) [-2071.753] (-2077.295) (-2082.301) -- 0:00:23
918300 -- [-2077.804] (-2079.166) (-2075.974) (-2079.799) * (-2085.126) [-2071.391] (-2074.066) (-2079.939) -- 0:00:23
918400 -- [-2076.109] (-2082.177) (-2069.643) (-2079.430) * (-2082.674) [-2069.465] (-2077.829) (-2078.648) -- 0:00:23
918500 -- (-2085.508) (-2084.608) [-2065.306] (-2077.291) * [-2081.067] (-2068.565) (-2082.915) (-2080.764) -- 0:00:23
918600 -- (-2079.006) (-2076.871) [-2069.073] (-2077.748) * (-2078.398) [-2075.455] (-2082.383) (-2081.269) -- 0:00:23
918700 -- (-2076.772) (-2075.908) [-2069.761] (-2077.833) * (-2084.391) [-2070.000] (-2074.358) (-2078.959) -- 0:00:23
918800 -- (-2077.377) [-2076.624] (-2072.093) (-2087.136) * (-2087.009) [-2069.359] (-2077.294) (-2078.539) -- 0:00:23
918900 -- (-2080.469) (-2075.447) [-2075.162] (-2082.751) * [-2078.896] (-2070.632) (-2080.329) (-2082.211) -- 0:00:23
919000 -- (-2084.861) (-2084.614) (-2080.579) [-2071.787] * [-2076.352] (-2089.420) (-2080.946) (-2084.685) -- 0:00:23
Average standard deviation of split frequencies: 0.003326
919100 -- (-2082.058) [-2073.358] (-2078.085) (-2090.313) * (-2081.323) [-2077.029] (-2076.288) (-2092.920) -- 0:00:23
919200 -- [-2074.942] (-2081.483) (-2077.277) (-2073.481) * (-2086.597) [-2083.357] (-2075.667) (-2095.215) -- 0:00:23
919300 -- [-2083.647] (-2078.587) (-2085.301) (-2080.414) * (-2082.245) [-2078.239] (-2076.200) (-2091.920) -- 0:00:23
919400 -- [-2073.484] (-2079.779) (-2077.038) (-2083.731) * [-2076.655] (-2075.587) (-2083.988) (-2090.920) -- 0:00:23
919500 -- (-2075.554) (-2084.645) [-2070.754] (-2088.215) * (-2073.345) [-2074.114] (-2080.680) (-2091.254) -- 0:00:23
919600 -- [-2074.312] (-2075.254) (-2077.283) (-2087.312) * (-2073.593) [-2072.367] (-2085.934) (-2083.528) -- 0:00:23
919700 -- (-2080.409) (-2081.338) [-2071.390] (-2087.939) * (-2073.513) [-2075.143] (-2076.662) (-2082.862) -- 0:00:23
919800 -- (-2079.338) [-2073.212] (-2067.093) (-2087.843) * (-2077.934) [-2075.514] (-2072.221) (-2084.967) -- 0:00:23
919900 -- (-2085.562) (-2073.725) [-2067.820] (-2084.925) * (-2082.045) (-2084.590) (-2078.190) [-2082.746] -- 0:00:22
920000 -- (-2080.701) (-2075.783) [-2070.783] (-2085.082) * [-2080.568] (-2089.849) (-2080.814) (-2084.988) -- 0:00:22
Average standard deviation of split frequencies: 0.003381
920100 -- [-2073.543] (-2079.121) (-2071.019) (-2084.207) * [-2083.713] (-2089.159) (-2080.583) (-2080.749) -- 0:00:22
920200 -- (-2080.097) (-2080.775) [-2067.019] (-2087.537) * (-2077.790) (-2089.608) (-2077.204) [-2073.518] -- 0:00:22
920300 -- (-2076.442) (-2079.131) [-2072.178] (-2085.102) * (-2080.944) (-2081.490) [-2076.213] (-2079.772) -- 0:00:22
920400 -- (-2087.938) (-2079.550) [-2070.294] (-2097.140) * (-2083.601) (-2088.649) (-2078.458) [-2078.476] -- 0:00:22
920500 -- (-2082.943) (-2079.540) [-2078.656] (-2095.772) * (-2089.616) (-2089.894) (-2091.373) [-2078.876] -- 0:00:22
920600 -- [-2076.935] (-2075.289) (-2071.305) (-2092.558) * (-2092.517) (-2076.839) (-2085.804) [-2078.216] -- 0:00:22
920700 -- (-2085.126) (-2079.260) [-2073.023] (-2094.388) * (-2089.535) [-2083.419] (-2090.203) (-2090.572) -- 0:00:22
920800 -- (-2083.840) [-2080.114] (-2080.584) (-2090.645) * (-2082.476) [-2078.061] (-2091.345) (-2077.599) -- 0:00:22
920900 -- (-2084.330) (-2080.312) [-2072.734] (-2098.686) * (-2077.490) [-2079.886] (-2083.637) (-2088.326) -- 0:00:22
921000 -- (-2094.141) (-2080.765) [-2075.294] (-2088.578) * (-2094.944) (-2082.844) [-2076.684] (-2086.157) -- 0:00:22
Average standard deviation of split frequencies: 0.003348
921100 -- (-2092.514) (-2084.866) [-2070.354] (-2087.541) * (-2087.500) (-2081.428) [-2075.555] (-2087.629) -- 0:00:22
921200 -- (-2084.979) (-2087.140) [-2072.614] (-2096.913) * (-2081.608) (-2081.881) [-2071.591] (-2078.067) -- 0:00:22
921300 -- [-2085.181] (-2085.307) (-2070.825) (-2089.190) * (-2089.225) (-2079.555) [-2075.343] (-2078.359) -- 0:00:22
921400 -- (-2086.416) (-2079.558) [-2076.867] (-2086.467) * (-2074.630) (-2071.480) [-2076.424] (-2083.954) -- 0:00:22
921500 -- (-2082.974) [-2077.200] (-2072.641) (-2091.379) * (-2075.810) [-2076.682] (-2079.884) (-2080.336) -- 0:00:22
921600 -- (-2078.804) [-2080.287] (-2081.302) (-2080.656) * [-2075.373] (-2068.271) (-2080.131) (-2078.587) -- 0:00:22
921700 -- (-2079.190) (-2083.046) [-2073.334] (-2085.089) * (-2076.531) [-2070.100] (-2076.933) (-2083.851) -- 0:00:22
921800 -- (-2079.626) (-2084.445) [-2076.328] (-2082.466) * (-2073.890) (-2076.415) [-2077.937] (-2080.086) -- 0:00:22
921900 -- (-2086.016) (-2077.191) [-2078.428] (-2088.458) * [-2078.637] (-2078.443) (-2079.207) (-2080.705) -- 0:00:22
922000 -- (-2082.365) (-2078.646) (-2074.771) [-2077.696] * (-2076.166) (-2073.076) [-2078.149] (-2084.186) -- 0:00:22
Average standard deviation of split frequencies: 0.003389
922100 -- (-2085.208) (-2083.544) [-2076.992] (-2076.938) * [-2072.309] (-2076.630) (-2076.170) (-2082.872) -- 0:00:22
922200 -- (-2092.506) (-2080.727) (-2086.186) [-2071.850] * [-2070.770] (-2076.539) (-2072.971) (-2078.146) -- 0:00:22
922300 -- (-2097.708) (-2074.572) [-2070.191] (-2077.275) * (-2068.843) (-2075.699) (-2071.883) [-2074.823] -- 0:00:22
922400 -- (-2092.492) (-2078.083) (-2073.747) [-2073.558] * [-2072.533] (-2081.867) (-2075.912) (-2079.691) -- 0:00:22
922500 -- (-2091.401) [-2076.380] (-2082.490) (-2080.192) * [-2067.940] (-2082.796) (-2078.155) (-2083.796) -- 0:00:22
922600 -- (-2093.917) (-2078.598) [-2073.425] (-2076.171) * (-2075.048) [-2076.278] (-2083.995) (-2083.871) -- 0:00:22
922700 -- (-2083.362) (-2078.842) [-2075.031] (-2072.179) * [-2075.371] (-2076.394) (-2083.273) (-2083.493) -- 0:00:22
922800 -- (-2088.627) (-2078.791) (-2078.514) [-2071.986] * [-2072.637] (-2074.072) (-2087.980) (-2079.335) -- 0:00:22
922900 -- (-2081.574) (-2081.284) (-2078.139) [-2078.006] * (-2077.620) (-2082.398) [-2078.343] (-2083.740) -- 0:00:22
923000 -- (-2091.385) (-2082.383) (-2076.647) [-2076.626] * [-2077.046] (-2083.220) (-2084.257) (-2087.958) -- 0:00:22
Average standard deviation of split frequencies: 0.003428
923100 -- (-2092.342) (-2080.906) [-2072.212] (-2076.762) * [-2074.260] (-2084.466) (-2091.816) (-2079.209) -- 0:00:22
923200 -- [-2082.795] (-2091.383) (-2084.365) (-2075.727) * [-2072.046] (-2071.429) (-2094.034) (-2081.833) -- 0:00:22
923300 -- (-2076.738) (-2083.857) (-2078.196) [-2076.922] * [-2074.993] (-2076.864) (-2080.798) (-2083.688) -- 0:00:22
923400 -- (-2081.027) (-2090.663) (-2075.587) [-2079.721] * [-2073.109] (-2078.843) (-2080.651) (-2080.176) -- 0:00:21
923500 -- (-2087.783) (-2082.729) [-2074.373] (-2076.686) * (-2071.664) [-2076.543] (-2086.238) (-2080.141) -- 0:00:21
923600 -- (-2093.554) (-2085.548) [-2077.736] (-2087.990) * [-2068.747] (-2077.542) (-2084.304) (-2088.848) -- 0:00:21
923700 -- (-2085.115) (-2079.201) [-2073.385] (-2082.365) * (-2073.832) (-2079.336) (-2088.683) [-2075.381] -- 0:00:21
923800 -- (-2079.750) (-2087.654) [-2070.656] (-2082.832) * (-2076.141) (-2087.613) (-2084.390) [-2075.615] -- 0:00:21
923900 -- (-2081.311) (-2080.986) (-2069.460) [-2088.419] * (-2073.284) (-2070.484) (-2084.063) [-2076.741] -- 0:00:21
924000 -- (-2075.453) (-2090.578) [-2072.813] (-2081.262) * [-2077.039] (-2081.597) (-2080.364) (-2073.934) -- 0:00:21
Average standard deviation of split frequencies: 0.003279
924100 -- (-2075.270) (-2086.141) [-2079.631] (-2088.341) * (-2080.321) (-2082.345) (-2079.969) [-2072.682] -- 0:00:21
924200 -- [-2075.025] (-2080.409) (-2073.697) (-2085.057) * (-2083.404) (-2081.069) (-2087.166) [-2081.350] -- 0:00:21
924300 -- (-2074.154) (-2084.221) [-2070.226] (-2076.607) * (-2082.083) [-2072.221] (-2080.893) (-2076.084) -- 0:00:21
924400 -- (-2077.872) (-2086.947) [-2076.902] (-2086.671) * (-2092.492) (-2075.886) (-2077.760) [-2079.026] -- 0:00:21
924500 -- [-2074.512] (-2079.439) (-2071.598) (-2085.714) * (-2081.162) (-2074.667) [-2080.113] (-2083.560) -- 0:00:21
924600 -- (-2078.983) (-2077.147) [-2074.165] (-2086.094) * (-2073.137) [-2073.333] (-2078.929) (-2081.608) -- 0:00:21
924700 -- (-2086.164) (-2078.280) [-2075.523] (-2093.527) * [-2073.886] (-2079.158) (-2082.058) (-2079.427) -- 0:00:21
924800 -- (-2078.212) [-2075.161] (-2071.139) (-2082.764) * [-2067.433] (-2075.094) (-2081.663) (-2082.804) -- 0:00:21
924900 -- (-2078.376) (-2077.350) [-2068.709] (-2086.241) * (-2076.936) (-2085.668) (-2087.012) [-2071.426] -- 0:00:21
925000 -- (-2083.267) (-2078.173) [-2066.904] (-2079.079) * [-2071.022] (-2077.622) (-2080.943) (-2075.220) -- 0:00:21
Average standard deviation of split frequencies: 0.003290
925100 -- (-2079.532) (-2082.098) [-2067.599] (-2083.166) * [-2069.522] (-2078.341) (-2079.464) (-2080.245) -- 0:00:21
925200 -- (-2076.495) (-2080.463) [-2069.262] (-2084.513) * (-2072.717) (-2075.862) (-2081.730) [-2075.041] -- 0:00:21
925300 -- [-2074.326] (-2074.036) (-2067.532) (-2087.872) * (-2070.770) (-2071.146) (-2086.566) [-2075.180] -- 0:00:21
925400 -- (-2080.829) [-2075.759] (-2082.364) (-2078.372) * [-2073.924] (-2078.869) (-2087.321) (-2075.506) -- 0:00:21
925500 -- [-2078.167] (-2083.628) (-2077.101) (-2074.494) * [-2079.056] (-2081.383) (-2079.167) (-2083.263) -- 0:00:21
925600 -- (-2081.749) (-2084.472) [-2074.753] (-2079.742) * [-2071.970] (-2091.663) (-2082.604) (-2079.703) -- 0:00:21
925700 -- (-2083.943) (-2089.777) [-2077.923] (-2079.706) * [-2075.569] (-2075.886) (-2078.364) (-2077.442) -- 0:00:21
925800 -- (-2082.373) (-2088.484) [-2074.185] (-2082.526) * (-2073.162) [-2073.256] (-2077.055) (-2084.729) -- 0:00:21
925900 -- (-2083.339) (-2076.649) [-2074.014] (-2081.999) * (-2075.556) [-2071.120] (-2085.057) (-2078.034) -- 0:00:21
926000 -- (-2082.481) [-2076.368] (-2074.836) (-2086.770) * (-2078.063) [-2071.249] (-2095.651) (-2072.935) -- 0:00:21
Average standard deviation of split frequencies: 0.003359
926100 -- (-2086.847) (-2085.130) (-2082.695) [-2073.258] * [-2074.940] (-2077.439) (-2078.121) (-2072.691) -- 0:00:21
926200 -- (-2089.244) [-2076.479] (-2079.371) (-2075.440) * (-2077.893) (-2077.672) [-2077.029] (-2072.902) -- 0:00:21
926300 -- (-2088.188) (-2077.259) [-2077.144] (-2076.029) * (-2090.210) (-2077.030) (-2082.794) [-2082.191] -- 0:00:21
926400 -- [-2077.329] (-2081.570) (-2088.192) (-2080.780) * (-2077.408) (-2079.316) (-2081.901) [-2081.203] -- 0:00:21
926500 -- (-2086.602) (-2081.909) [-2075.413] (-2078.763) * (-2081.561) (-2073.306) (-2078.735) [-2083.636] -- 0:00:21
926600 -- (-2082.754) (-2084.769) (-2074.253) [-2074.012] * (-2076.488) (-2072.129) (-2077.333) [-2072.771] -- 0:00:21
926700 -- (-2093.219) (-2091.655) (-2075.079) [-2074.322] * (-2073.436) [-2075.132] (-2077.485) (-2079.149) -- 0:00:21
926800 -- (-2090.874) (-2085.071) [-2072.486] (-2078.321) * (-2076.417) [-2072.113] (-2075.811) (-2078.529) -- 0:00:21
926900 -- (-2077.654) (-2076.265) [-2075.164] (-2074.780) * (-2079.550) [-2073.686] (-2080.267) (-2076.085) -- 0:00:20
927000 -- (-2087.351) (-2081.654) [-2074.628] (-2080.636) * (-2078.499) (-2077.932) (-2084.707) [-2082.235] -- 0:00:20
Average standard deviation of split frequencies: 0.003312
927100 -- (-2077.265) (-2080.340) [-2082.851] (-2078.695) * (-2082.302) [-2076.077] (-2081.636) (-2075.887) -- 0:00:20
927200 -- [-2078.739] (-2087.715) (-2083.941) (-2080.435) * [-2077.245] (-2071.842) (-2087.268) (-2080.074) -- 0:00:20
927300 -- [-2071.981] (-2087.584) (-2072.032) (-2078.478) * (-2080.759) [-2071.315] (-2094.781) (-2080.119) -- 0:00:20
927400 -- (-2076.618) (-2076.816) (-2074.117) [-2082.357] * [-2081.469] (-2074.445) (-2091.028) (-2080.621) -- 0:00:20
927500 -- (-2076.107) (-2077.901) [-2082.178] (-2085.524) * (-2077.995) [-2071.917] (-2091.380) (-2080.100) -- 0:00:20
927600 -- (-2082.354) [-2083.472] (-2082.975) (-2078.421) * (-2082.649) [-2071.590] (-2086.743) (-2074.766) -- 0:00:20
927700 -- (-2079.451) [-2079.800] (-2085.602) (-2078.487) * (-2080.241) [-2071.771] (-2089.009) (-2083.909) -- 0:00:20
927800 -- (-2080.180) [-2074.059] (-2084.750) (-2082.481) * (-2083.128) [-2069.520] (-2087.228) (-2078.977) -- 0:00:20
927900 -- [-2077.889] (-2074.161) (-2084.701) (-2088.865) * (-2080.231) [-2080.222] (-2094.701) (-2090.864) -- 0:00:20
928000 -- [-2076.423] (-2078.723) (-2078.567) (-2080.794) * (-2079.462) [-2072.957] (-2094.969) (-2089.685) -- 0:00:20
Average standard deviation of split frequencies: 0.003251
928100 -- (-2078.987) [-2072.641] (-2080.083) (-2097.648) * (-2077.661) [-2070.755] (-2085.663) (-2082.959) -- 0:00:20
928200 -- (-2079.367) [-2078.672] (-2072.314) (-2093.557) * (-2083.595) (-2080.129) [-2088.251] (-2084.174) -- 0:00:20
928300 -- (-2084.788) [-2079.901] (-2078.231) (-2082.565) * (-2079.812) [-2080.466] (-2090.349) (-2084.646) -- 0:00:20
928400 -- (-2091.224) (-2076.372) (-2075.734) [-2074.694] * [-2082.922] (-2075.383) (-2081.332) (-2079.894) -- 0:00:20
928500 -- (-2086.494) (-2078.632) (-2078.689) [-2071.255] * (-2077.304) [-2075.173] (-2082.103) (-2084.877) -- 0:00:20
928600 -- (-2083.539) [-2080.425] (-2076.729) (-2069.931) * [-2074.451] (-2076.017) (-2082.312) (-2080.706) -- 0:00:20
928700 -- (-2085.399) (-2081.366) (-2074.099) [-2069.969] * [-2078.587] (-2073.822) (-2086.210) (-2078.477) -- 0:00:20
928800 -- (-2092.953) (-2092.548) (-2070.925) [-2071.250] * (-2072.368) (-2080.472) (-2085.007) [-2076.177] -- 0:00:20
928900 -- (-2087.326) (-2083.542) (-2071.928) [-2073.954] * [-2074.971] (-2081.810) (-2076.097) (-2077.860) -- 0:00:20
929000 -- (-2090.147) (-2079.264) [-2069.313] (-2069.832) * (-2072.471) [-2080.061] (-2088.381) (-2077.944) -- 0:00:20
Average standard deviation of split frequencies: 0.003116
929100 -- (-2089.567) [-2073.748] (-2071.167) (-2076.777) * (-2077.311) (-2082.084) (-2084.271) [-2076.422] -- 0:00:20
929200 -- (-2083.195) [-2073.395] (-2073.324) (-2076.951) * [-2074.882] (-2077.738) (-2079.871) (-2077.351) -- 0:00:20
929300 -- [-2073.007] (-2079.155) (-2077.857) (-2074.055) * [-2076.417] (-2089.105) (-2084.387) (-2080.111) -- 0:00:20
929400 -- (-2080.919) (-2086.888) [-2073.726] (-2081.316) * [-2070.880] (-2084.525) (-2078.324) (-2079.494) -- 0:00:20
929500 -- (-2077.391) (-2085.708) [-2072.201] (-2080.336) * (-2072.202) (-2082.627) (-2083.402) [-2074.546] -- 0:00:20
929600 -- (-2075.160) (-2097.115) [-2072.065] (-2082.217) * [-2069.654] (-2082.114) (-2088.622) (-2078.797) -- 0:00:20
929700 -- [-2075.398] (-2093.623) (-2069.252) (-2081.515) * [-2071.210] (-2082.270) (-2080.561) (-2080.539) -- 0:00:20
929800 -- [-2080.092] (-2086.391) (-2073.249) (-2076.129) * (-2078.377) [-2072.564] (-2087.648) (-2081.039) -- 0:00:20
929900 -- (-2077.294) (-2083.182) [-2075.554] (-2082.532) * (-2081.106) (-2077.783) (-2082.500) [-2074.451] -- 0:00:20
930000 -- (-2073.715) (-2074.417) [-2069.915] (-2074.858) * (-2072.783) [-2075.653] (-2084.936) (-2082.880) -- 0:00:20
Average standard deviation of split frequencies: 0.003215
930100 -- (-2080.116) (-2078.757) [-2073.678] (-2073.212) * [-2073.839] (-2077.869) (-2094.801) (-2080.584) -- 0:00:20
930200 -- [-2081.112] (-2085.238) (-2070.416) (-2076.332) * [-2073.238] (-2070.562) (-2085.329) (-2075.294) -- 0:00:20
930300 -- [-2080.429] (-2076.780) (-2072.352) (-2076.413) * (-2080.117) [-2073.745] (-2080.492) (-2079.026) -- 0:00:20
930400 -- (-2085.924) [-2077.545] (-2076.505) (-2068.885) * [-2075.185] (-2070.296) (-2082.922) (-2084.046) -- 0:00:19
930500 -- (-2080.779) (-2081.062) [-2075.480] (-2069.266) * (-2073.859) (-2070.827) [-2078.734] (-2082.180) -- 0:00:19
930600 -- (-2077.994) (-2084.657) (-2078.664) [-2069.501] * (-2075.473) [-2075.575] (-2076.029) (-2086.874) -- 0:00:19
930700 -- (-2078.188) (-2085.648) (-2082.726) [-2072.548] * (-2078.493) [-2082.497] (-2081.039) (-2093.228) -- 0:00:19
930800 -- (-2076.479) (-2085.312) (-2087.698) [-2068.380] * [-2077.736] (-2072.654) (-2079.537) (-2079.040) -- 0:00:19
930900 -- (-2080.698) [-2081.990] (-2091.613) (-2071.856) * (-2081.038) (-2077.045) [-2080.185] (-2076.664) -- 0:00:19
931000 -- (-2083.976) [-2080.850] (-2084.980) (-2082.242) * (-2082.357) [-2069.864] (-2083.044) (-2082.070) -- 0:00:19
Average standard deviation of split frequencies: 0.003341
931100 -- (-2082.612) [-2078.872] (-2075.852) (-2073.669) * [-2070.655] (-2074.059) (-2075.304) (-2081.743) -- 0:00:19
931200 -- (-2077.985) (-2080.843) (-2080.975) [-2072.752] * [-2071.292] (-2074.495) (-2077.441) (-2084.402) -- 0:00:19
931300 -- [-2080.068] (-2081.293) (-2069.299) (-2071.721) * (-2073.825) (-2071.717) (-2076.594) [-2076.537] -- 0:00:19
931400 -- (-2083.113) (-2078.620) [-2070.120] (-2070.073) * [-2072.968] (-2094.622) (-2077.717) (-2074.397) -- 0:00:19
931500 -- (-2083.257) (-2074.319) (-2075.218) [-2067.995] * [-2072.565] (-2075.508) (-2077.699) (-2086.874) -- 0:00:19
931600 -- (-2076.756) (-2078.334) [-2073.478] (-2069.046) * [-2070.001] (-2072.694) (-2083.700) (-2079.123) -- 0:00:19
931700 -- (-2080.859) (-2080.024) [-2073.396] (-2070.739) * [-2075.849] (-2070.039) (-2088.514) (-2082.886) -- 0:00:19
931800 -- (-2083.881) (-2075.259) [-2069.502] (-2071.342) * (-2083.593) [-2067.475] (-2081.666) (-2088.152) -- 0:00:19
931900 -- (-2084.672) (-2076.874) (-2070.695) [-2078.205] * (-2080.467) [-2067.367] (-2078.296) (-2080.197) -- 0:00:19
932000 -- [-2081.135] (-2077.525) (-2079.196) (-2082.822) * (-2079.074) [-2072.445] (-2077.263) (-2083.847) -- 0:00:19
Average standard deviation of split frequencies: 0.003381
932100 -- (-2081.540) (-2073.176) [-2073.235] (-2081.750) * (-2081.607) [-2070.243] (-2079.525) (-2082.213) -- 0:00:19
932200 -- (-2081.167) (-2082.042) [-2075.080] (-2075.361) * [-2069.486] (-2074.776) (-2087.712) (-2081.784) -- 0:00:19
932300 -- [-2079.323] (-2077.286) (-2075.724) (-2082.180) * (-2079.368) [-2071.872] (-2085.963) (-2079.410) -- 0:00:19
932400 -- (-2087.773) [-2077.611] (-2077.846) (-2079.427) * (-2074.868) [-2071.092] (-2083.558) (-2084.172) -- 0:00:19
932500 -- (-2082.524) (-2089.234) (-2085.326) [-2076.269] * (-2072.863) [-2071.001] (-2079.166) (-2089.775) -- 0:00:19
932600 -- (-2077.391) (-2081.243) (-2090.035) [-2070.073] * (-2072.410) [-2069.935] (-2082.312) (-2089.831) -- 0:00:19
932700 -- (-2080.804) (-2091.779) (-2076.648) [-2073.800] * [-2073.226] (-2066.468) (-2091.539) (-2075.518) -- 0:00:19
932800 -- (-2078.881) (-2093.630) (-2082.317) [-2067.594] * (-2071.653) [-2071.404] (-2076.758) (-2076.734) -- 0:00:19
932900 -- (-2075.881) (-2087.322) (-2081.431) [-2073.998] * [-2067.504] (-2071.719) (-2080.169) (-2080.832) -- 0:00:19
933000 -- (-2086.477) [-2086.613] (-2075.379) (-2084.403) * (-2068.601) (-2070.518) [-2082.197] (-2085.117) -- 0:00:19
Average standard deviation of split frequencies: 0.003377
933100 -- (-2084.264) [-2081.232] (-2080.860) (-2074.922) * (-2073.925) [-2073.181] (-2084.955) (-2087.295) -- 0:00:19
933200 -- (-2077.823) (-2093.689) [-2074.513] (-2074.256) * (-2079.855) [-2072.837] (-2084.535) (-2092.733) -- 0:00:19
933300 -- (-2075.951) (-2080.316) [-2080.362] (-2076.729) * (-2075.533) (-2074.849) [-2078.873] (-2078.938) -- 0:00:19
933400 -- (-2075.944) (-2082.047) [-2075.162] (-2085.828) * (-2082.791) (-2074.779) [-2083.479] (-2080.795) -- 0:00:19
933500 -- [-2075.458] (-2081.540) (-2072.425) (-2082.384) * (-2077.631) [-2070.374] (-2078.460) (-2085.475) -- 0:00:19
933600 -- (-2079.374) (-2088.428) (-2079.285) [-2077.959] * (-2074.005) [-2069.544] (-2075.175) (-2083.874) -- 0:00:19
933700 -- (-2080.178) (-2080.955) (-2080.228) [-2077.600] * (-2083.048) (-2070.923) [-2080.091] (-2078.713) -- 0:00:19
933800 -- (-2084.616) (-2082.039) (-2077.998) [-2078.329] * (-2078.938) [-2076.487] (-2080.801) (-2079.666) -- 0:00:18
933900 -- (-2078.783) (-2088.286) [-2075.884] (-2075.515) * (-2069.582) [-2078.174] (-2076.688) (-2092.126) -- 0:00:18
934000 -- (-2077.440) (-2089.621) (-2072.369) [-2074.612] * (-2071.509) [-2070.204] (-2083.605) (-2084.963) -- 0:00:18
Average standard deviation of split frequencies: 0.003403
934100 -- (-2077.478) (-2083.355) (-2073.060) [-2076.015] * [-2075.856] (-2071.975) (-2083.004) (-2081.345) -- 0:00:18
934200 -- (-2077.236) (-2083.583) [-2073.629] (-2074.912) * (-2075.238) [-2069.861] (-2084.324) (-2076.734) -- 0:00:18
934300 -- (-2077.730) (-2084.519) (-2070.529) [-2074.813] * [-2070.217] (-2068.496) (-2099.406) (-2082.442) -- 0:00:18
934400 -- (-2085.948) (-2081.264) [-2077.076] (-2071.574) * (-2074.093) (-2070.207) (-2100.871) [-2075.956] -- 0:00:18
934500 -- (-2086.391) (-2082.940) [-2073.128] (-2070.508) * [-2073.558] (-2070.310) (-2091.258) (-2082.204) -- 0:00:18
934600 -- (-2079.319) [-2075.347] (-2076.218) (-2081.180) * (-2071.328) [-2074.480] (-2102.307) (-2084.733) -- 0:00:18
934700 -- (-2079.212) [-2075.795] (-2077.698) (-2080.460) * (-2074.843) [-2074.721] (-2090.262) (-2086.194) -- 0:00:18
934800 -- (-2087.098) (-2080.172) (-2081.051) [-2076.185] * (-2077.124) [-2071.343] (-2093.146) (-2084.406) -- 0:00:18
934900 -- (-2084.979) [-2073.921] (-2079.945) (-2070.978) * (-2085.898) [-2074.202] (-2088.000) (-2081.324) -- 0:00:18
935000 -- (-2081.394) (-2073.398) [-2073.630] (-2088.734) * (-2078.089) [-2076.984] (-2082.040) (-2080.679) -- 0:00:18
Average standard deviation of split frequencies: 0.003557
935100 -- (-2081.867) (-2079.952) (-2078.543) [-2080.535] * (-2086.360) (-2073.290) (-2083.979) [-2080.744] -- 0:00:18
935200 -- [-2077.759] (-2089.457) (-2081.559) (-2084.902) * (-2082.988) [-2069.646] (-2084.933) (-2081.095) -- 0:00:18
935300 -- (-2079.707) (-2079.878) [-2072.434] (-2084.392) * (-2074.527) [-2070.809] (-2087.310) (-2078.404) -- 0:00:18
935400 -- [-2075.175] (-2074.885) (-2076.585) (-2076.132) * (-2073.608) [-2073.060] (-2087.882) (-2070.736) -- 0:00:18
935500 -- (-2079.441) [-2075.001] (-2070.850) (-2076.631) * (-2079.670) [-2075.368] (-2085.244) (-2071.684) -- 0:00:18
935600 -- (-2076.697) (-2079.789) [-2070.449] (-2079.557) * [-2075.157] (-2073.348) (-2084.132) (-2080.940) -- 0:00:18
935700 -- (-2081.630) (-2076.521) [-2072.565] (-2074.138) * [-2076.135] (-2073.992) (-2083.033) (-2084.819) -- 0:00:18
935800 -- (-2087.845) (-2077.532) (-2073.299) [-2070.187] * (-2076.334) [-2071.780] (-2079.597) (-2080.398) -- 0:00:18
935900 -- (-2083.155) (-2088.365) [-2072.090] (-2079.827) * (-2082.673) [-2071.640] (-2082.764) (-2086.812) -- 0:00:18
936000 -- (-2081.599) (-2079.775) [-2074.477] (-2091.127) * (-2089.050) [-2071.606] (-2081.717) (-2085.264) -- 0:00:18
Average standard deviation of split frequencies: 0.003539
936100 -- (-2080.544) [-2075.185] (-2069.781) (-2082.015) * (-2077.417) [-2068.358] (-2088.159) (-2090.545) -- 0:00:18
936200 -- (-2082.271) (-2079.142) [-2075.290] (-2081.347) * (-2072.001) [-2072.903] (-2093.551) (-2077.401) -- 0:00:18
936300 -- (-2089.441) (-2081.335) [-2073.027] (-2076.602) * (-2081.716) [-2071.668] (-2084.757) (-2086.277) -- 0:00:18
936400 -- (-2084.970) (-2082.273) [-2073.262] (-2076.055) * [-2080.110] (-2075.443) (-2080.200) (-2085.785) -- 0:00:18
936500 -- (-2082.249) (-2083.267) [-2073.252] (-2078.612) * (-2078.789) [-2075.873] (-2076.062) (-2091.427) -- 0:00:18
936600 -- (-2082.553) [-2078.063] (-2073.513) (-2092.074) * (-2079.921) [-2073.098] (-2084.925) (-2077.560) -- 0:00:18
936700 -- (-2090.376) (-2081.823) [-2075.609] (-2080.265) * (-2080.671) [-2072.360] (-2094.277) (-2080.142) -- 0:00:18
936800 -- (-2091.792) (-2083.582) (-2077.118) [-2071.003] * (-2084.053) (-2071.377) (-2076.148) [-2081.512] -- 0:00:18
936900 -- (-2083.246) (-2080.685) [-2074.209] (-2077.036) * (-2078.756) (-2073.456) [-2074.083] (-2081.754) -- 0:00:18
937000 -- (-2075.047) [-2082.264] (-2076.263) (-2078.073) * (-2072.348) (-2075.825) (-2078.948) [-2078.626] -- 0:00:18
Average standard deviation of split frequencies: 0.003507
937100 -- (-2080.168) (-2083.543) (-2075.187) [-2072.159] * (-2081.410) [-2077.363] (-2083.834) (-2077.189) -- 0:00:18
937200 -- (-2077.797) (-2084.818) [-2069.399] (-2073.203) * (-2079.942) [-2068.080] (-2084.232) (-2082.982) -- 0:00:18
937300 -- (-2084.055) [-2074.715] (-2071.663) (-2074.901) * (-2080.283) [-2077.294] (-2089.820) (-2082.637) -- 0:00:17
937400 -- (-2084.525) (-2078.486) (-2078.980) [-2073.864] * (-2073.951) [-2072.921] (-2091.122) (-2078.423) -- 0:00:17
937500 -- (-2087.020) (-2078.484) [-2070.641] (-2088.129) * (-2084.624) (-2086.193) (-2084.315) [-2075.446] -- 0:00:17
937600 -- (-2082.524) [-2070.657] (-2073.144) (-2080.747) * (-2082.367) (-2080.643) (-2078.967) [-2075.100] -- 0:00:17
937700 -- (-2088.732) (-2081.600) (-2077.236) [-2069.779] * (-2079.320) (-2083.462) (-2078.729) [-2076.786] -- 0:00:17
937800 -- (-2080.942) (-2080.469) (-2075.308) [-2077.114] * (-2076.534) (-2086.719) [-2077.763] (-2078.368) -- 0:00:17
937900 -- (-2077.104) (-2081.454) [-2072.122] (-2079.975) * [-2071.872] (-2074.961) (-2081.025) (-2080.376) -- 0:00:17
938000 -- (-2075.080) (-2087.393) [-2075.357] (-2079.898) * (-2075.174) (-2074.814) (-2084.015) [-2074.340] -- 0:00:17
Average standard deviation of split frequencies: 0.003474
938100 -- (-2079.503) (-2079.626) (-2082.618) [-2073.996] * (-2071.638) (-2079.611) (-2079.207) [-2075.434] -- 0:00:17
938200 -- (-2083.863) (-2079.474) [-2073.021] (-2078.503) * [-2072.684] (-2074.829) (-2082.790) (-2076.803) -- 0:00:17
938300 -- (-2072.241) (-2081.258) [-2076.025] (-2075.088) * (-2072.948) (-2082.663) [-2072.336] (-2093.388) -- 0:00:17
938400 -- (-2075.920) (-2074.932) (-2072.817) [-2073.232] * (-2076.089) [-2074.021] (-2079.192) (-2095.559) -- 0:00:17
938500 -- (-2076.126) (-2074.209) (-2075.704) [-2075.398] * (-2089.714) [-2077.326] (-2082.715) (-2091.704) -- 0:00:17
938600 -- (-2093.808) [-2067.254] (-2076.377) (-2086.564) * (-2074.272) [-2076.114] (-2082.733) (-2092.547) -- 0:00:17
938700 -- (-2091.883) [-2067.680] (-2075.768) (-2077.922) * (-2070.515) [-2078.637] (-2077.889) (-2078.296) -- 0:00:17
938800 -- (-2089.080) [-2079.887] (-2075.075) (-2073.388) * (-2072.241) (-2079.997) (-2081.537) [-2075.117] -- 0:00:17
938900 -- (-2084.795) (-2075.365) [-2071.538] (-2075.925) * (-2074.398) [-2071.269] (-2087.944) (-2077.945) -- 0:00:17
939000 -- (-2080.147) [-2079.907] (-2075.311) (-2074.486) * [-2073.195] (-2072.459) (-2074.141) (-2077.463) -- 0:00:17
Average standard deviation of split frequencies: 0.003528
939100 -- (-2077.207) (-2075.203) [-2074.471] (-2082.619) * [-2072.917] (-2071.338) (-2074.523) (-2085.141) -- 0:00:17
939200 -- (-2081.290) [-2072.378] (-2078.548) (-2077.088) * (-2074.491) [-2070.844] (-2087.770) (-2079.866) -- 0:00:17
939300 -- (-2086.914) [-2071.666] (-2076.671) (-2089.307) * (-2070.174) (-2073.552) (-2082.447) [-2077.635] -- 0:00:17
939400 -- (-2087.498) (-2068.915) [-2075.603] (-2082.235) * [-2072.784] (-2073.463) (-2089.414) (-2082.511) -- 0:00:17
939500 -- (-2080.910) (-2079.874) [-2075.919] (-2082.711) * (-2072.812) [-2071.560] (-2080.783) (-2077.961) -- 0:00:17
939600 -- (-2081.173) [-2075.855] (-2076.127) (-2072.256) * [-2076.909] (-2072.343) (-2085.283) (-2086.438) -- 0:00:17
939700 -- (-2090.252) [-2070.648] (-2078.084) (-2079.021) * (-2072.340) [-2068.915] (-2080.123) (-2085.592) -- 0:00:17
939800 -- (-2085.738) (-2078.546) [-2075.520] (-2074.521) * (-2072.686) (-2070.479) [-2076.905] (-2084.169) -- 0:00:17
939900 -- (-2088.503) (-2084.826) (-2074.168) [-2072.841] * (-2075.500) [-2072.259] (-2088.723) (-2084.492) -- 0:00:17
940000 -- (-2089.231) (-2083.248) (-2084.039) [-2070.125] * [-2072.410] (-2070.266) (-2083.839) (-2084.095) -- 0:00:17
Average standard deviation of split frequencies: 0.003653
940100 -- (-2084.048) (-2076.556) (-2082.636) [-2075.379] * [-2072.845] (-2072.538) (-2079.657) (-2082.317) -- 0:00:17
940200 -- (-2089.097) (-2076.953) (-2094.623) [-2069.221] * (-2079.782) [-2076.837] (-2084.200) (-2072.883) -- 0:00:17
940300 -- (-2081.862) (-2077.049) (-2091.560) [-2069.202] * (-2084.092) [-2071.802] (-2088.152) (-2077.212) -- 0:00:17
940400 -- (-2086.233) (-2076.821) [-2083.769] (-2073.669) * [-2072.797] (-2079.448) (-2081.192) (-2080.255) -- 0:00:17
940500 -- (-2079.382) (-2069.478) (-2086.133) [-2074.388] * [-2069.839] (-2079.692) (-2082.901) (-2086.464) -- 0:00:17
940600 -- (-2077.470) (-2073.108) (-2080.679) [-2073.200] * [-2069.666] (-2076.254) (-2082.755) (-2082.241) -- 0:00:17
940700 -- [-2079.996] (-2070.864) (-2085.722) (-2081.873) * (-2075.118) [-2075.936] (-2085.522) (-2076.546) -- 0:00:17
940800 -- [-2079.580] (-2069.825) (-2093.705) (-2081.751) * (-2073.475) [-2072.785] (-2093.984) (-2077.218) -- 0:00:16
940900 -- (-2082.925) [-2078.536] (-2082.640) (-2074.308) * (-2070.950) [-2077.817] (-2085.654) (-2079.546) -- 0:00:16
941000 -- (-2074.776) [-2077.274] (-2081.068) (-2075.849) * (-2073.680) (-2066.515) (-2080.121) [-2077.506] -- 0:00:16
Average standard deviation of split frequencies: 0.003649
941100 -- (-2083.824) [-2074.686] (-2089.304) (-2080.570) * (-2068.579) (-2069.181) (-2086.895) [-2078.898] -- 0:00:16
941200 -- (-2080.652) [-2076.349] (-2092.190) (-2085.187) * (-2078.913) [-2066.996] (-2083.487) (-2076.539) -- 0:00:16
941300 -- (-2083.009) [-2070.093] (-2082.691) (-2079.649) * (-2077.503) [-2068.284] (-2082.908) (-2074.196) -- 0:00:16
941400 -- (-2082.800) [-2071.077] (-2089.345) (-2082.710) * (-2084.721) [-2070.798] (-2081.635) (-2072.649) -- 0:00:16
941500 -- (-2085.108) [-2068.287] (-2078.135) (-2089.647) * (-2080.133) [-2073.928] (-2082.293) (-2077.762) -- 0:00:16
941600 -- (-2076.891) [-2065.128] (-2077.412) (-2077.841) * (-2081.457) [-2071.980] (-2081.267) (-2076.463) -- 0:00:16
941700 -- (-2091.215) [-2068.766] (-2074.895) (-2084.653) * (-2079.145) [-2068.904] (-2079.872) (-2079.476) -- 0:00:16
941800 -- (-2083.642) (-2069.899) [-2078.648] (-2084.022) * (-2077.744) [-2068.073] (-2087.821) (-2079.078) -- 0:00:16
941900 -- (-2080.716) [-2073.035] (-2071.094) (-2085.473) * [-2071.937] (-2069.420) (-2093.748) (-2078.585) -- 0:00:16
942000 -- (-2073.639) [-2071.898] (-2072.511) (-2096.201) * (-2072.336) [-2071.988] (-2084.220) (-2078.339) -- 0:00:16
Average standard deviation of split frequencies: 0.003560
942100 -- (-2080.785) [-2072.944] (-2075.764) (-2093.373) * (-2079.281) [-2071.467] (-2082.376) (-2080.967) -- 0:00:16
942200 -- (-2085.122) (-2080.398) [-2070.220] (-2100.382) * (-2074.899) [-2073.112] (-2086.832) (-2076.532) -- 0:00:16
942300 -- (-2084.341) [-2079.500] (-2070.365) (-2096.955) * (-2075.346) (-2074.174) (-2083.126) [-2085.316] -- 0:00:16
942400 -- (-2075.846) (-2079.790) [-2074.452] (-2092.141) * [-2080.884] (-2070.772) (-2079.863) (-2077.365) -- 0:00:16
942500 -- (-2072.980) [-2072.300] (-2075.394) (-2095.369) * (-2079.065) [-2073.535] (-2084.721) (-2077.501) -- 0:00:16
942600 -- [-2072.664] (-2081.041) (-2075.135) (-2082.939) * (-2079.890) [-2075.920] (-2086.733) (-2080.803) -- 0:00:16
942700 -- [-2077.673] (-2074.932) (-2081.828) (-2089.324) * (-2078.879) [-2078.033] (-2084.295) (-2083.808) -- 0:00:16
942800 -- (-2082.577) (-2079.020) [-2072.693] (-2082.620) * [-2077.337] (-2073.832) (-2085.238) (-2073.209) -- 0:00:16
942900 -- [-2078.884] (-2086.574) (-2075.552) (-2078.577) * (-2079.166) [-2070.559] (-2077.755) (-2072.233) -- 0:00:16
943000 -- (-2078.213) (-2078.657) (-2076.998) [-2078.021] * [-2071.474] (-2069.607) (-2075.061) (-2079.237) -- 0:00:16
Average standard deviation of split frequencies: 0.003613
943100 -- (-2076.175) (-2083.227) (-2076.891) [-2075.511] * (-2072.241) [-2072.455] (-2074.994) (-2081.217) -- 0:00:16
943200 -- (-2078.613) (-2089.379) (-2078.387) [-2076.763] * (-2090.519) (-2078.228) (-2077.608) [-2076.109] -- 0:00:16
943300 -- (-2075.944) (-2089.393) [-2076.621] (-2072.391) * (-2081.695) [-2078.773] (-2076.991) (-2075.554) -- 0:00:16
943400 -- (-2076.403) (-2083.401) [-2073.736] (-2076.895) * (-2077.311) [-2077.689] (-2073.561) (-2083.968) -- 0:00:16
943500 -- (-2088.594) (-2084.869) (-2077.928) [-2075.312] * (-2087.330) (-2076.901) [-2078.968] (-2079.371) -- 0:00:16
943600 -- (-2078.929) (-2083.299) (-2077.295) [-2072.689] * [-2074.244] (-2075.263) (-2078.769) (-2084.053) -- 0:00:16
943700 -- [-2082.925] (-2082.443) (-2071.816) (-2076.692) * (-2073.681) (-2074.704) (-2084.736) [-2077.594] -- 0:00:16
943800 -- (-2081.361) [-2075.129] (-2073.757) (-2076.589) * [-2068.595] (-2074.959) (-2080.510) (-2077.357) -- 0:00:16
943900 -- (-2082.747) (-2079.256) (-2081.525) [-2074.681] * [-2068.531] (-2083.476) (-2087.404) (-2085.909) -- 0:00:16
944000 -- (-2079.341) (-2077.589) [-2079.084] (-2078.698) * (-2070.133) [-2072.599] (-2085.795) (-2082.071) -- 0:00:16
Average standard deviation of split frequencies: 0.003566
944100 -- (-2074.915) [-2070.888] (-2074.590) (-2081.505) * (-2080.828) [-2072.171] (-2093.879) (-2081.000) -- 0:00:16
944200 -- [-2067.791] (-2078.752) (-2070.375) (-2085.075) * (-2076.844) [-2067.804] (-2089.589) (-2079.495) -- 0:00:16
944300 -- (-2068.746) (-2074.242) [-2069.379] (-2085.749) * (-2074.445) [-2071.912] (-2081.900) (-2080.317) -- 0:00:15
944400 -- (-2073.863) (-2075.582) [-2068.476] (-2084.969) * (-2072.461) [-2069.237] (-2086.741) (-2080.177) -- 0:00:15
944500 -- [-2072.499] (-2089.661) (-2076.210) (-2080.521) * (-2076.239) (-2076.548) (-2091.122) [-2076.227] -- 0:00:15
944600 -- [-2072.512] (-2086.447) (-2073.817) (-2079.232) * [-2077.065] (-2078.289) (-2085.980) (-2079.933) -- 0:00:15
944700 -- (-2076.686) (-2083.522) [-2071.421] (-2084.908) * (-2076.309) [-2072.931] (-2081.338) (-2083.367) -- 0:00:15
944800 -- (-2073.311) [-2079.436] (-2075.100) (-2082.668) * [-2076.234] (-2075.662) (-2077.658) (-2082.305) -- 0:00:15
944900 -- (-2075.733) (-2081.473) [-2071.360] (-2077.988) * (-2083.992) [-2072.707] (-2077.580) (-2076.528) -- 0:00:15
945000 -- (-2110.240) [-2079.104] (-2078.765) (-2074.817) * (-2077.230) (-2081.555) (-2077.470) [-2080.636] -- 0:00:15
Average standard deviation of split frequencies: 0.003548
945100 -- (-2086.891) (-2080.922) (-2085.158) [-2074.809] * (-2078.253) (-2079.119) [-2077.567] (-2080.797) -- 0:00:15
945200 -- (-2077.525) (-2086.280) [-2075.815] (-2068.908) * (-2073.803) (-2078.016) [-2079.573] (-2086.755) -- 0:00:15
945300 -- (-2080.506) (-2091.340) [-2070.797] (-2073.432) * (-2081.121) (-2076.843) [-2077.746] (-2080.070) -- 0:00:15
945400 -- (-2084.357) (-2093.283) [-2076.642] (-2076.269) * (-2075.884) (-2075.842) [-2075.011] (-2081.342) -- 0:00:15
945500 -- (-2089.628) (-2092.446) [-2072.356] (-2075.833) * (-2075.226) [-2075.429] (-2083.318) (-2077.430) -- 0:00:15
945600 -- (-2079.950) (-2081.786) (-2079.035) [-2073.575] * [-2070.869] (-2072.584) (-2082.525) (-2085.558) -- 0:00:15
945700 -- (-2077.653) (-2086.972) (-2084.558) [-2072.944] * (-2076.811) [-2069.094] (-2074.983) (-2091.924) -- 0:00:15
945800 -- [-2073.422] (-2083.259) (-2078.614) (-2074.871) * [-2070.740] (-2073.125) (-2082.935) (-2093.423) -- 0:00:15
945900 -- (-2082.700) (-2080.171) (-2077.056) [-2068.946] * [-2067.428] (-2077.733) (-2086.028) (-2091.084) -- 0:00:15
946000 -- (-2087.645) (-2086.921) (-2079.879) [-2076.494] * (-2072.026) [-2074.129] (-2078.764) (-2097.069) -- 0:00:15
Average standard deviation of split frequencies: 0.003459
946100 -- (-2082.342) (-2080.442) (-2072.285) [-2077.093] * (-2075.361) [-2075.848] (-2080.009) (-2096.240) -- 0:00:15
946200 -- (-2078.612) [-2080.947] (-2073.091) (-2074.391) * [-2071.034] (-2078.019) (-2073.014) (-2086.167) -- 0:00:15
946300 -- (-2073.193) (-2082.560) (-2088.308) [-2072.009] * (-2068.062) [-2074.376] (-2077.115) (-2081.838) -- 0:00:15
946400 -- (-2080.202) (-2087.017) [-2076.094] (-2068.586) * (-2075.704) [-2083.345] (-2073.863) (-2085.483) -- 0:00:15
946500 -- (-2072.711) [-2077.393] (-2076.234) (-2074.156) * (-2071.037) (-2082.987) (-2076.434) [-2073.907] -- 0:00:15
946600 -- (-2077.589) (-2083.754) (-2080.183) [-2075.737] * (-2079.114) (-2077.340) [-2076.524] (-2087.392) -- 0:00:15
946700 -- (-2075.485) (-2086.615) [-2075.703] (-2073.984) * (-2078.563) [-2071.026] (-2076.069) (-2081.306) -- 0:00:15
946800 -- (-2075.250) (-2083.703) (-2077.798) [-2076.608] * (-2074.034) [-2070.439] (-2086.718) (-2077.188) -- 0:00:15
946900 -- (-2077.263) (-2091.108) [-2073.705] (-2076.504) * [-2073.434] (-2072.100) (-2077.071) (-2077.820) -- 0:00:15
947000 -- [-2074.430] (-2085.454) (-2079.027) (-2078.393) * (-2075.301) [-2075.708] (-2085.437) (-2089.616) -- 0:00:15
Average standard deviation of split frequencies: 0.003484
947100 -- [-2072.071] (-2079.940) (-2086.131) (-2077.116) * (-2079.217) [-2069.757] (-2086.340) (-2082.680) -- 0:00:15
947200 -- (-2069.094) (-2073.607) (-2079.580) [-2073.133] * (-2077.524) [-2071.855] (-2078.879) (-2074.982) -- 0:00:15
947300 -- (-2071.593) [-2076.197] (-2074.260) (-2074.426) * (-2078.741) [-2065.957] (-2080.175) (-2073.407) -- 0:00:15
947400 -- (-2075.354) [-2074.282] (-2073.014) (-2073.403) * (-2075.543) (-2068.577) (-2083.112) [-2079.348] -- 0:00:15
947500 -- (-2070.324) (-2076.380) (-2077.333) [-2074.335] * (-2073.980) [-2074.284] (-2088.167) (-2086.891) -- 0:00:15
947600 -- [-2068.863] (-2075.479) (-2078.054) (-2075.866) * [-2075.279] (-2072.269) (-2087.349) (-2084.576) -- 0:00:15
947700 -- (-2074.123) (-2078.929) (-2088.233) [-2073.214] * (-2074.159) [-2072.775] (-2079.764) (-2085.914) -- 0:00:15
947800 -- (-2080.517) (-2084.910) (-2079.712) [-2075.497] * [-2071.157] (-2076.194) (-2086.561) (-2086.894) -- 0:00:14
947900 -- [-2079.696] (-2079.037) (-2076.770) (-2076.952) * [-2070.458] (-2077.502) (-2078.878) (-2089.360) -- 0:00:15
948000 -- [-2095.490] (-2075.808) (-2076.894) (-2072.700) * (-2074.272) [-2072.679] (-2080.371) (-2085.069) -- 0:00:14
Average standard deviation of split frequencies: 0.003367
948100 -- (-2083.414) (-2075.992) (-2079.149) [-2077.900] * [-2070.786] (-2075.146) (-2079.571) (-2086.737) -- 0:00:14
948200 -- [-2072.497] (-2080.393) (-2079.281) (-2079.843) * (-2068.871) [-2069.251] (-2087.715) (-2078.690) -- 0:00:14
948300 -- [-2069.988] (-2092.019) (-2092.870) (-2084.047) * [-2070.010] (-2073.305) (-2084.079) (-2084.799) -- 0:00:14
948400 -- [-2069.892] (-2078.217) (-2077.705) (-2082.299) * [-2073.304] (-2071.386) (-2095.680) (-2094.973) -- 0:00:14
948500 -- [-2072.410] (-2089.505) (-2080.543) (-2078.097) * (-2076.679) (-2073.133) [-2076.152] (-2091.411) -- 0:00:14
948600 -- (-2076.308) (-2087.685) (-2074.018) [-2076.171] * [-2070.077] (-2070.351) (-2085.107) (-2082.839) -- 0:00:14
948700 -- (-2078.386) (-2080.370) [-2068.419] (-2075.255) * [-2067.392] (-2073.573) (-2093.934) (-2087.322) -- 0:00:14
948800 -- (-2076.635) (-2082.698) [-2073.949] (-2079.454) * [-2073.175] (-2080.033) (-2090.096) (-2080.542) -- 0:00:14
948900 -- (-2081.006) (-2081.099) [-2073.242] (-2081.889) * (-2070.089) (-2081.266) (-2091.341) [-2075.004] -- 0:00:14
949000 -- (-2078.388) (-2075.003) [-2070.395] (-2084.346) * (-2074.187) (-2068.259) (-2088.525) [-2071.437] -- 0:00:14
Average standard deviation of split frequencies: 0.003377
949100 -- (-2078.651) [-2076.527] (-2074.631) (-2082.923) * [-2073.206] (-2074.444) (-2079.909) (-2081.089) -- 0:00:14
949200 -- (-2093.719) [-2076.215] (-2069.880) (-2082.224) * (-2072.233) [-2077.029] (-2086.103) (-2084.147) -- 0:00:14
949300 -- (-2102.039) [-2078.011] (-2074.946) (-2088.448) * (-2071.911) [-2083.806] (-2090.477) (-2084.843) -- 0:00:14
949400 -- (-2097.196) (-2086.608) (-2070.939) [-2073.563] * [-2067.677] (-2070.021) (-2082.126) (-2075.850) -- 0:00:14
949500 -- (-2086.534) (-2089.243) (-2070.572) [-2078.232] * [-2069.855] (-2072.080) (-2083.718) (-2069.005) -- 0:00:14
949600 -- (-2080.528) (-2091.826) [-2074.107] (-2075.516) * (-2070.245) [-2069.306] (-2088.185) (-2083.032) -- 0:00:14
949700 -- [-2078.756] (-2097.656) (-2084.304) (-2080.221) * [-2065.955] (-2073.965) (-2085.835) (-2072.663) -- 0:00:14
949800 -- (-2088.353) (-2089.911) [-2076.963] (-2076.696) * [-2067.151] (-2078.429) (-2090.644) (-2076.763) -- 0:00:14
949900 -- (-2088.045) (-2090.532) [-2079.504] (-2075.046) * (-2078.838) (-2067.294) (-2088.337) [-2076.917] -- 0:00:14
950000 -- (-2081.129) (-2084.570) [-2070.745] (-2076.576) * [-2069.799] (-2069.073) (-2085.244) (-2072.703) -- 0:00:14
Average standard deviation of split frequencies: 0.003360
950100 -- (-2083.044) (-2094.412) (-2074.431) [-2073.422] * [-2075.921] (-2067.381) (-2080.417) (-2077.327) -- 0:00:14
950200 -- (-2097.973) (-2080.045) (-2071.473) [-2072.433] * (-2069.885) [-2071.770] (-2086.465) (-2075.772) -- 0:00:14
950300 -- (-2083.225) (-2076.100) (-2068.132) [-2075.312] * (-2075.431) [-2070.860] (-2087.169) (-2078.517) -- 0:00:14
950400 -- (-2078.262) (-2073.937) [-2072.896] (-2078.431) * [-2070.663] (-2076.478) (-2084.829) (-2084.909) -- 0:00:14
950500 -- (-2074.942) (-2085.014) [-2073.153] (-2076.740) * (-2076.825) [-2074.634] (-2085.201) (-2083.547) -- 0:00:14
950600 -- (-2077.074) (-2080.686) (-2072.258) [-2074.873] * (-2075.352) (-2072.680) [-2076.277] (-2079.182) -- 0:00:14
950700 -- (-2084.811) [-2075.142] (-2073.713) (-2083.868) * [-2076.193] (-2073.315) (-2077.236) (-2082.641) -- 0:00:14
950800 -- (-2087.344) (-2079.409) [-2072.924] (-2074.720) * (-2072.591) [-2077.175] (-2082.941) (-2085.936) -- 0:00:14
950900 -- (-2081.521) (-2075.088) [-2072.487] (-2076.189) * (-2074.055) [-2074.479] (-2091.230) (-2086.292) -- 0:00:14
951000 -- (-2070.498) (-2082.338) [-2074.063] (-2083.984) * (-2075.494) (-2073.849) (-2082.496) [-2090.202] -- 0:00:14
Average standard deviation of split frequencies: 0.003370
951100 -- (-2075.899) (-2091.112) [-2073.267] (-2083.980) * (-2070.783) [-2071.946] (-2089.783) (-2083.432) -- 0:00:14
951200 -- [-2074.508] (-2095.007) (-2074.749) (-2081.350) * (-2087.635) (-2071.825) [-2080.538] (-2082.887) -- 0:00:14
951300 -- [-2072.993] (-2079.960) (-2085.749) (-2085.505) * (-2085.493) (-2074.832) (-2103.299) [-2076.042] -- 0:00:14
951400 -- [-2071.281] (-2084.215) (-2076.927) (-2077.866) * [-2081.996] (-2071.729) (-2086.308) (-2076.569) -- 0:00:13
951500 -- (-2085.679) (-2081.040) (-2075.632) [-2076.161] * (-2075.216) (-2071.993) (-2086.614) [-2070.478] -- 0:00:13
951600 -- (-2079.253) [-2084.523] (-2076.537) (-2076.607) * [-2077.963] (-2068.235) (-2078.555) (-2074.589) -- 0:00:13
951700 -- (-2078.605) (-2081.684) [-2075.041] (-2089.593) * [-2071.176] (-2069.455) (-2080.095) (-2077.454) -- 0:00:13
951800 -- [-2072.139] (-2082.446) (-2072.952) (-2087.018) * (-2071.326) [-2075.898] (-2081.921) (-2082.817) -- 0:00:13
951900 -- (-2076.687) (-2081.235) [-2072.873] (-2087.695) * (-2074.267) (-2081.332) (-2079.723) [-2076.413] -- 0:00:13
952000 -- [-2070.357] (-2082.738) (-2072.668) (-2077.252) * [-2076.465] (-2079.998) (-2084.861) (-2076.549) -- 0:00:13
Average standard deviation of split frequencies: 0.003310
952100 -- [-2070.139] (-2075.579) (-2074.353) (-2079.366) * [-2073.517] (-2080.259) (-2082.430) (-2074.228) -- 0:00:13
952200 -- [-2068.597] (-2088.432) (-2071.225) (-2085.374) * (-2069.862) [-2073.994] (-2080.758) (-2077.651) -- 0:00:13
952300 -- (-2070.043) (-2077.984) [-2073.303] (-2091.761) * (-2086.862) [-2073.018] (-2083.304) (-2073.724) -- 0:00:13
952400 -- [-2073.989] (-2086.393) (-2072.489) (-2087.368) * (-2085.261) (-2072.232) (-2091.916) [-2075.010] -- 0:00:13
952500 -- [-2076.494] (-2083.585) (-2073.222) (-2085.326) * (-2084.329) [-2068.114] (-2100.164) (-2072.671) -- 0:00:13
952600 -- (-2076.007) (-2090.289) [-2075.677] (-2083.678) * (-2081.114) [-2068.321] (-2100.221) (-2073.980) -- 0:00:13
952700 -- [-2071.628] (-2079.564) (-2083.784) (-2081.115) * (-2078.204) (-2077.239) (-2091.062) [-2067.300] -- 0:00:13
952800 -- [-2073.476] (-2075.539) (-2072.580) (-2083.032) * (-2079.416) (-2071.286) (-2081.032) [-2069.443] -- 0:00:13
952900 -- [-2079.622] (-2075.287) (-2072.784) (-2078.313) * (-2079.754) (-2068.193) (-2088.596) [-2071.774] -- 0:00:13
953000 -- (-2085.618) (-2082.007) [-2074.940] (-2089.290) * (-2078.678) (-2070.581) (-2081.375) [-2073.078] -- 0:00:13
Average standard deviation of split frequencies: 0.003250
953100 -- [-2073.461] (-2078.519) (-2076.905) (-2077.322) * (-2086.360) (-2076.955) (-2080.678) [-2073.115] -- 0:00:13
953200 -- (-2077.792) (-2080.300) [-2071.989] (-2076.588) * (-2091.523) (-2081.578) (-2082.384) [-2079.002] -- 0:00:13
953300 -- [-2073.675] (-2076.195) (-2074.128) (-2090.254) * (-2080.601) (-2080.660) (-2081.068) [-2068.982] -- 0:00:13
953400 -- (-2073.018) (-2083.766) [-2076.454] (-2083.957) * (-2075.268) [-2078.032] (-2076.940) (-2075.601) -- 0:00:13
953500 -- [-2076.957] (-2085.121) (-2074.564) (-2077.175) * (-2079.487) (-2084.426) [-2080.099] (-2075.255) -- 0:00:13
953600 -- (-2086.086) (-2080.919) (-2076.237) [-2077.424] * (-2079.743) (-2071.439) (-2080.523) [-2069.794] -- 0:00:13
953700 -- [-2076.875] (-2084.126) (-2080.136) (-2075.802) * (-2080.168) (-2076.509) (-2081.856) [-2074.089] -- 0:00:13
953800 -- [-2072.566] (-2084.432) (-2080.296) (-2079.192) * (-2083.170) [-2067.147] (-2081.400) (-2072.439) -- 0:00:13
953900 -- [-2075.744] (-2077.901) (-2075.624) (-2074.871) * (-2083.777) (-2076.665) [-2078.712] (-2073.380) -- 0:00:13
954000 -- (-2072.886) (-2076.662) [-2072.797] (-2082.865) * (-2078.482) (-2080.247) (-2075.076) [-2072.125] -- 0:00:13
Average standard deviation of split frequencies: 0.003331
954100 -- [-2070.028] (-2075.614) (-2072.571) (-2075.472) * (-2079.223) (-2074.615) (-2088.803) [-2072.691] -- 0:00:13
954200 -- (-2081.751) [-2073.158] (-2074.705) (-2075.012) * (-2078.761) (-2081.922) (-2084.124) [-2072.860] -- 0:00:13
954300 -- (-2083.995) (-2082.813) [-2077.152] (-2076.950) * (-2089.938) [-2077.718] (-2089.612) (-2075.996) -- 0:00:13
954400 -- (-2077.011) (-2079.541) [-2077.209] (-2077.239) * (-2089.938) [-2075.929] (-2079.029) (-2073.297) -- 0:00:13
954500 -- [-2078.157] (-2086.948) (-2076.539) (-2075.625) * (-2086.906) [-2074.462] (-2078.612) (-2087.507) -- 0:00:13
954600 -- [-2073.714] (-2082.848) (-2080.088) (-2074.578) * (-2082.025) (-2074.814) [-2075.732] (-2081.014) -- 0:00:13
954700 -- (-2069.029) (-2087.783) [-2072.106] (-2075.160) * (-2082.605) (-2077.094) [-2078.007] (-2077.074) -- 0:00:13
954800 -- [-2068.150] (-2084.154) (-2074.421) (-2077.798) * (-2082.677) (-2074.014) (-2075.057) [-2085.396] -- 0:00:13
954900 -- [-2071.134] (-2086.331) (-2080.046) (-2082.353) * (-2079.389) (-2081.903) [-2078.400] (-2077.380) -- 0:00:12
955000 -- (-2078.208) (-2079.076) [-2068.187] (-2080.380) * (-2083.246) (-2076.991) [-2075.267] (-2076.618) -- 0:00:12
Average standard deviation of split frequencies: 0.003271
955100 -- (-2070.464) (-2079.476) [-2073.944] (-2076.478) * (-2074.369) [-2074.850] (-2077.069) (-2077.470) -- 0:00:12
955200 -- (-2076.552) (-2080.976) (-2079.316) [-2074.190] * (-2082.019) (-2081.551) (-2075.558) [-2076.287] -- 0:00:12
955300 -- (-2071.301) (-2078.518) [-2075.169] (-2075.335) * (-2075.974) (-2081.113) (-2082.700) [-2076.220] -- 0:00:12
955400 -- [-2075.851] (-2080.189) (-2072.651) (-2080.698) * (-2076.130) (-2073.202) (-2079.988) [-2073.132] -- 0:00:12
955500 -- (-2075.643) (-2082.149) [-2075.579] (-2077.196) * (-2082.139) (-2076.270) (-2082.789) [-2070.496] -- 0:00:12
955600 -- (-2081.079) [-2078.950] (-2090.871) (-2082.140) * [-2080.082] (-2085.634) (-2079.740) (-2077.462) -- 0:00:12
955700 -- [-2073.371] (-2079.781) (-2089.084) (-2076.240) * (-2074.655) (-2086.039) (-2076.019) [-2078.907] -- 0:00:12
955800 -- [-2068.169] (-2084.386) (-2069.871) (-2072.915) * (-2078.403) (-2078.261) (-2076.082) [-2070.682] -- 0:00:12
955900 -- (-2068.743) (-2079.935) [-2073.183] (-2082.682) * (-2074.002) (-2079.349) [-2075.529] (-2076.644) -- 0:00:12
956000 -- [-2072.334] (-2076.000) (-2086.160) (-2077.750) * (-2085.479) (-2079.733) [-2069.236] (-2076.492) -- 0:00:12
Average standard deviation of split frequencies: 0.003268
956100 -- [-2069.058] (-2080.189) (-2076.492) (-2082.367) * (-2073.556) (-2073.574) (-2075.015) [-2070.624] -- 0:00:12
956200 -- [-2067.484] (-2089.430) (-2074.653) (-2071.590) * (-2075.164) [-2075.513] (-2086.881) (-2075.891) -- 0:00:12
956300 -- (-2074.709) (-2092.741) [-2075.330] (-2079.390) * (-2076.445) (-2079.614) [-2082.667] (-2079.026) -- 0:00:12
956400 -- (-2071.631) (-2076.961) [-2076.293] (-2082.388) * (-2080.137) (-2073.746) [-2075.885] (-2077.366) -- 0:00:12
956500 -- (-2080.520) (-2085.273) (-2083.667) [-2076.936] * (-2078.221) (-2074.026) (-2080.806) [-2071.796] -- 0:00:12
956600 -- (-2079.522) [-2078.925] (-2081.684) (-2075.405) * (-2080.412) [-2073.444] (-2086.455) (-2078.700) -- 0:00:12
956700 -- [-2081.674] (-2075.173) (-2082.049) (-2082.620) * (-2080.827) [-2073.831] (-2081.949) (-2076.815) -- 0:00:12
956800 -- (-2072.750) (-2075.407) [-2073.734] (-2089.865) * [-2082.949] (-2078.012) (-2082.960) (-2082.383) -- 0:00:12
956900 -- [-2075.519] (-2084.500) (-2077.910) (-2085.895) * [-2080.457] (-2083.096) (-2080.449) (-2076.724) -- 0:00:12
957000 -- [-2073.997] (-2088.939) (-2073.580) (-2085.429) * (-2077.408) [-2072.146] (-2086.568) (-2074.784) -- 0:00:12
Average standard deviation of split frequencies: 0.003335
957100 -- [-2068.773] (-2075.773) (-2079.329) (-2086.970) * (-2077.643) (-2076.323) (-2090.193) [-2076.427] -- 0:00:12
957200 -- [-2068.891] (-2076.100) (-2074.427) (-2083.470) * (-2080.126) [-2070.319] (-2085.024) (-2074.153) -- 0:00:12
957300 -- [-2069.380] (-2076.315) (-2076.014) (-2086.707) * (-2086.493) [-2072.165] (-2080.016) (-2077.533) -- 0:00:12
957400 -- [-2069.308] (-2076.259) (-2081.444) (-2079.593) * [-2080.215] (-2068.672) (-2083.393) (-2077.498) -- 0:00:12
957500 -- (-2076.473) [-2079.028] (-2072.452) (-2083.873) * (-2076.774) [-2073.575] (-2079.474) (-2084.519) -- 0:00:12
957600 -- (-2083.579) (-2076.034) [-2083.662] (-2076.825) * (-2077.055) [-2071.077] (-2078.691) (-2087.400) -- 0:00:12
957700 -- (-2075.489) [-2072.704] (-2090.188) (-2082.270) * (-2080.167) (-2074.893) [-2079.370] (-2073.096) -- 0:00:12
957800 -- (-2082.305) (-2077.162) [-2075.584] (-2082.955) * (-2076.666) [-2075.493] (-2088.052) (-2070.948) -- 0:00:12
957900 -- (-2086.082) [-2076.398] (-2079.958) (-2073.383) * (-2075.396) (-2077.037) (-2078.406) [-2070.070] -- 0:00:12
958000 -- (-2084.959) (-2086.821) [-2076.869] (-2082.567) * (-2080.040) (-2077.126) (-2083.528) [-2069.769] -- 0:00:12
Average standard deviation of split frequencies: 0.003346
958100 -- (-2080.641) (-2078.558) [-2074.035] (-2081.032) * (-2077.861) (-2078.516) (-2079.510) [-2072.988] -- 0:00:12
958200 -- (-2083.692) (-2081.249) [-2072.324] (-2081.576) * [-2078.008] (-2080.068) (-2081.571) (-2073.150) -- 0:00:12
958300 -- (-2082.251) (-2083.502) [-2069.890] (-2082.788) * (-2079.490) (-2075.745) (-2077.706) [-2068.944] -- 0:00:12
958400 -- (-2081.775) [-2080.878] (-2073.717) (-2091.335) * (-2077.629) (-2073.501) (-2076.242) [-2070.877] -- 0:00:11
958500 -- (-2083.821) [-2076.579] (-2072.596) (-2085.528) * (-2081.840) [-2079.556] (-2080.206) (-2069.376) -- 0:00:11
958600 -- [-2080.306] (-2080.902) (-2072.950) (-2086.656) * (-2076.701) (-2079.299) (-2077.030) [-2072.779] -- 0:00:11
958700 -- (-2094.591) (-2077.466) [-2072.088] (-2082.222) * (-2075.664) (-2082.306) [-2075.113] (-2073.814) -- 0:00:11
958800 -- (-2087.009) [-2078.597] (-2084.776) (-2091.769) * (-2086.914) (-2080.838) (-2075.425) [-2069.426] -- 0:00:11
958900 -- (-2083.917) (-2078.521) [-2071.597] (-2084.908) * (-2085.834) [-2077.203] (-2082.897) (-2075.421) -- 0:00:11
959000 -- (-2074.844) (-2076.646) [-2079.202] (-2087.455) * (-2088.632) (-2076.649) (-2088.179) [-2072.825] -- 0:00:11
Average standard deviation of split frequencies: 0.003300
959100 -- (-2076.788) (-2081.671) [-2079.838] (-2089.043) * (-2091.306) (-2075.737) (-2081.544) [-2074.596] -- 0:00:11
959200 -- [-2075.767] (-2081.787) (-2075.643) (-2092.635) * (-2091.146) (-2088.459) [-2075.413] (-2072.529) -- 0:00:11
959300 -- (-2071.160) (-2090.672) [-2072.682] (-2090.864) * (-2092.128) (-2079.786) (-2078.986) [-2067.674] -- 0:00:11
959400 -- [-2071.080] (-2081.063) (-2074.091) (-2095.499) * (-2080.408) (-2077.643) (-2078.942) [-2069.408] -- 0:00:11
959500 -- (-2077.968) (-2084.677) [-2073.875] (-2092.131) * (-2085.007) (-2078.024) [-2079.081] (-2068.579) -- 0:00:11
959600 -- (-2081.498) (-2084.437) [-2073.932] (-2094.148) * (-2085.487) (-2086.414) (-2073.285) [-2067.894] -- 0:00:11
959700 -- (-2073.795) (-2084.332) [-2070.039] (-2096.677) * (-2079.694) (-2084.616) (-2089.118) [-2067.760] -- 0:00:11
959800 -- (-2075.992) (-2087.613) [-2072.048] (-2089.062) * (-2072.679) [-2083.156] (-2083.346) (-2070.494) -- 0:00:11
959900 -- (-2074.720) (-2085.657) [-2072.160] (-2084.105) * (-2080.322) (-2081.966) (-2086.716) [-2070.868] -- 0:00:11
960000 -- (-2075.580) (-2093.142) [-2071.015] (-2084.772) * (-2085.011) (-2077.128) (-2102.292) [-2071.569] -- 0:00:11
Average standard deviation of split frequencies: 0.003311
960100 -- [-2070.559] (-2094.143) (-2075.245) (-2078.067) * (-2079.238) (-2075.689) (-2086.945) [-2071.242] -- 0:00:11
960200 -- (-2081.808) (-2089.381) (-2071.526) [-2076.828] * (-2086.754) (-2076.334) (-2091.509) [-2071.218] -- 0:00:11
960300 -- (-2086.578) [-2081.906] (-2070.952) (-2075.013) * (-2073.741) (-2081.678) (-2082.234) [-2070.323] -- 0:00:11
960400 -- (-2078.390) (-2081.350) [-2069.466] (-2083.060) * [-2075.302] (-2080.449) (-2077.965) (-2070.766) -- 0:00:11
960500 -- [-2070.191] (-2079.816) (-2068.865) (-2091.969) * (-2074.079) (-2077.776) (-2091.280) [-2066.607] -- 0:00:11
960600 -- (-2081.807) (-2077.419) [-2071.180] (-2078.381) * (-2081.613) (-2077.716) (-2092.955) [-2068.002] -- 0:00:11
960700 -- [-2070.453] (-2080.774) (-2075.860) (-2084.302) * (-2078.362) [-2077.546] (-2081.357) (-2070.801) -- 0:00:11
960800 -- [-2067.720] (-2081.016) (-2080.432) (-2082.320) * (-2084.504) [-2071.648] (-2078.321) (-2074.045) -- 0:00:11
960900 -- (-2071.982) (-2074.398) [-2074.841] (-2085.045) * (-2077.067) (-2071.931) (-2089.332) [-2071.231] -- 0:00:11
961000 -- [-2073.321] (-2082.888) (-2075.893) (-2089.509) * (-2081.550) (-2074.398) [-2073.085] (-2076.862) -- 0:00:11
Average standard deviation of split frequencies: 0.003251
961100 -- (-2073.224) (-2087.097) (-2081.873) [-2080.735] * (-2082.187) (-2071.975) (-2078.455) [-2070.092] -- 0:00:11
961200 -- [-2071.432] (-2094.099) (-2081.976) (-2080.320) * (-2079.749) [-2070.408] (-2077.891) (-2077.011) -- 0:00:11
961300 -- (-2073.313) (-2091.702) (-2092.154) [-2076.003] * [-2077.889] (-2068.350) (-2079.497) (-2074.097) -- 0:00:11
961400 -- (-2077.843) (-2086.275) (-2092.644) [-2078.004] * (-2079.309) [-2074.420] (-2083.743) (-2079.009) -- 0:00:11
961500 -- (-2084.687) (-2080.735) [-2081.971] (-2079.711) * [-2077.986] (-2071.191) (-2083.247) (-2072.435) -- 0:00:11
961600 -- [-2075.978] (-2086.930) (-2080.572) (-2080.617) * (-2083.405) (-2077.918) (-2076.821) [-2071.511] -- 0:00:11
961700 -- (-2079.541) [-2075.345] (-2081.749) (-2086.544) * [-2074.184] (-2077.824) (-2081.007) (-2068.161) -- 0:00:11
961800 -- (-2084.686) (-2068.904) (-2077.534) [-2075.244] * (-2081.808) (-2079.040) (-2088.837) [-2069.908] -- 0:00:11
961900 -- (-2087.817) [-2070.044] (-2077.164) (-2080.641) * (-2085.479) (-2081.605) (-2091.624) [-2069.498] -- 0:00:10
962000 -- (-2077.288) [-2071.163] (-2072.844) (-2086.138) * (-2081.105) (-2078.042) [-2076.032] (-2079.450) -- 0:00:10
Average standard deviation of split frequencies: 0.003220
962100 -- [-2076.161] (-2073.269) (-2080.461) (-2079.267) * (-2084.216) (-2077.757) [-2085.043] (-2085.031) -- 0:00:10
962200 -- (-2084.194) (-2070.109) [-2078.221] (-2081.693) * (-2077.413) (-2082.383) (-2079.104) [-2080.091] -- 0:00:10
962300 -- (-2080.412) [-2068.785] (-2078.344) (-2078.150) * (-2080.225) [-2074.127] (-2080.246) (-2077.268) -- 0:00:10
962400 -- [-2071.300] (-2077.457) (-2074.479) (-2074.456) * (-2079.793) (-2080.091) [-2079.624] (-2076.467) -- 0:00:10
962500 -- [-2074.029] (-2074.992) (-2074.612) (-2080.214) * (-2080.996) (-2080.813) [-2080.396] (-2076.608) -- 0:00:10
962600 -- [-2070.879] (-2075.826) (-2074.709) (-2089.723) * [-2076.217] (-2080.256) (-2089.430) (-2076.063) -- 0:00:10
962700 -- [-2069.389] (-2076.337) (-2078.416) (-2081.520) * (-2075.724) [-2081.106] (-2082.382) (-2078.713) -- 0:00:10
962800 -- (-2068.444) [-2071.353] (-2078.735) (-2085.235) * (-2083.838) (-2079.038) (-2080.029) [-2072.217] -- 0:00:10
962900 -- (-2071.978) [-2070.713] (-2082.211) (-2081.545) * (-2090.301) (-2076.187) [-2077.242] (-2078.212) -- 0:00:10
963000 -- (-2075.454) [-2065.856] (-2078.452) (-2074.408) * (-2083.526) (-2072.418) (-2078.127) [-2070.485] -- 0:00:10
Average standard deviation of split frequencies: 0.003160
963100 -- [-2075.371] (-2068.182) (-2089.079) (-2077.233) * (-2076.020) (-2075.556) [-2074.796] (-2076.845) -- 0:00:10
963200 -- (-2079.334) [-2074.732] (-2084.271) (-2076.319) * (-2077.756) (-2073.830) [-2075.658] (-2074.936) -- 0:00:10
963300 -- (-2073.398) [-2076.314] (-2083.214) (-2082.038) * [-2075.381] (-2072.831) (-2075.340) (-2071.957) -- 0:00:10
963400 -- (-2068.434) (-2080.750) [-2078.147] (-2080.588) * [-2074.642] (-2084.968) (-2075.290) (-2070.311) -- 0:00:10
963500 -- [-2076.595] (-2068.781) (-2074.973) (-2078.430) * (-2076.646) (-2077.158) (-2073.144) [-2073.047] -- 0:00:10
963600 -- (-2082.200) [-2076.234] (-2075.315) (-2077.203) * [-2077.714] (-2074.881) (-2081.903) (-2074.916) -- 0:00:10
963700 -- (-2076.369) (-2072.433) [-2072.571] (-2083.782) * (-2071.038) [-2070.788] (-2091.991) (-2073.765) -- 0:00:10
963800 -- (-2086.910) (-2068.007) [-2067.978] (-2082.118) * (-2081.860) [-2073.299] (-2092.424) (-2078.686) -- 0:00:10
963900 -- (-2089.516) (-2072.035) [-2070.372] (-2084.645) * (-2076.313) [-2072.335] (-2094.282) (-2077.833) -- 0:00:10
964000 -- (-2080.780) (-2075.561) (-2085.633) [-2074.936] * (-2071.473) [-2071.935] (-2081.030) (-2075.751) -- 0:00:10
Average standard deviation of split frequencies: 0.003157
964100 -- (-2074.853) [-2074.529] (-2079.218) (-2073.839) * [-2069.372] (-2077.217) (-2083.240) (-2079.576) -- 0:00:10
964200 -- (-2075.288) (-2071.973) [-2071.057] (-2072.548) * [-2070.295] (-2081.970) (-2078.415) (-2076.070) -- 0:00:10
964300 -- (-2081.425) [-2080.323] (-2077.067) (-2073.407) * (-2072.474) (-2078.112) (-2087.687) [-2075.804] -- 0:00:10
964400 -- (-2080.622) [-2074.476] (-2087.347) (-2073.934) * (-2075.865) (-2071.978) (-2084.913) [-2075.369] -- 0:00:10
964500 -- (-2079.326) (-2077.302) [-2076.174] (-2074.467) * [-2070.948] (-2085.483) (-2082.276) (-2073.307) -- 0:00:10
964600 -- (-2083.541) (-2072.785) (-2080.825) [-2071.352] * [-2076.152] (-2088.646) (-2082.310) (-2071.415) -- 0:00:10
964700 -- (-2081.415) [-2069.085] (-2079.078) (-2074.892) * (-2074.160) (-2077.290) (-2085.186) [-2073.025] -- 0:00:10
964800 -- [-2071.832] (-2070.276) (-2088.100) (-2081.235) * (-2076.652) (-2080.029) (-2078.386) [-2069.698] -- 0:00:10
964900 -- (-2078.956) [-2071.032] (-2095.420) (-2073.925) * [-2074.945] (-2079.279) (-2074.398) (-2076.944) -- 0:00:10
965000 -- (-2079.187) [-2078.867] (-2088.492) (-2075.312) * (-2077.919) (-2087.307) (-2081.328) [-2073.225] -- 0:00:10
Average standard deviation of split frequencies: 0.003154
965100 -- (-2078.997) [-2073.097] (-2080.981) (-2073.583) * (-2077.691) (-2074.418) (-2077.096) [-2072.028] -- 0:00:10
965200 -- (-2081.592) [-2077.069] (-2085.477) (-2079.577) * (-2079.281) [-2074.070] (-2076.066) (-2076.854) -- 0:00:10
965300 -- [-2072.311] (-2082.192) (-2080.256) (-2080.654) * (-2075.454) (-2074.323) (-2075.491) [-2078.512] -- 0:00:09
965400 -- (-2080.587) (-2079.936) (-2084.075) [-2069.337] * [-2082.053] (-2080.432) (-2083.675) (-2078.186) -- 0:00:09
965500 -- (-2079.603) (-2071.893) (-2079.074) [-2070.052] * [-2076.053] (-2079.590) (-2082.376) (-2074.512) -- 0:00:09
965600 -- [-2071.974] (-2071.070) (-2078.182) (-2079.722) * (-2081.224) (-2085.388) (-2080.532) [-2073.498] -- 0:00:09
965700 -- (-2075.207) [-2073.736] (-2079.679) (-2073.229) * (-2071.715) (-2085.627) [-2074.362] (-2075.062) -- 0:00:09
965800 -- (-2076.244) [-2070.194] (-2079.181) (-2070.175) * [-2070.026] (-2084.325) (-2073.833) (-2074.839) -- 0:00:09
965900 -- [-2074.658] (-2070.747) (-2085.124) (-2074.364) * [-2075.124] (-2091.049) (-2077.760) (-2077.583) -- 0:00:09
966000 -- (-2072.334) (-2075.284) (-2084.831) [-2076.713] * (-2082.104) (-2085.291) [-2071.770] (-2085.893) -- 0:00:09
Average standard deviation of split frequencies: 0.002955
966100 -- [-2076.164] (-2080.837) (-2075.271) (-2090.565) * (-2079.088) (-2091.532) (-2079.515) [-2075.736] -- 0:00:09
966200 -- [-2075.114] (-2070.164) (-2074.209) (-2088.332) * (-2078.000) [-2078.510] (-2081.107) (-2077.252) -- 0:00:09
966300 -- (-2076.004) [-2067.834] (-2077.763) (-2082.172) * [-2077.808] (-2087.442) (-2072.300) (-2082.648) -- 0:00:09
966400 -- [-2068.901] (-2073.361) (-2086.364) (-2077.260) * (-2071.975) (-2086.139) [-2077.139] (-2082.126) -- 0:00:09
966500 -- (-2074.231) (-2071.012) (-2074.999) [-2081.820] * (-2073.431) (-2085.342) [-2075.359] (-2082.658) -- 0:00:09
966600 -- (-2081.398) [-2070.630] (-2075.277) (-2083.060) * (-2076.851) (-2077.114) (-2077.927) [-2077.137] -- 0:00:09
966700 -- (-2083.205) (-2071.460) [-2073.535] (-2072.938) * (-2082.376) [-2077.280] (-2083.411) (-2075.659) -- 0:00:09
966800 -- (-2075.447) (-2078.409) [-2078.421] (-2078.831) * [-2077.158] (-2080.696) (-2092.115) (-2080.182) -- 0:00:09
966900 -- (-2078.195) (-2086.018) [-2072.353] (-2073.208) * [-2078.384] (-2078.808) (-2075.214) (-2076.176) -- 0:00:09
967000 -- (-2074.065) (-2078.959) (-2082.670) [-2068.678] * (-2074.684) (-2083.410) [-2075.875] (-2083.026) -- 0:00:09
Average standard deviation of split frequencies: 0.002729
967100 -- (-2071.968) (-2073.208) (-2081.864) [-2070.096] * [-2074.999] (-2078.043) (-2080.336) (-2073.516) -- 0:00:09
967200 -- [-2073.511] (-2080.691) (-2079.796) (-2076.754) * (-2070.928) (-2087.449) (-2077.924) [-2075.704] -- 0:00:09
967300 -- (-2075.894) (-2073.900) [-2073.578] (-2069.431) * [-2071.845] (-2084.686) (-2084.633) (-2076.036) -- 0:00:09
967400 -- (-2078.689) (-2072.836) (-2075.437) [-2070.890] * (-2077.306) (-2077.206) [-2077.636] (-2081.270) -- 0:00:09
967500 -- (-2078.833) (-2074.600) [-2072.255] (-2067.024) * (-2076.841) [-2077.596] (-2080.455) (-2076.450) -- 0:00:09
967600 -- [-2077.584] (-2075.717) (-2083.063) (-2076.569) * (-2084.383) (-2075.798) (-2076.113) [-2071.402] -- 0:00:09
967700 -- (-2087.044) [-2077.670] (-2078.886) (-2071.490) * (-2082.500) (-2078.171) (-2076.126) [-2071.601] -- 0:00:09
967800 -- (-2086.195) [-2071.950] (-2076.720) (-2078.657) * (-2088.698) (-2077.900) (-2080.125) [-2070.096] -- 0:00:09
967900 -- (-2078.051) (-2072.878) [-2075.234] (-2077.749) * (-2077.433) [-2077.213] (-2086.367) (-2070.744) -- 0:00:09
968000 -- (-2078.413) [-2078.056] (-2079.228) (-2076.054) * (-2080.964) (-2074.994) (-2090.942) [-2072.016] -- 0:00:09
Average standard deviation of split frequencies: 0.002796
968100 -- (-2076.249) (-2073.543) (-2078.174) [-2068.163] * (-2074.699) (-2084.348) (-2086.529) [-2071.497] -- 0:00:09
968200 -- (-2090.798) (-2076.362) (-2079.727) [-2071.278] * (-2075.179) (-2077.176) (-2088.403) [-2066.763] -- 0:00:09
968300 -- (-2088.115) (-2077.314) (-2081.740) [-2068.243] * (-2083.935) (-2084.629) (-2078.914) [-2075.349] -- 0:00:09
968400 -- (-2082.486) (-2086.386) (-2084.840) [-2064.682] * [-2077.549] (-2088.602) (-2081.684) (-2076.657) -- 0:00:09
968500 -- (-2082.448) (-2075.060) (-2076.239) [-2068.242] * (-2073.548) (-2078.655) (-2081.042) [-2072.995] -- 0:00:09
968600 -- (-2074.779) [-2070.859] (-2074.278) (-2074.953) * (-2071.376) [-2077.719] (-2091.775) (-2068.366) -- 0:00:09
968700 -- (-2077.977) [-2071.373] (-2079.329) (-2078.686) * (-2074.400) (-2082.053) (-2085.316) [-2073.067] -- 0:00:09
968800 -- [-2072.541] (-2086.191) (-2069.219) (-2080.351) * [-2075.296] (-2079.117) (-2081.451) (-2070.454) -- 0:00:08
968900 -- (-2081.617) (-2087.501) (-2069.297) [-2074.688] * (-2077.904) (-2079.086) (-2084.745) [-2073.516] -- 0:00:08
969000 -- (-2083.078) (-2080.243) [-2069.305] (-2087.616) * (-2087.534) (-2081.115) (-2092.790) [-2073.086] -- 0:00:08
Average standard deviation of split frequencies: 0.002891
969100 -- (-2080.939) (-2075.734) [-2070.646] (-2094.785) * (-2081.974) (-2081.192) (-2093.263) [-2073.506] -- 0:00:08
969200 -- (-2077.002) (-2073.362) [-2079.344] (-2089.766) * [-2084.124] (-2078.442) (-2076.426) (-2076.201) -- 0:00:08
969300 -- [-2070.302] (-2072.079) (-2076.584) (-2082.685) * (-2085.228) (-2074.007) (-2075.423) [-2069.437] -- 0:00:08
969400 -- (-2072.468) [-2072.277] (-2077.606) (-2087.735) * (-2084.063) (-2085.232) (-2077.692) [-2069.614] -- 0:00:08
969500 -- (-2073.856) [-2068.605] (-2077.859) (-2082.522) * (-2080.965) [-2076.164] (-2090.002) (-2076.651) -- 0:00:08
969600 -- [-2074.810] (-2073.280) (-2078.272) (-2083.715) * (-2080.054) [-2077.609] (-2084.881) (-2076.075) -- 0:00:08
969700 -- (-2071.369) [-2074.596] (-2079.642) (-2079.028) * (-2088.472) (-2080.632) (-2080.584) [-2070.587] -- 0:00:08
969800 -- [-2070.968] (-2073.294) (-2076.241) (-2081.688) * (-2088.872) [-2079.475] (-2078.452) (-2069.070) -- 0:00:08
969900 -- (-2074.863) [-2075.037] (-2082.499) (-2074.919) * [-2082.722] (-2078.774) (-2075.587) (-2073.377) -- 0:00:08
970000 -- (-2089.699) (-2072.857) (-2081.297) [-2070.113] * [-2078.903] (-2085.866) (-2077.467) (-2080.421) -- 0:00:08
Average standard deviation of split frequencies: 0.002860
970100 -- (-2096.491) (-2077.509) (-2080.020) [-2068.206] * (-2088.393) (-2079.686) (-2072.955) [-2080.150] -- 0:00:08
970200 -- (-2088.273) (-2075.976) (-2075.634) [-2069.631] * (-2078.660) (-2076.658) [-2074.383] (-2086.277) -- 0:00:08
970300 -- (-2083.265) (-2070.957) (-2080.528) [-2071.624] * (-2079.389) (-2080.100) (-2078.540) [-2074.880] -- 0:00:08
970400 -- (-2080.720) [-2069.582] (-2079.446) (-2071.394) * (-2100.511) (-2093.514) (-2077.522) [-2073.749] -- 0:00:08
970500 -- (-2080.440) (-2070.691) (-2081.124) [-2067.242] * (-2082.392) (-2083.618) (-2079.086) [-2070.188] -- 0:00:08
970600 -- (-2074.517) [-2069.938] (-2084.108) (-2072.400) * (-2082.464) (-2084.766) (-2075.780) [-2071.189] -- 0:00:08
970700 -- (-2084.143) (-2072.092) (-2080.931) [-2072.965] * [-2074.086] (-2081.893) (-2073.457) (-2070.866) -- 0:00:08
970800 -- (-2084.486) [-2070.738] (-2078.602) (-2074.735) * (-2077.725) (-2082.432) (-2079.207) [-2075.348] -- 0:00:08
970900 -- [-2078.663] (-2070.687) (-2086.562) (-2068.779) * (-2080.964) [-2071.873] (-2075.520) (-2076.348) -- 0:00:08
971000 -- (-2086.941) [-2074.477] (-2076.722) (-2072.083) * (-2080.664) (-2078.894) (-2074.964) [-2075.875] -- 0:00:08
Average standard deviation of split frequencies: 0.002815
971100 -- [-2076.292] (-2078.791) (-2078.246) (-2071.884) * (-2082.487) [-2075.496] (-2074.291) (-2082.897) -- 0:00:08
971200 -- (-2070.508) [-2072.342] (-2076.897) (-2073.249) * (-2086.044) (-2072.533) (-2080.414) [-2077.524] -- 0:00:08
971300 -- (-2080.210) (-2073.735) (-2079.258) [-2071.857] * (-2084.100) [-2072.336] (-2083.839) (-2082.366) -- 0:00:08
971400 -- (-2079.256) (-2081.755) [-2082.952] (-2075.948) * (-2078.479) [-2070.600] (-2085.837) (-2072.179) -- 0:00:08
971500 -- (-2079.952) [-2079.807] (-2077.229) (-2082.834) * (-2080.519) [-2069.193] (-2083.171) (-2084.913) -- 0:00:08
971600 -- (-2077.261) (-2080.268) [-2072.875] (-2076.132) * (-2077.815) (-2080.573) (-2080.033) [-2069.502] -- 0:00:08
971700 -- (-2079.261) (-2077.995) [-2072.763] (-2077.859) * (-2084.109) [-2074.410] (-2087.248) (-2075.278) -- 0:00:08
971800 -- (-2084.299) (-2088.797) (-2071.551) [-2070.337] * (-2085.607) [-2077.319] (-2082.709) (-2075.791) -- 0:00:08
971900 -- (-2088.235) [-2081.502] (-2077.590) (-2072.058) * (-2083.380) (-2073.995) (-2077.767) [-2073.705] -- 0:00:08
972000 -- (-2076.028) (-2079.457) (-2072.763) [-2070.862] * (-2087.671) (-2070.479) (-2082.727) [-2072.211] -- 0:00:08
Average standard deviation of split frequencies: 0.002743
972100 -- (-2075.381) (-2074.564) (-2075.343) [-2073.635] * [-2080.059] (-2067.004) (-2076.401) (-2073.806) -- 0:00:08
972200 -- (-2069.834) (-2075.015) [-2073.316] (-2074.373) * (-2075.025) (-2068.573) (-2076.991) [-2071.971] -- 0:00:08
972300 -- [-2072.081] (-2077.595) (-2078.959) (-2075.590) * (-2078.981) [-2071.673] (-2093.190) (-2077.109) -- 0:00:07
972400 -- (-2078.150) (-2082.027) (-2082.257) [-2072.318] * (-2080.205) (-2074.913) (-2086.764) [-2072.967] -- 0:00:07
972500 -- (-2077.185) [-2072.216] (-2087.563) (-2069.017) * (-2084.201) [-2069.780] (-2105.676) (-2072.638) -- 0:00:07
972600 -- (-2079.491) [-2071.705] (-2075.578) (-2072.330) * [-2079.851] (-2071.530) (-2084.984) (-2077.951) -- 0:00:07
972700 -- (-2072.881) [-2067.667] (-2068.054) (-2072.136) * (-2082.371) [-2066.531] (-2082.505) (-2072.297) -- 0:00:07
972800 -- (-2068.525) (-2080.605) [-2073.961] (-2074.569) * (-2082.800) [-2070.674] (-2080.737) (-2076.541) -- 0:00:07
972900 -- (-2080.958) (-2073.113) (-2067.027) [-2070.833] * (-2078.539) [-2075.790] (-2093.508) (-2082.451) -- 0:00:07
973000 -- (-2071.902) (-2076.541) [-2067.046] (-2076.590) * (-2084.940) (-2077.384) (-2088.130) [-2076.601] -- 0:00:07
Average standard deviation of split frequencies: 0.002879
973100 -- (-2074.168) (-2077.858) (-2074.543) [-2077.084] * (-2080.378) (-2075.299) (-2089.823) [-2069.290] -- 0:00:07
973200 -- (-2073.496) (-2076.676) [-2079.109] (-2084.433) * (-2078.130) (-2078.133) (-2086.315) [-2069.017] -- 0:00:07
973300 -- (-2083.928) [-2073.477] (-2071.317) (-2081.049) * (-2093.213) (-2070.523) (-2081.727) [-2066.222] -- 0:00:07
973400 -- [-2067.765] (-2080.347) (-2074.018) (-2077.447) * (-2083.063) (-2073.049) (-2083.205) [-2070.860] -- 0:00:07
973500 -- [-2074.437] (-2080.974) (-2082.240) (-2082.010) * (-2082.601) [-2070.840] (-2075.037) (-2073.290) -- 0:00:07
973600 -- (-2080.596) [-2074.510] (-2079.212) (-2080.644) * (-2084.402) (-2074.766) (-2084.016) [-2070.689] -- 0:00:07
973700 -- [-2068.455] (-2075.583) (-2077.468) (-2076.140) * (-2088.709) (-2083.805) (-2076.437) [-2072.475] -- 0:00:07
973800 -- (-2073.949) (-2071.419) (-2082.205) [-2078.869] * (-2092.272) (-2076.551) (-2078.603) [-2070.603] -- 0:00:07
973900 -- (-2077.103) [-2072.484] (-2071.504) (-2082.942) * (-2081.814) (-2087.489) [-2075.705] (-2074.097) -- 0:00:07
974000 -- (-2073.839) (-2079.550) [-2074.998] (-2078.902) * (-2091.092) (-2094.598) (-2080.309) [-2076.868] -- 0:00:07
Average standard deviation of split frequencies: 0.002904
974100 -- [-2074.480] (-2075.017) (-2077.711) (-2081.010) * (-2095.323) (-2085.094) (-2072.868) [-2074.972] -- 0:00:07
974200 -- (-2085.745) [-2075.967] (-2070.108) (-2069.529) * (-2073.393) (-2076.247) (-2077.254) [-2075.353] -- 0:00:07
974300 -- (-2077.572) (-2082.480) (-2069.639) [-2074.955] * (-2077.538) (-2070.930) [-2075.648] (-2077.469) -- 0:00:07
974400 -- (-2072.664) (-2087.070) (-2074.486) [-2075.866] * (-2079.969) (-2076.142) (-2078.190) [-2072.811] -- 0:00:07
974500 -- (-2083.505) [-2078.331] (-2079.050) (-2072.541) * (-2079.707) (-2078.445) (-2081.137) [-2068.529] -- 0:00:07
974600 -- (-2076.457) (-2078.872) (-2090.445) [-2068.234] * (-2075.817) [-2075.158] (-2089.434) (-2072.501) -- 0:00:07
974700 -- (-2083.910) (-2077.581) (-2089.168) [-2071.581] * (-2077.892) (-2079.063) (-2082.061) [-2071.118] -- 0:00:07
974800 -- (-2080.190) (-2076.576) (-2079.249) [-2067.930] * (-2080.917) (-2081.114) (-2084.195) [-2071.816] -- 0:00:07
974900 -- (-2077.445) (-2071.609) (-2081.451) [-2070.224] * [-2076.312] (-2080.524) (-2083.503) (-2082.520) -- 0:00:07
975000 -- (-2076.591) [-2073.036] (-2081.611) (-2075.569) * (-2075.885) (-2074.585) [-2084.388] (-2079.419) -- 0:00:07
Average standard deviation of split frequencies: 0.003025
975100 -- (-2073.050) [-2075.921] (-2081.388) (-2075.188) * [-2073.663] (-2074.960) (-2087.037) (-2083.903) -- 0:00:07
975200 -- (-2076.050) (-2075.108) (-2077.218) [-2073.357] * (-2073.252) (-2075.046) (-2091.545) [-2079.394] -- 0:00:07
975300 -- [-2072.619] (-2077.364) (-2081.622) (-2088.865) * [-2073.717] (-2075.944) (-2082.858) (-2082.508) -- 0:00:07
975400 -- (-2075.132) (-2081.127) (-2073.503) [-2073.352] * (-2076.783) (-2078.608) (-2075.137) [-2076.852] -- 0:00:07
975500 -- (-2080.402) (-2092.221) (-2075.257) [-2067.904] * (-2072.181) (-2073.711) (-2081.104) [-2073.441] -- 0:00:07
975600 -- (-2072.038) (-2090.108) (-2076.243) [-2069.409] * [-2071.734] (-2077.998) (-2084.147) (-2076.345) -- 0:00:07
975700 -- [-2072.408] (-2085.193) (-2073.705) (-2071.431) * [-2068.470] (-2093.413) (-2082.706) (-2071.792) -- 0:00:06
975800 -- (-2074.832) (-2078.766) (-2075.838) [-2069.224] * [-2071.542] (-2085.428) (-2087.708) (-2075.711) -- 0:00:06
975900 -- (-2072.643) (-2077.829) (-2073.544) [-2076.596] * [-2068.826] (-2092.061) (-2087.711) (-2073.136) -- 0:00:06
976000 -- (-2073.883) (-2074.415) (-2077.155) [-2075.740] * [-2068.131] (-2082.445) (-2086.827) (-2074.132) -- 0:00:06
Average standard deviation of split frequencies: 0.003077
976100 -- (-2074.766) (-2073.018) (-2085.527) [-2070.267] * [-2071.128] (-2078.946) (-2082.075) (-2076.400) -- 0:00:06
976200 -- [-2075.632] (-2070.771) (-2098.760) (-2076.566) * (-2068.868) [-2079.426] (-2077.806) (-2082.220) -- 0:00:06
976300 -- (-2080.916) (-2070.248) (-2082.326) [-2073.939] * [-2071.566] (-2073.767) (-2089.442) (-2076.481) -- 0:00:06
976400 -- (-2083.326) (-2075.529) (-2083.279) [-2071.206] * [-2075.164] (-2077.228) (-2078.339) (-2081.770) -- 0:00:06
976500 -- (-2083.799) (-2074.502) (-2081.750) [-2073.623] * [-2070.990] (-2077.281) (-2082.073) (-2079.322) -- 0:00:06
976600 -- (-2076.690) [-2070.810] (-2082.614) (-2086.197) * [-2078.189] (-2081.451) (-2087.249) (-2084.888) -- 0:00:06
976700 -- [-2073.283] (-2076.328) (-2078.239) (-2086.930) * (-2074.776) (-2082.280) [-2079.827] (-2078.840) -- 0:00:06
976800 -- (-2080.210) (-2071.490) [-2078.193] (-2098.379) * (-2073.860) (-2083.813) [-2079.125] (-2077.537) -- 0:00:06
976900 -- (-2081.840) [-2073.154] (-2068.635) (-2084.313) * [-2073.540] (-2082.240) (-2085.157) (-2070.872) -- 0:00:06
977000 -- (-2079.141) (-2080.309) [-2073.064] (-2081.732) * (-2076.639) [-2078.808] (-2085.263) (-2068.771) -- 0:00:06
Average standard deviation of split frequencies: 0.003239
977100 -- (-2080.056) (-2089.335) [-2070.638] (-2077.559) * (-2073.510) (-2083.836) [-2074.925] (-2082.401) -- 0:00:06
977200 -- [-2074.354] (-2079.960) (-2076.545) (-2080.682) * [-2076.054] (-2088.972) (-2079.509) (-2075.881) -- 0:00:06
977300 -- (-2073.577) (-2088.787) [-2077.420] (-2092.447) * (-2080.115) (-2081.164) (-2082.846) [-2076.242] -- 0:00:06
977400 -- (-2075.853) [-2078.394] (-2081.606) (-2085.446) * (-2078.201) (-2085.902) (-2079.189) [-2080.529] -- 0:00:06
977500 -- [-2068.918] (-2079.876) (-2074.481) (-2086.634) * [-2074.661] (-2079.441) (-2076.290) (-2077.407) -- 0:00:06
977600 -- (-2074.822) [-2071.642] (-2080.150) (-2084.236) * (-2071.054) (-2083.075) (-2081.919) [-2072.242] -- 0:00:06
977700 -- (-2071.457) [-2071.598] (-2074.743) (-2077.466) * [-2073.158] (-2084.978) (-2075.814) (-2072.022) -- 0:00:06
977800 -- (-2075.593) [-2080.275] (-2079.644) (-2076.958) * [-2072.464] (-2079.212) (-2080.703) (-2083.245) -- 0:00:06
977900 -- (-2071.986) [-2071.599] (-2079.530) (-2087.604) * (-2071.761) [-2078.514] (-2078.320) (-2073.655) -- 0:00:06
978000 -- [-2069.664] (-2069.838) (-2082.797) (-2093.122) * [-2074.470] (-2094.452) (-2080.345) (-2073.683) -- 0:00:06
Average standard deviation of split frequencies: 0.003387
978100 -- [-2068.188] (-2070.256) (-2078.583) (-2093.246) * [-2071.085] (-2081.877) (-2071.734) (-2069.233) -- 0:00:06
978200 -- (-2076.852) (-2069.958) [-2078.113] (-2085.548) * (-2072.652) (-2091.113) [-2069.671] (-2075.020) -- 0:00:06
978300 -- (-2076.807) (-2069.708) [-2076.716] (-2077.712) * (-2072.682) (-2081.175) [-2078.936] (-2078.392) -- 0:00:06
978400 -- (-2081.378) (-2074.365) [-2072.060] (-2078.387) * (-2080.972) (-2078.995) (-2076.815) [-2071.558] -- 0:00:06
978500 -- (-2073.731) (-2068.768) [-2073.300] (-2075.135) * (-2071.805) [-2077.245] (-2077.740) (-2075.029) -- 0:00:06
978600 -- [-2072.608] (-2075.753) (-2077.433) (-2079.537) * (-2077.505) (-2087.253) (-2077.417) [-2072.563] -- 0:00:06
978700 -- (-2073.469) [-2077.114] (-2085.751) (-2076.062) * (-2071.755) (-2081.256) [-2075.364] (-2072.572) -- 0:00:06
978800 -- (-2079.966) (-2068.484) (-2076.232) [-2068.664] * (-2074.503) (-2078.933) (-2072.232) [-2072.199] -- 0:00:06
978900 -- (-2083.119) (-2068.416) (-2076.338) [-2072.723] * [-2068.860] (-2087.579) (-2076.627) (-2072.665) -- 0:00:06
979000 -- (-2083.053) [-2068.499] (-2080.241) (-2069.960) * (-2076.949) (-2082.103) [-2073.146] (-2079.417) -- 0:00:06
Average standard deviation of split frequencies: 0.003342
979100 -- (-2079.439) (-2068.634) (-2085.163) [-2071.438] * (-2074.044) (-2081.808) [-2070.456] (-2074.217) -- 0:00:06
979200 -- (-2075.868) [-2075.334] (-2088.807) (-2071.993) * [-2069.284] (-2090.431) (-2069.491) (-2072.819) -- 0:00:05
979300 -- (-2085.280) [-2068.968] (-2079.192) (-2072.149) * (-2070.916) (-2088.467) (-2068.536) [-2071.812] -- 0:00:05
979400 -- (-2089.123) [-2072.254] (-2082.115) (-2074.053) * (-2074.112) (-2082.681) [-2070.913] (-2074.467) -- 0:00:05
979500 -- (-2100.932) (-2074.458) [-2075.291] (-2070.738) * [-2077.326] (-2081.406) (-2071.335) (-2074.536) -- 0:00:05
979600 -- (-2086.893) [-2073.041] (-2082.261) (-2073.746) * (-2088.683) (-2076.893) [-2081.458] (-2077.901) -- 0:00:05
979700 -- (-2078.614) (-2072.211) [-2074.918] (-2079.977) * (-2084.823) (-2078.155) [-2069.959] (-2081.047) -- 0:00:05
979800 -- (-2079.393) (-2074.429) [-2074.352] (-2068.742) * [-2075.613] (-2073.637) (-2079.831) (-2071.555) -- 0:00:05
979900 -- (-2084.185) (-2077.169) (-2080.673) [-2072.432] * (-2078.635) [-2074.091] (-2076.595) (-2080.570) -- 0:00:05
980000 -- (-2079.138) (-2075.599) (-2078.403) [-2069.458] * (-2084.280) (-2073.436) (-2081.100) [-2078.160] -- 0:00:05
Average standard deviation of split frequencies: 0.003298
980100 -- (-2087.317) (-2072.081) [-2076.391] (-2077.701) * (-2076.327) (-2081.516) [-2067.913] (-2073.169) -- 0:00:05
980200 -- (-2086.505) (-2076.700) [-2074.339] (-2078.715) * (-2077.989) (-2080.579) [-2068.469] (-2075.296) -- 0:00:05
980300 -- (-2078.158) [-2071.921] (-2074.962) (-2084.643) * (-2081.865) (-2092.383) [-2078.535] (-2073.532) -- 0:00:05
980400 -- (-2076.754) [-2070.862] (-2080.970) (-2080.997) * [-2077.304] (-2086.842) (-2080.292) (-2075.235) -- 0:00:05
980500 -- (-2080.624) (-2077.633) (-2080.729) [-2072.363] * [-2076.711] (-2084.208) (-2078.527) (-2077.138) -- 0:00:05
980600 -- (-2079.782) (-2073.990) (-2079.703) [-2071.599] * (-2074.278) (-2078.052) [-2073.125] (-2077.229) -- 0:00:05
980700 -- (-2079.516) (-2069.755) [-2073.911] (-2087.004) * (-2072.958) (-2076.987) [-2070.944] (-2083.499) -- 0:00:05
980800 -- (-2077.555) [-2067.254] (-2074.787) (-2084.070) * (-2079.938) (-2076.705) [-2072.126] (-2075.430) -- 0:00:05
980900 -- (-2077.774) [-2069.359] (-2077.990) (-2087.488) * (-2083.213) (-2084.140) (-2071.223) [-2077.918] -- 0:00:05
981000 -- (-2077.554) (-2070.414) [-2074.121] (-2079.532) * (-2084.985) (-2087.305) (-2075.142) [-2074.342] -- 0:00:05
Average standard deviation of split frequencies: 0.003240
981100 -- (-2075.741) [-2072.996] (-2071.085) (-2083.324) * (-2088.634) (-2090.594) (-2077.748) [-2077.441] -- 0:00:05
981200 -- (-2071.205) (-2073.740) (-2075.524) [-2073.575] * (-2089.952) (-2084.401) (-2085.416) [-2074.529] -- 0:00:05
981300 -- (-2080.845) (-2083.357) [-2073.883] (-2068.841) * (-2081.480) (-2076.372) [-2070.343] (-2075.843) -- 0:00:05
981400 -- (-2081.617) (-2072.717) (-2081.443) [-2069.211] * (-2077.990) (-2085.197) [-2073.039] (-2085.485) -- 0:00:05
981500 -- (-2077.238) (-2073.368) [-2070.262] (-2074.822) * (-2077.577) [-2074.769] (-2088.468) (-2075.177) -- 0:00:05
981600 -- (-2073.593) (-2083.307) (-2080.503) [-2079.124] * (-2084.838) (-2070.560) (-2077.487) [-2068.337] -- 0:00:05
981700 -- [-2073.852] (-2081.790) (-2085.687) (-2074.280) * [-2078.425] (-2071.227) (-2078.201) (-2077.647) -- 0:00:05
981800 -- (-2069.893) (-2082.018) (-2078.635) [-2070.014] * (-2075.274) [-2073.641] (-2083.524) (-2081.075) -- 0:00:05
981900 -- (-2076.445) (-2074.731) [-2072.639] (-2075.335) * (-2084.120) [-2077.331] (-2089.328) (-2076.693) -- 0:00:05
982000 -- (-2072.975) (-2084.413) (-2071.391) [-2070.555] * [-2073.049] (-2082.872) (-2092.494) (-2073.525) -- 0:00:05
Average standard deviation of split frequencies: 0.003236
982100 -- (-2071.394) (-2084.574) (-2072.692) [-2076.123] * [-2070.167] (-2073.031) (-2079.104) (-2074.927) -- 0:00:05
982200 -- [-2069.295] (-2079.309) (-2074.175) (-2078.296) * [-2070.225] (-2072.278) (-2089.795) (-2087.575) -- 0:00:05
982300 -- (-2068.756) (-2079.457) [-2074.907] (-2084.555) * [-2078.052] (-2075.260) (-2077.082) (-2084.723) -- 0:00:05
982400 -- [-2068.090] (-2072.231) (-2070.427) (-2079.207) * (-2077.814) [-2071.364] (-2077.447) (-2076.429) -- 0:00:05
982500 -- (-2067.565) [-2081.990] (-2075.234) (-2084.813) * (-2078.929) [-2072.953] (-2076.746) (-2072.284) -- 0:00:05
982600 -- (-2080.625) (-2070.149) (-2077.682) [-2068.919] * [-2069.102] (-2068.360) (-2071.749) (-2077.065) -- 0:00:05
982700 -- (-2070.305) [-2071.404] (-2083.137) (-2066.115) * (-2078.245) [-2070.607] (-2075.969) (-2072.334) -- 0:00:04
982800 -- (-2077.654) [-2071.508] (-2083.259) (-2074.469) * (-2079.686) [-2067.719] (-2071.794) (-2082.871) -- 0:00:04
982900 -- (-2072.547) [-2073.301] (-2076.987) (-2068.537) * [-2076.310] (-2071.313) (-2069.328) (-2078.301) -- 0:00:04
983000 -- (-2079.693) (-2073.268) [-2075.313] (-2072.229) * (-2080.484) [-2076.438] (-2079.346) (-2074.486) -- 0:00:04
Average standard deviation of split frequencies: 0.003356
983100 -- [-2071.541] (-2077.667) (-2076.718) (-2067.601) * (-2069.312) (-2076.639) (-2076.447) [-2077.876] -- 0:00:04
983200 -- [-2070.990] (-2082.189) (-2089.122) (-2080.524) * [-2071.315] (-2074.723) (-2080.582) (-2072.615) -- 0:00:04
983300 -- [-2074.423] (-2077.898) (-2080.046) (-2072.972) * (-2073.509) (-2077.902) [-2071.668] (-2073.674) -- 0:00:04
983400 -- (-2072.896) (-2078.242) (-2075.416) [-2076.934] * (-2075.299) (-2078.677) (-2072.735) [-2071.295] -- 0:00:04
983500 -- (-2074.792) (-2078.405) [-2069.574] (-2084.919) * (-2085.033) [-2073.348] (-2066.898) (-2073.110) -- 0:00:04
983600 -- (-2082.374) [-2077.043] (-2073.737) (-2078.955) * (-2080.651) (-2072.864) (-2071.453) [-2072.013] -- 0:00:04
983700 -- [-2071.856] (-2077.829) (-2074.647) (-2080.371) * (-2075.265) [-2075.472] (-2069.798) (-2077.864) -- 0:00:04
983800 -- (-2071.842) (-2081.703) (-2072.319) [-2074.850] * [-2079.900] (-2073.038) (-2079.092) (-2076.945) -- 0:00:04
983900 -- (-2073.718) (-2085.838) [-2069.262] (-2080.214) * (-2075.511) (-2075.603) [-2074.501] (-2083.674) -- 0:00:04
984000 -- (-2075.934) [-2082.854] (-2073.204) (-2089.034) * (-2079.294) (-2077.861) (-2084.429) [-2077.956] -- 0:00:04
Average standard deviation of split frequencies: 0.003435
984100 -- (-2074.596) [-2079.270] (-2075.872) (-2083.334) * [-2072.512] (-2085.404) (-2073.916) (-2079.466) -- 0:00:04
984200 -- [-2073.059] (-2079.503) (-2073.091) (-2081.509) * (-2069.874) (-2079.378) (-2075.641) [-2077.234] -- 0:00:04
984300 -- (-2084.415) (-2079.787) (-2073.808) [-2074.758] * (-2072.332) (-2080.445) (-2073.133) [-2083.077] -- 0:00:04
984400 -- (-2084.229) (-2080.022) (-2070.376) [-2077.059] * [-2069.856] (-2080.524) (-2076.997) (-2084.485) -- 0:00:04
984500 -- (-2083.463) [-2075.227] (-2076.086) (-2081.490) * (-2078.254) [-2071.053] (-2079.327) (-2080.033) -- 0:00:04
984600 -- (-2078.537) (-2073.150) (-2076.189) [-2075.313] * (-2083.619) [-2073.830] (-2077.225) (-2077.005) -- 0:00:04
984700 -- (-2077.688) (-2077.737) [-2073.582] (-2075.826) * (-2076.570) (-2080.777) (-2075.943) [-2078.576] -- 0:00:04
984800 -- (-2080.450) [-2079.803] (-2071.814) (-2071.644) * (-2077.428) (-2078.165) [-2067.969] (-2083.883) -- 0:00:04
984900 -- (-2094.920) (-2079.443) [-2073.414] (-2073.716) * (-2082.789) (-2074.908) [-2068.983] (-2087.398) -- 0:00:04
985000 -- (-2078.878) (-2084.095) (-2073.622) [-2073.581] * (-2076.297) [-2073.637] (-2070.996) (-2093.335) -- 0:00:04
Average standard deviation of split frequencies: 0.003267
985100 -- (-2076.378) [-2078.296] (-2070.179) (-2071.254) * (-2074.829) (-2070.427) [-2078.609] (-2078.553) -- 0:00:04
985200 -- [-2067.137] (-2080.479) (-2077.453) (-2079.470) * (-2075.916) [-2068.119] (-2080.674) (-2081.146) -- 0:00:04
985300 -- [-2070.938] (-2078.288) (-2075.511) (-2076.070) * (-2071.788) [-2068.609] (-2079.798) (-2087.327) -- 0:00:04
985400 -- (-2074.243) (-2076.191) (-2071.012) [-2069.153] * [-2069.930] (-2072.751) (-2070.444) (-2080.640) -- 0:00:04
985500 -- (-2081.956) [-2072.207] (-2073.822) (-2083.560) * (-2074.407) [-2068.751] (-2079.675) (-2077.072) -- 0:00:04
985600 -- (-2072.962) (-2078.916) (-2081.095) [-2073.351] * [-2074.440] (-2076.249) (-2072.561) (-2075.026) -- 0:00:04
985700 -- (-2076.213) (-2081.948) (-2076.755) [-2073.791] * (-2073.112) [-2078.369] (-2075.787) (-2075.830) -- 0:00:04
985800 -- [-2076.265] (-2074.802) (-2076.896) (-2074.016) * [-2072.180] (-2075.514) (-2072.555) (-2079.965) -- 0:00:04
985900 -- [-2073.871] (-2082.083) (-2074.072) (-2077.321) * (-2076.680) (-2074.150) [-2070.746] (-2075.527) -- 0:00:04
986000 -- (-2074.662) [-2075.150] (-2072.385) (-2067.167) * (-2078.280) [-2075.310] (-2083.352) (-2075.354) -- 0:00:04
Average standard deviation of split frequencies: 0.003169
986100 -- (-2086.161) (-2075.527) [-2073.517] (-2076.262) * (-2073.959) (-2082.802) [-2072.101] (-2079.036) -- 0:00:04
986200 -- (-2085.260) (-2081.696) (-2074.266) [-2078.709] * [-2069.928] (-2084.864) (-2072.419) (-2076.280) -- 0:00:03
986300 -- (-2085.716) [-2069.987] (-2078.953) (-2075.626) * (-2078.150) (-2083.566) [-2069.820] (-2081.166) -- 0:00:03
986400 -- [-2077.107] (-2072.301) (-2076.302) (-2079.263) * [-2074.105] (-2076.213) (-2070.429) (-2081.466) -- 0:00:03
986500 -- [-2075.459] (-2076.878) (-2079.000) (-2083.530) * (-2080.185) (-2073.495) (-2081.643) [-2074.378] -- 0:00:03
986600 -- (-2084.429) (-2085.762) [-2072.563] (-2077.594) * (-2084.950) [-2075.086] (-2068.281) (-2076.339) -- 0:00:03
986700 -- [-2072.181] (-2089.679) (-2073.268) (-2082.340) * (-2081.764) [-2073.425] (-2074.010) (-2087.066) -- 0:00:03
986800 -- (-2072.388) (-2077.405) (-2075.292) [-2076.279] * (-2077.728) (-2068.901) [-2070.361] (-2087.389) -- 0:00:03
986900 -- (-2074.772) (-2083.127) (-2076.370) [-2077.353] * (-2078.830) [-2067.478] (-2073.250) (-2085.752) -- 0:00:03
987000 -- [-2070.485] (-2084.210) (-2073.802) (-2086.049) * (-2075.472) (-2078.853) [-2074.233] (-2085.698) -- 0:00:03
Average standard deviation of split frequencies: 0.003029
987100 -- (-2075.774) [-2076.986] (-2085.587) (-2075.173) * (-2073.462) (-2074.448) [-2073.316] (-2088.833) -- 0:00:03
987200 -- [-2069.066] (-2074.614) (-2079.236) (-2081.591) * [-2077.933] (-2078.005) (-2075.994) (-2084.848) -- 0:00:03
987300 -- (-2074.225) (-2071.865) (-2081.286) [-2075.612] * (-2076.107) (-2084.476) (-2083.021) [-2090.187] -- 0:00:03
987400 -- (-2084.062) [-2071.407] (-2078.505) (-2078.658) * (-2082.909) (-2078.664) [-2068.980] (-2085.879) -- 0:00:03
987500 -- (-2081.928) (-2074.680) [-2071.197] (-2069.754) * (-2077.691) (-2077.982) [-2071.898] (-2096.621) -- 0:00:03
987600 -- (-2076.210) (-2079.033) [-2070.238] (-2074.549) * (-2085.737) (-2080.254) [-2075.264] (-2083.225) -- 0:00:03
987700 -- (-2071.877) (-2077.860) (-2074.103) [-2082.342] * (-2089.010) [-2072.844] (-2076.558) (-2079.782) -- 0:00:03
987800 -- (-2081.138) [-2074.760] (-2076.405) (-2078.769) * (-2081.818) [-2069.942] (-2083.548) (-2092.429) -- 0:00:03
987900 -- (-2086.398) [-2073.742] (-2077.091) (-2078.944) * (-2081.123) [-2073.199] (-2077.656) (-2090.311) -- 0:00:03
988000 -- (-2088.487) [-2071.801] (-2074.441) (-2079.955) * (-2080.946) [-2070.618] (-2079.067) (-2092.698) -- 0:00:03
Average standard deviation of split frequencies: 0.002917
988100 -- (-2084.125) (-2069.207) [-2073.026] (-2089.426) * [-2075.421] (-2069.897) (-2080.522) (-2083.995) -- 0:00:03
988200 -- (-2086.980) (-2072.728) [-2067.110] (-2089.957) * (-2082.840) (-2069.841) [-2076.885] (-2090.178) -- 0:00:03
988300 -- (-2082.999) [-2070.424] (-2074.628) (-2089.965) * (-2078.881) [-2075.507] (-2074.090) (-2088.395) -- 0:00:03
988400 -- [-2079.911] (-2071.071) (-2074.235) (-2084.654) * (-2078.069) (-2076.620) [-2073.182] (-2095.579) -- 0:00:03
988500 -- (-2076.436) (-2075.370) [-2069.797] (-2076.053) * [-2079.041] (-2078.592) (-2071.011) (-2089.659) -- 0:00:03
988600 -- [-2075.861] (-2072.220) (-2070.303) (-2078.454) * (-2077.081) [-2075.255] (-2073.037) (-2095.312) -- 0:00:03
988700 -- [-2074.989] (-2073.825) (-2076.299) (-2079.472) * (-2083.288) (-2074.626) [-2075.137] (-2107.093) -- 0:00:03
988800 -- (-2072.784) [-2071.085] (-2084.207) (-2085.224) * (-2086.628) (-2071.660) [-2071.267] (-2091.398) -- 0:00:03
988900 -- (-2080.796) (-2087.959) (-2083.632) [-2070.633] * (-2082.767) (-2076.398) [-2072.994] (-2092.497) -- 0:00:03
989000 -- [-2075.921] (-2087.251) (-2086.299) (-2076.789) * (-2080.622) (-2074.091) [-2078.212] (-2099.135) -- 0:00:03
Average standard deviation of split frequencies: 0.002927
989100 -- [-2074.294] (-2079.481) (-2083.347) (-2077.372) * (-2075.583) [-2070.939] (-2072.607) (-2090.481) -- 0:00:03
989200 -- (-2083.122) [-2071.217] (-2076.616) (-2076.707) * (-2079.496) (-2070.862) [-2073.324] (-2084.211) -- 0:00:03
989300 -- [-2077.715] (-2074.016) (-2076.131) (-2079.993) * (-2083.427) [-2073.710] (-2082.538) (-2086.677) -- 0:00:03
989400 -- (-2080.364) (-2072.813) (-2076.523) [-2071.947] * (-2079.140) (-2071.059) [-2080.249] (-2087.812) -- 0:00:03
989500 -- (-2084.814) (-2076.907) (-2076.486) [-2069.799] * (-2087.768) (-2069.539) [-2081.113] (-2081.542) -- 0:00:03
989600 -- (-2086.544) (-2080.421) (-2080.371) [-2066.595] * (-2078.431) [-2070.383] (-2088.750) (-2079.242) -- 0:00:02
989700 -- (-2082.897) (-2074.778) (-2082.611) [-2069.461] * (-2079.108) [-2071.977] (-2072.795) (-2084.380) -- 0:00:02
989800 -- (-2075.158) (-2074.882) (-2084.930) [-2072.307] * (-2087.173) (-2079.636) [-2074.086] (-2080.270) -- 0:00:02
989900 -- (-2069.511) (-2075.645) (-2080.615) [-2071.170] * (-2077.998) (-2078.509) (-2075.305) [-2086.795] -- 0:00:02
990000 -- [-2076.894] (-2077.444) (-2083.696) (-2074.975) * [-2077.585] (-2073.153) (-2072.378) (-2084.139) -- 0:00:02
Average standard deviation of split frequencies: 0.002965
990100 -- (-2072.567) [-2074.279] (-2075.740) (-2070.519) * [-2080.008] (-2071.496) (-2071.785) (-2091.580) -- 0:00:02
990200 -- (-2069.610) (-2084.241) [-2074.365] (-2072.185) * (-2076.913) (-2072.571) [-2069.206] (-2084.255) -- 0:00:02
990300 -- (-2077.050) (-2077.862) (-2082.587) [-2072.183] * (-2079.162) [-2070.627] (-2071.820) (-2092.519) -- 0:00:02
990400 -- (-2078.051) [-2075.695] (-2082.836) (-2079.770) * (-2082.319) [-2071.184] (-2069.411) (-2086.289) -- 0:00:02
990500 -- [-2077.184] (-2084.377) (-2086.052) (-2078.750) * (-2084.005) (-2068.853) [-2070.802] (-2088.295) -- 0:00:02
990600 -- (-2081.875) (-2086.083) [-2074.121] (-2084.976) * (-2082.673) [-2071.099] (-2072.324) (-2088.015) -- 0:00:02
990700 -- (-2080.641) (-2078.695) [-2072.235] (-2082.682) * (-2080.689) (-2072.936) [-2071.676] (-2084.207) -- 0:00:02
990800 -- [-2081.005] (-2082.541) (-2073.135) (-2085.228) * (-2084.495) (-2078.832) [-2074.282] (-2084.414) -- 0:00:02
990900 -- (-2078.829) [-2077.800] (-2078.073) (-2080.858) * (-2089.928) (-2078.521) [-2070.145] (-2085.696) -- 0:00:02
991000 -- (-2077.749) [-2075.199] (-2088.929) (-2081.000) * (-2086.388) [-2079.085] (-2072.784) (-2085.212) -- 0:00:02
Average standard deviation of split frequencies: 0.002949
991100 -- (-2080.641) [-2074.559] (-2085.158) (-2080.409) * (-2080.762) (-2082.787) [-2070.600] (-2088.083) -- 0:00:02
991200 -- [-2074.677] (-2079.558) (-2077.456) (-2080.144) * [-2078.090] (-2079.257) (-2070.152) (-2090.367) -- 0:00:02
991300 -- (-2078.095) [-2078.713] (-2079.987) (-2091.160) * (-2086.634) (-2081.551) [-2071.365] (-2093.564) -- 0:00:02
991400 -- (-2077.425) [-2078.321] (-2079.556) (-2102.367) * (-2077.518) (-2079.071) [-2070.975] (-2096.499) -- 0:00:02
991500 -- (-2074.470) [-2078.717] (-2078.128) (-2095.224) * (-2075.921) (-2078.371) [-2069.522] (-2085.653) -- 0:00:02
991600 -- (-2078.360) (-2081.283) [-2070.790] (-2079.549) * (-2076.951) [-2073.193] (-2074.399) (-2087.201) -- 0:00:02
991700 -- [-2074.630] (-2086.324) (-2075.567) (-2087.614) * (-2081.237) (-2074.453) [-2068.585] (-2087.183) -- 0:00:02
991800 -- (-2078.006) (-2085.246) (-2080.264) [-2077.446] * (-2084.775) [-2073.371] (-2068.401) (-2082.118) -- 0:00:02
991900 -- (-2084.258) (-2072.845) [-2077.694] (-2079.886) * (-2077.034) [-2072.206] (-2075.099) (-2082.781) -- 0:00:02
992000 -- (-2075.074) [-2075.611] (-2081.329) (-2080.091) * (-2086.405) [-2070.703] (-2074.387) (-2081.699) -- 0:00:02
Average standard deviation of split frequencies: 0.002946
992100 -- (-2080.697) (-2078.757) (-2077.131) [-2081.276] * (-2080.167) [-2072.687] (-2074.431) (-2078.356) -- 0:00:02
992200 -- (-2083.085) [-2076.920] (-2084.998) (-2081.326) * (-2092.750) (-2080.387) [-2068.187] (-2079.996) -- 0:00:02
992300 -- (-2078.540) [-2077.781] (-2079.010) (-2086.864) * (-2094.160) (-2079.501) [-2068.441] (-2077.185) -- 0:00:02
992400 -- (-2076.214) [-2075.100] (-2077.164) (-2085.750) * (-2093.288) [-2078.746] (-2072.558) (-2089.525) -- 0:00:02
992500 -- (-2082.968) (-2074.402) [-2079.736] (-2090.595) * (-2095.094) (-2074.588) [-2070.141] (-2085.868) -- 0:00:02
992600 -- (-2084.907) [-2078.313] (-2077.254) (-2079.163) * (-2099.687) (-2075.581) [-2068.977] (-2081.694) -- 0:00:02
992700 -- (-2073.466) [-2077.781] (-2082.534) (-2081.230) * (-2100.558) (-2083.912) [-2070.427] (-2076.155) -- 0:00:02
992800 -- (-2078.672) [-2077.586] (-2079.823) (-2090.093) * (-2092.955) (-2082.821) [-2075.758] (-2084.321) -- 0:00:02
992900 -- (-2078.949) [-2077.375] (-2082.150) (-2086.095) * (-2102.392) (-2074.728) [-2068.675] (-2083.102) -- 0:00:02
993000 -- (-2085.249) [-2076.947] (-2085.937) (-2091.567) * (-2105.977) (-2072.251) (-2079.666) [-2079.255] -- 0:00:02
Average standard deviation of split frequencies: 0.002888
993100 -- [-2081.897] (-2075.184) (-2083.144) (-2085.364) * (-2115.762) [-2068.421] (-2080.806) (-2076.077) -- 0:00:01
993200 -- [-2073.090] (-2087.764) (-2069.831) (-2092.528) * (-2099.118) [-2067.621] (-2079.106) (-2083.150) -- 0:00:01
993300 -- (-2085.770) [-2076.475] (-2070.710) (-2088.553) * (-2082.881) [-2070.529] (-2080.837) (-2085.081) -- 0:00:01
993400 -- (-2082.876) [-2077.748] (-2078.298) (-2076.876) * (-2085.395) [-2071.035] (-2077.411) (-2083.172) -- 0:00:01
993500 -- (-2090.353) (-2074.868) (-2071.482) [-2077.188] * (-2075.188) (-2076.267) [-2072.999] (-2083.275) -- 0:00:01
993600 -- (-2079.690) (-2075.943) (-2074.404) [-2073.388] * (-2079.756) [-2074.076] (-2074.258) (-2079.672) -- 0:00:01
993700 -- (-2081.419) (-2076.054) [-2076.846] (-2075.178) * (-2085.963) (-2080.285) (-2070.512) [-2078.410] -- 0:00:01
993800 -- (-2084.717) (-2074.339) (-2074.216) [-2082.140] * (-2077.838) (-2078.311) [-2073.463] (-2079.182) -- 0:00:01
993900 -- (-2083.943) [-2080.850] (-2083.443) (-2082.639) * (-2078.857) (-2079.826) (-2072.423) [-2078.318] -- 0:00:01
994000 -- (-2083.528) (-2081.687) [-2076.010] (-2083.157) * (-2082.088) (-2082.864) [-2072.638] (-2080.552) -- 0:00:01
Average standard deviation of split frequencies: 0.002886
994100 -- (-2085.753) (-2079.334) [-2079.539] (-2083.118) * (-2082.474) (-2082.493) (-2067.498) [-2072.903] -- 0:00:01
994200 -- (-2078.510) (-2083.997) [-2074.529] (-2084.086) * (-2077.847) (-2088.746) [-2071.178] (-2078.578) -- 0:00:01
994300 -- (-2087.966) (-2083.351) [-2069.937] (-2074.979) * (-2079.555) (-2078.593) [-2065.102] (-2078.561) -- 0:00:01
994400 -- [-2088.247] (-2082.916) (-2075.358) (-2080.876) * (-2078.912) (-2076.645) [-2068.629] (-2077.869) -- 0:00:01
994500 -- (-2081.757) (-2075.538) [-2069.352] (-2081.032) * (-2083.832) (-2074.859) [-2065.191] (-2080.581) -- 0:00:01
994600 -- (-2081.223) (-2080.117) [-2070.694] (-2090.567) * (-2085.840) [-2072.440] (-2069.742) (-2082.826) -- 0:00:01
994700 -- (-2088.191) (-2078.922) [-2068.598] (-2083.774) * (-2085.932) (-2074.890) [-2070.284] (-2084.402) -- 0:00:01
994800 -- (-2079.882) (-2080.646) [-2073.422] (-2088.610) * (-2080.749) (-2069.442) [-2068.816] (-2080.525) -- 0:00:01
994900 -- (-2081.560) (-2085.635) [-2072.051] (-2076.623) * (-2078.776) (-2076.879) [-2073.997] (-2081.540) -- 0:00:01
995000 -- [-2078.683] (-2076.834) (-2071.315) (-2076.225) * (-2080.862) [-2071.070] (-2081.738) (-2086.975) -- 0:00:01
Average standard deviation of split frequencies: 0.002937
995100 -- (-2079.326) (-2080.619) [-2072.415] (-2074.861) * (-2081.173) [-2077.931] (-2085.265) (-2077.462) -- 0:00:01
995200 -- (-2086.766) (-2078.540) [-2080.259] (-2081.555) * (-2082.921) [-2073.682] (-2085.428) (-2081.000) -- 0:00:01
995300 -- (-2085.621) (-2093.884) (-2075.900) [-2076.873] * (-2079.803) (-2073.612) [-2078.019] (-2078.935) -- 0:00:01
995400 -- (-2086.544) (-2092.846) [-2075.397] (-2077.809) * (-2079.179) (-2073.490) [-2075.870] (-2075.767) -- 0:00:01
995500 -- (-2084.997) (-2086.942) [-2075.335] (-2078.392) * (-2078.232) [-2071.523] (-2074.727) (-2080.613) -- 0:00:01
995600 -- (-2075.846) [-2080.962] (-2080.950) (-2078.721) * [-2081.291] (-2079.002) (-2070.909) (-2086.494) -- 0:00:01
995700 -- (-2079.547) [-2076.422] (-2077.456) (-2086.392) * (-2079.774) (-2076.345) [-2072.909] (-2084.379) -- 0:00:01
995800 -- (-2081.438) (-2082.483) [-2071.386] (-2082.746) * (-2085.417) (-2084.401) [-2068.397] (-2080.299) -- 0:00:01
995900 -- (-2080.201) (-2079.103) [-2071.289] (-2084.189) * (-2090.854) (-2077.782) [-2073.959] (-2084.098) -- 0:00:01
996000 -- (-2086.319) [-2080.388] (-2071.358) (-2089.573) * (-2080.928) (-2077.134) [-2075.412] (-2075.091) -- 0:00:01
Average standard deviation of split frequencies: 0.002866
996100 -- [-2073.245] (-2077.295) (-2071.643) (-2096.955) * (-2075.624) (-2077.157) (-2070.420) [-2078.313] -- 0:00:01
996200 -- (-2078.851) (-2081.944) [-2070.419] (-2091.225) * (-2084.209) (-2080.932) [-2070.637] (-2075.749) -- 0:00:01
996300 -- (-2075.350) (-2080.389) [-2076.725] (-2090.211) * (-2090.511) (-2074.612) (-2075.444) [-2079.423] -- 0:00:01
996400 -- (-2076.596) (-2083.536) (-2078.319) [-2085.236] * (-2091.859) [-2082.793] (-2069.510) (-2079.886) -- 0:00:01
996500 -- [-2076.773] (-2074.229) (-2075.932) (-2089.470) * (-2083.910) (-2093.352) [-2069.196] (-2078.852) -- 0:00:01
996600 -- (-2076.526) (-2082.594) [-2077.541] (-2080.773) * (-2086.263) (-2080.931) [-2067.852] (-2082.811) -- 0:00:00
996700 -- (-2077.087) (-2086.854) [-2072.946] (-2085.679) * (-2084.664) (-2078.279) [-2069.135] (-2078.182) -- 0:00:00
996800 -- (-2077.303) (-2089.452) [-2073.159] (-2088.308) * (-2079.965) (-2079.260) [-2071.680] (-2075.577) -- 0:00:00
996900 -- (-2073.533) [-2078.053] (-2078.122) (-2097.030) * (-2080.026) [-2078.582] (-2072.403) (-2079.112) -- 0:00:00
997000 -- (-2078.230) (-2080.094) [-2075.037] (-2090.588) * (-2087.811) [-2078.010] (-2076.109) (-2078.873) -- 0:00:00
Average standard deviation of split frequencies: 0.002917
997100 -- [-2072.053] (-2083.875) (-2082.379) (-2082.877) * (-2080.859) (-2077.872) (-2077.476) [-2080.325] -- 0:00:00
997200 -- [-2078.462] (-2082.348) (-2081.412) (-2075.336) * (-2079.511) [-2076.385] (-2081.055) (-2078.436) -- 0:00:00
997300 -- (-2071.906) (-2082.430) [-2069.554] (-2082.032) * [-2077.820] (-2079.014) (-2075.434) (-2081.939) -- 0:00:00
997400 -- [-2077.086] (-2080.340) (-2072.865) (-2084.698) * (-2081.941) (-2080.917) (-2074.497) [-2078.994] -- 0:00:00
997500 -- (-2084.536) (-2083.356) [-2071.674] (-2085.707) * (-2081.369) (-2082.182) (-2075.435) [-2079.975] -- 0:00:00
997600 -- (-2075.256) (-2078.339) [-2071.845] (-2083.923) * [-2079.940] (-2081.781) (-2082.716) (-2076.415) -- 0:00:00
997700 -- (-2078.206) (-2081.086) [-2069.254] (-2082.892) * (-2086.405) (-2084.066) (-2077.393) [-2072.382] -- 0:00:00
997800 -- (-2089.836) (-2080.353) [-2066.291] (-2080.178) * (-2084.311) [-2079.322] (-2081.245) (-2079.059) -- 0:00:00
997900 -- (-2083.907) [-2075.587] (-2070.983) (-2073.935) * (-2084.856) [-2075.179] (-2073.398) (-2077.322) -- 0:00:00
998000 -- (-2077.927) [-2080.242] (-2077.261) (-2079.914) * (-2085.116) (-2082.587) [-2075.741] (-2086.903) -- 0:00:00
Average standard deviation of split frequencies: 0.002928
998100 -- (-2074.489) [-2070.865] (-2075.984) (-2081.438) * (-2085.463) [-2076.499] (-2073.691) (-2079.079) -- 0:00:00
998200 -- (-2077.925) (-2080.611) (-2083.629) [-2081.110] * (-2073.978) [-2070.413] (-2076.828) (-2081.738) -- 0:00:00
998300 -- [-2077.342] (-2076.390) (-2075.508) (-2082.726) * (-2076.558) (-2075.592) [-2074.463] (-2082.708) -- 0:00:00
998400 -- (-2075.682) [-2080.922] (-2080.687) (-2078.358) * (-2079.775) [-2076.072] (-2081.577) (-2088.489) -- 0:00:00
998500 -- (-2078.330) (-2078.650) [-2075.864] (-2077.477) * (-2087.027) (-2078.359) (-2075.696) [-2076.789] -- 0:00:00
998600 -- (-2082.119) (-2083.720) (-2070.803) [-2074.933] * (-2075.607) [-2078.273] (-2087.171) (-2086.651) -- 0:00:00
998700 -- (-2087.083) [-2077.347] (-2074.623) (-2083.863) * (-2079.379) [-2071.974] (-2083.833) (-2082.631) -- 0:00:00
998800 -- (-2083.722) (-2075.356) [-2078.000] (-2088.616) * (-2076.510) [-2074.994] (-2085.471) (-2083.289) -- 0:00:00
998900 -- (-2075.166) (-2077.926) [-2074.661] (-2087.345) * (-2078.145) [-2076.024] (-2083.941) (-2087.912) -- 0:00:00
999000 -- (-2077.261) (-2078.773) (-2087.724) [-2072.508] * (-2076.732) [-2075.008] (-2082.288) (-2087.409) -- 0:00:00
Average standard deviation of split frequencies: 0.002844
999100 -- (-2077.954) (-2092.311) (-2086.513) [-2072.065] * [-2075.857] (-2075.858) (-2085.963) (-2083.084) -- 0:00:00
999200 -- (-2077.456) (-2091.061) (-2077.484) [-2077.042] * [-2075.780] (-2087.384) (-2080.762) (-2086.026) -- 0:00:00
999300 -- (-2080.798) (-2077.901) [-2074.931] (-2081.821) * [-2072.326] (-2084.987) (-2080.442) (-2084.864) -- 0:00:00
999400 -- (-2080.178) (-2084.054) (-2076.980) [-2083.892] * [-2073.903] (-2075.678) (-2077.792) (-2087.399) -- 0:00:00
999500 -- (-2076.277) (-2088.497) (-2078.124) [-2077.801] * (-2089.327) (-2076.906) [-2071.984] (-2090.554) -- 0:00:00
999600 -- (-2077.167) (-2100.217) [-2073.945] (-2078.783) * (-2101.157) (-2075.747) [-2068.467] (-2075.872) -- 0:00:00
999700 -- (-2070.885) (-2086.675) (-2069.605) [-2076.205] * (-2090.330) (-2085.566) [-2068.416] (-2073.652) -- 0:00:00
999800 -- (-2074.997) (-2086.652) [-2075.983] (-2080.736) * (-2084.558) (-2080.631) (-2070.101) [-2076.224] -- 0:00:00
999900 -- [-2072.275] (-2084.507) (-2080.278) (-2089.808) * (-2099.359) [-2066.957] (-2067.782) (-2074.660) -- 0:00:00
1000000 -- (-2081.172) (-2087.037) [-2077.041] (-2089.731) * (-2098.794) (-2071.515) [-2074.886] (-2078.515) -- 0:00:00
Average standard deviation of split frequencies: 0.002868
Analysis completed in 288 seconds
Analysis used 287.94 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2063.97
Likelihood of best state for "cold" chain of run 2 was -2064.72
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. Chain accepted changes to
57.55 % param. 1 (revmat) with Dirichlet proposal
21.13 % param. 2 (state frequencies) with Dirichlet proposal
82.74 % param. 3 (gamma shape) with multiplier
90.22 % param. 4 (gamma shape) with multiplier
75.75 % param. 5 (prop. invar. sites) with sliding window
30.18 % param. 6 (topology and branch lengths) with extending TBR
24.91 % param. 6 (topology and branch lengths) with LOCAL
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. Chain accepted changes to
57.66 % param. 1 (revmat) with Dirichlet proposal
21.47 % param. 2 (state frequencies) with Dirichlet proposal
84.05 % param. 3 (gamma shape) with multiplier
90.58 % param. 4 (gamma shape) with multiplier
74.84 % param. 5 (prop. invar. sites) with sliding window
30.20 % param. 6 (topology and branch lengths) with extending TBR
24.76 % param. 6 (topology and branch lengths) with LOCAL
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.62 0.36 0.21
2 | 166726 0.68 0.45
3 | 166537 166263 0.73
4 | 167013 166943 166518
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.62 0.36 0.21
2 | 166707 0.68 0.45
3 | 166545 166290 0.73
4 | 166861 167005 166592
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.83
3 -- 0.71
4 -- 0.62
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.20 is the temperature and ID is the chain number)
Setting sump burnin to 2500
Summarizing parameters in files /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing output to screen but not to file ('Printtofile = No')
UNIX line termination
Longest line length = 176
Found 10001 parameter lines in file "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p"
Of the 10001 lines, 7501 of them will be summarized (starting at line 2503)
(Only the last set of lines will be read, in case multiple
parameter blocks are present in the same file.)
7501 rows and 16 columns in each row
Expecting the same layout in all subsequent files
Successfully read 7501 lines from last parameter block of file 1
Successfully read 7501 lines from last parameter block of file 2
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2072.66
| 1 1 1 1 |
|1 1 1 |
| *2 12 2 2 2 |
| 1 2 1 1 11 2 1 1 1 1 22|
| 21 1212 1 1 2 21 1* 2 2 2 *2 |
| 112 21 2 12 11 112 1 1 1 1 21 |
|2 2 2 2 2 1 1 2 1 2221 |
| 2 1 * 2 2 221 1 1 2 *1 1|
| 21 2 2 2 2 2 |
| 2 1 22 1 1 |
| 2 1 2 |
| 2 22 1 1 |
| |
| 2 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2077.61
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2070.09 -2086.67
2 -2070.24 -2083.84
--------------------------------------
TOTAL -2070.16 -2086.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)
95% Cred. Interval
----------------------
Parameter Mean Variance Lower Upper Median PSRF *
---------------------------------------------------------------------------------------------
TL{all} 0.387002 0.002772 0.302000 0.506000 0.381000 1.002
r(A<->C){all} 0.063303 0.000621 0.021490 0.117950 0.060938 1.000
r(A<->G){all} 0.298973 0.001963 0.216633 0.390808 0.297989 1.000
r(A<->T){all} 0.103916 0.001019 0.049369 0.171716 0.101087 1.001
r(C<->G){all} 0.097919 0.000523 0.057623 0.147252 0.096397 1.000
r(C<->T){all} 0.366160 0.002758 0.268401 0.474117 0.364419 1.000
r(G<->T){all} 0.069729 0.000452 0.033963 0.117084 0.067622 1.000
pi(A){all} 0.223771 0.000189 0.197390 0.251420 0.223506 1.000
pi(C){all} 0.252485 0.000208 0.224846 0.281379 0.252357 1.000
pi(G){all} 0.319789 0.000228 0.290485 0.349826 0.319538 1.000
pi(T){all} 0.203956 0.000181 0.178250 0.231141 0.203611 1.000
alpha{1,2} 28.031627 2721.559097 0.308864 180.764229 1.105597 1.012
alpha{3} 101.990667 3266.394053 6.809541 195.003643 100.976671 1.000
pinvar{all} 0.607037 0.006145 0.427042 0.720997 0.620129 1.007
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
Setting sumt burnin to 2500
Summarizing trees in files "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
UNIX line termination
Examining first file ...
Found one tree block in file "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 10001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 20002 trees in 2 files (sampling 15002 of them)
(Each file contained 10001 trees of which 7501 were sampled)
General explanation:
A taxon bibartition is specified by removing a branch, thereby dividing the
species into those to the left and those to the right of the branch. Here,
taxa to one side of the removed branch are denoted "." and those to the
other side are denoted "*". The output includes the bipartition number
(ID; sorted from highest to lowest probability), bipartition (e.g., ...**..),
number of times the bipartition was observed (#obs), the posterior probabil-
ity of the bipartition, and, if branch lengths were recorded on the trees in
the file, the average (Mean(v)) and variance (Var(v)) of the lengths. Each
"." or "*" in the bipartition represents a taxon that is to the left or
right of the removed branch. A list of the taxa in the bipartition is given
before the list of bipartitions. If you summarize several independent analy-
ses, convergence diagnostics are presented for both the posterior probabil-
ities of bipartitions (bipartition or split frequencies) and branch lengths
(if recorded on the trees in the files). In the former case, the diagnostic is
the standard deviation of the partition frequencies (Stdev(s)), in the second
case it is the potential scale reduction factor (PSRF) of Gelman and Rubin
(1992). Stdev(s) is expected to approach 0 and PSRF is expected to approach 1
as runs converge onto the posterior probability distribution. Note that these
values may be unreliable if the partition is not present in all runs (the
last column indicates the number of runs that sampled the partition if more
than one run is summarized). The PSRF is also sensitive to small sample
sizes and it should only be considered a rough guide to convergence since
some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in the phylogenetic context.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Summary statistics for taxon bipartitions:
ID -- Partition #obs Probab. Stdev(s) Mean(v) Var(v) PSRF Nruns
----------------------------------------------------------------------------
1 -- ......* 15002 1.000000 0.000000 0.017314 0.000036 1.000 2
2 -- .****** 15002 1.000000 0.000000 0.020274 0.000037 1.000 2
3 -- .....*. 15002 1.000000 0.000000 0.023525 0.000044 1.000 2
4 -- ...*... 15002 1.000000 0.000000 0.024816 0.000055 1.000 2
5 -- ..*.... 15002 1.000000 0.000000 0.013398 0.000024 1.000 2
6 -- ....*.. 15002 1.000000 0.000000 0.022298 0.000043 1.000 2
7 -- .*..... 15002 1.000000 0.000000 0.226873 0.001820 1.001 2
8 -- .*.*..* 14804 0.986802 0.000943 0.018984 0.000052 1.000 2
9 -- .*.**** 14383 0.958739 0.001414 0.007991 0.000016 1.000 2
10 -- .*.**.* 7932 0.528730 0.006222 0.004981 0.000011 1.000 2
11 -- ...*..* 7612 0.507399 0.002451 0.007844 0.000036 1.000 2
12 -- .*.*.** 5814 0.387548 0.006410 0.005709 0.000014 1.000 2
13 -- .*.*... 5037 0.335755 0.000094 0.006017 0.000023 1.000 2
14 -- .*....* 2353 0.156846 0.002545 0.004295 0.000016 1.000 2
15 -- ....**. 1070 0.071324 0.000377 0.003047 0.000007 1.000 2
----------------------------------------------------------------------------
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C3 (3)
|
| /----------------------------- C2 (2)
+ |
| /------99-----+ /-------------- C4 (4)
| | \------51------+
| /------53------+ \-------------- C7 (7)
| | |
\------96-----+ \------------------------------------------- C5 (5)
|
\---------------------------------------------------------- C6 (6)
Phylogram:
/------ C1 (1)
|
|---- C3 (3)
|
| /--------------------------------------------------------------- C2 (2)
+ |
| /----+ /------- C4 (4)
| | \-+
| /-+ \----- C7 (7)
| | |
\-+ \------ C5 (5)
|
\------- C6 (6)
|-------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (60 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 7 trees
95 % credible set contains 10 trees
99 % credible set contains 23 trees
Exiting MrBayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.5, December 2011
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 801
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
3 ambiguity characters in seq. 4
3 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
3 ambiguity characters in seq. 7
2 sites are removed. 85 267
Sequences read..
Counting site patterns.. 0:00
157 patterns at 265 / 265 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
153232 bytes for conP
13816 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
383080 bytes for conP, adjusted
0.043036 0.037702 0.015828 0.003872 0.025226 0.404768 0.016353 0.056789 0.048112 0.048353 0.060224 0.300000 0.590554 0.166278
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
np = 14
lnL0 = -2136.421055
Iterating by ming2
Initial: fx= 2136.421055
x= 0.04304 0.03770 0.01583 0.00387 0.02523 0.40477 0.01635 0.05679 0.04811 0.04835 0.06022 0.30000 0.59055 0.16628
1 h-m-p 0.0000 0.0017 575.3006 ++CYCCC 2128.976973 4 0.0001 28 | 0/14
2 h-m-p 0.0002 0.0012 355.8394 ++ 2070.603671 m 0.0012 45 | 0/14
3 h-m-p 0.0001 0.0007 417.3100 +CCCC 2047.274892 3 0.0006 69 | 0/14
4 h-m-p 0.0002 0.0009 385.0530 CCCC 2043.565263 3 0.0002 92 | 0/14
5 h-m-p 0.0004 0.0020 89.4510 YCCC 2042.893655 3 0.0002 114 | 0/14
6 h-m-p 0.0006 0.0101 30.7644 CCC 2042.539527 2 0.0009 135 | 0/14
7 h-m-p 0.0004 0.0032 70.0764 YCCC 2041.996591 3 0.0007 157 | 0/14
8 h-m-p 0.0005 0.0027 74.4542 CYC 2041.898263 2 0.0001 177 | 0/14
9 h-m-p 0.0011 0.0079 9.6625 C 2041.885262 0 0.0003 194 | 0/14
10 h-m-p 0.0013 0.0462 2.0829 CC 2041.863449 1 0.0018 213 | 0/14
11 h-m-p 0.0007 0.0491 5.5596 ++YCCCC 2041.049850 4 0.0111 239 | 0/14
12 h-m-p 0.0005 0.0029 122.3827 CYC 2040.243345 2 0.0005 259 | 0/14
13 h-m-p 0.0038 0.0192 13.9408 +YYCCC 2035.142548 4 0.0123 283 | 0/14
14 h-m-p 0.0000 0.0002 455.7743 +YYCCC 2033.260166 4 0.0001 307 | 0/14
15 h-m-p 0.0002 0.0012 81.7098 CYC 2032.914664 2 0.0002 327 | 0/14
16 h-m-p 0.0322 1.0798 0.5355 ++CCCC 2024.539815 3 0.5851 352 | 0/14
17 h-m-p 1.0393 5.1965 0.2662 YCCC 2018.571338 3 1.6883 388 | 0/14
18 h-m-p 1.3569 6.7846 0.2694 CCCC 2013.878283 3 2.0691 425 | 0/14
19 h-m-p 0.8670 4.3349 0.1712 YCCC 2012.651447 3 1.7433 461 | 0/14
20 h-m-p 1.6000 8.0000 0.1115 CCC 2012.363957 2 1.5426 496 | 0/14
21 h-m-p 1.6000 8.0000 0.0768 CC 2012.286728 1 1.4851 529 | 0/14
22 h-m-p 1.6000 8.0000 0.0272 CC 2012.269551 1 1.5157 562 | 0/14
23 h-m-p 1.6000 8.0000 0.0045 CC 2012.265694 1 1.9488 595 | 0/14
24 h-m-p 1.6000 8.0000 0.0048 CC 2012.264416 1 1.9478 628 | 0/14
25 h-m-p 1.6000 8.0000 0.0015 C 2012.264017 0 1.6563 659 | 0/14
26 h-m-p 1.6000 8.0000 0.0013 C 2012.263932 0 1.6385 690 | 0/14
27 h-m-p 1.6000 8.0000 0.0001 C 2012.263928 0 1.3718 721 | 0/14
28 h-m-p 1.6000 8.0000 0.0000 Y 2012.263927 0 1.0614 752 | 0/14
29 h-m-p 1.6000 8.0000 0.0000 Y 2012.263927 0 1.2207 783 | 0/14
30 h-m-p 0.9279 8.0000 0.0000 C 2012.263927 0 0.9279 814 | 0/14
31 h-m-p 1.6000 8.0000 0.0000 Y 2012.263927 0 1.6000 845 | 0/14
32 h-m-p 1.6000 8.0000 0.0000 --------------Y 2012.263927 0 0.0000 890
Out..
lnL = -2012.263927
891 lfun, 3564 EigenQcodon, 19602 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
0.043036 0.037702 0.015828 0.003872 0.025226 0.404768 0.016353 0.056789 0.048112 0.048353 0.060224 3.202154 0.895777 0.226577 0.117163 1.300000
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
np = 16
lnL0 = -2023.125070
Iterating by ming2
Initial: fx= 2023.125070
x= 0.04304 0.03770 0.01583 0.00387 0.02523 0.40477 0.01635 0.05679 0.04811 0.04835 0.06022 3.20215 0.89578 0.22658 0.11716 1.30000
1 h-m-p 0.0000 0.0021 418.3225 +CYCCC 2021.248231 4 0.0000 29 | 0/16
2 h-m-p 0.0001 0.0011 132.1805 YCCC 2019.517860 3 0.0002 53 | 0/16
3 h-m-p 0.0002 0.0008 119.1145 +YCYCC 2016.903451 4 0.0005 79 | 0/16
4 h-m-p 0.0000 0.0002 305.6490 ++ 2013.735771 m 0.0002 98 | 1/16
5 h-m-p 0.0002 0.0009 101.1521 YC 2013.197041 1 0.0003 118 | 1/16
6 h-m-p 0.0002 0.0010 127.3770 CYC 2012.809170 2 0.0002 140 | 1/16
7 h-m-p 0.0013 0.0090 18.4520 CCC 2012.752292 2 0.0004 163 | 1/16
8 h-m-p 0.0004 0.0187 19.8529 +YCCC 2012.467852 3 0.0027 188 | 1/16
9 h-m-p 0.0003 0.0074 168.9814 +YCC 2011.565483 2 0.0010 211 | 1/16
10 h-m-p 0.0012 0.0062 25.1006 CC 2011.531201 1 0.0003 232 | 1/16
11 h-m-p 0.0014 0.0795 5.8766 CC 2011.504790 1 0.0019 253 | 0/16
12 h-m-p 0.0002 0.0165 48.4877 ++YCC 2011.136114 2 0.0029 277 | 0/16
13 h-m-p 0.0003 0.0034 448.2962 +YCCC 2010.218839 3 0.0008 302 | 0/16
14 h-m-p 0.0008 0.0039 198.7043 YCCC 2009.404280 3 0.0018 326 | 0/16
15 h-m-p 0.0623 0.3258 5.7003 CCCC 2008.748393 3 0.0649 351 | 0/16
16 h-m-p 0.0723 2.0894 5.1158 +CCCC 2004.894697 3 0.3746 377 | 0/16
17 h-m-p 0.6968 3.4842 0.8028 CCCC 2003.146226 3 0.8999 402 | 0/16
18 h-m-p 0.8550 8.0000 0.8450 CYCC 2002.731207 3 0.6201 442 | 0/16
19 h-m-p 1.6000 8.0000 0.3108 YCC 2002.497218 2 1.0149 480 | 0/16
20 h-m-p 1.6000 8.0000 0.1378 YC 2002.436281 1 1.2159 516 | 0/16
21 h-m-p 1.6000 8.0000 0.0517 YC 2002.428154 1 1.1414 552 | 0/16
22 h-m-p 1.6000 8.0000 0.0205 YC 2002.426601 1 1.2554 588 | 0/16
23 h-m-p 1.6000 8.0000 0.0035 C 2002.425909 0 1.7047 623 | 0/16
24 h-m-p 0.7079 8.0000 0.0084 +YC 2002.425687 1 1.9754 660 | 0/16
25 h-m-p 1.6000 8.0000 0.0080 YC 2002.425442 1 3.6235 696 | 0/16
26 h-m-p 1.6000 8.0000 0.0103 C 2002.425266 0 2.3803 731 | 0/16
27 h-m-p 1.6000 8.0000 0.0072 C 2002.425170 0 2.5296 766 | 0/16
28 h-m-p 1.6000 8.0000 0.0016 C 2002.425163 0 1.7936 801 | 0/16
29 h-m-p 1.6000 8.0000 0.0005 C 2002.425163 0 1.2948 836 | 0/16
30 h-m-p 1.6000 8.0000 0.0001 Y 2002.425163 0 1.1880 871 | 0/16
31 h-m-p 1.6000 8.0000 0.0000 C 2002.425163 0 1.2816 906 | 0/16
32 h-m-p 1.6000 8.0000 0.0000 Y 2002.425163 0 0.4000 941 | 0/16
33 h-m-p 0.3874 8.0000 0.0000 -------C 2002.425163 0 0.0000 983
Out..
lnL = -2002.425163
984 lfun, 5904 EigenQcodon, 32472 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2009.323393 S = -1849.936632 -152.767543
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 157 patterns 0:14
did 20 / 157 patterns 0:14
did 30 / 157 patterns 0:14
did 40 / 157 patterns 0:14
did 50 / 157 patterns 0:14
did 60 / 157 patterns 0:14
did 70 / 157 patterns 0:14
did 80 / 157 patterns 0:14
did 90 / 157 patterns 0:15
did 100 / 157 patterns 0:15
did 110 / 157 patterns 0:15
did 120 / 157 patterns 0:15
did 130 / 157 patterns 0:15
did 140 / 157 patterns 0:15
did 150 / 157 patterns 0:15
did 157 / 157 patterns 0:15
Time used: 0:15
Model 7: beta
TREE # 1
(1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
0.043036 0.037702 0.015828 0.003872 0.025226 0.404768 0.016353 0.056789 0.048112 0.048353 0.060224 3.585584 0.788041 1.396211
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
np = 14
lnL0 = -2028.799249
Iterating by ming2
Initial: fx= 2028.799249
x= 0.04304 0.03770 0.01583 0.00387 0.02523 0.40477 0.01635 0.05679 0.04811 0.04835 0.06022 3.58558 0.78804 1.39621
1 h-m-p 0.0000 0.0022 387.6541 +CYCCC 2027.360749 4 0.0000 27 | 0/14
2 h-m-p 0.0001 0.0012 102.0297 CYCC 2026.661971 3 0.0002 49 | 0/14
3 h-m-p 0.0002 0.0010 47.8826 CCCC 2026.451423 3 0.0002 72 | 0/14
4 h-m-p 0.0003 0.0055 40.5817 +CCC 2026.026788 2 0.0009 94 | 0/14
5 h-m-p 0.0005 0.0024 65.1089 YYC 2025.766969 2 0.0004 113 | 0/14
6 h-m-p 0.0002 0.0012 51.6146 YCC 2025.704207 2 0.0001 133 | 0/14
7 h-m-p 0.0006 0.0336 12.2867 +YC 2025.605802 1 0.0018 152 | 0/14
8 h-m-p 0.0002 0.0083 93.4188 +YCCCC 2024.763625 4 0.0019 177 | 0/14
9 h-m-p 0.0004 0.0021 295.5938 YCCC 2024.507467 3 0.0002 199 | 0/14
10 h-m-p 0.0012 0.0061 35.2218 CYC 2024.470626 2 0.0003 219 | 0/14
11 h-m-p 0.0007 0.0781 14.9598 ++CCC 2023.943731 2 0.0127 242 | 0/14
12 h-m-p 0.0003 0.0014 732.5921 CYCYCC 2022.322303 5 0.0006 268 | 0/14
13 h-m-p 0.0017 0.0087 12.0141 YC 2022.311493 1 0.0003 286 | 0/14
14 h-m-p 0.0010 0.2546 3.9979 +++CYYCYYYYCC 2013.935709 10 0.2377 321 | 0/14
15 h-m-p 0.0000 0.0000 6965991.7799 YCC 2013.927428 2 0.0000 341 | 0/14
16 h-m-p 0.0081 1.1062 0.2704 +++YYCCCCC 2013.396222 6 0.5645 371 | 0/14
17 h-m-p 0.2988 1.6838 0.5109 YCC 2013.100179 2 0.1879 405 | 0/14
18 h-m-p 1.6000 8.0000 0.0383 YC 2013.087525 1 0.7936 437 | 0/14
19 h-m-p 1.6000 8.0000 0.0031 YC 2013.086717 1 0.7222 469 | 0/14
20 h-m-p 1.6000 8.0000 0.0008 ------------Y 2013.086717 0 0.0000 512
Out..
lnL = -2013.086717
513 lfun, 10260 EigenQcodon, 56430 P(t)
Time used: 0:30
Model 8: beta&w>1
TREE # 1
(1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
0.043036 0.037702 0.015828 0.003872 0.025226 0.404768 0.016353 0.056789 0.048112 0.048353 0.060224 2.788029 0.900000 0.255439 1.114990 1.300000
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
np = 16
lnL0 = -2016.073070
Iterating by ming2
Initial: fx= 2016.073070
x= 0.04304 0.03770 0.01583 0.00387 0.02523 0.40477 0.01635 0.05679 0.04811 0.04835 0.06022 2.78803 0.90000 0.25544 1.11499 1.30000
1 h-m-p 0.0000 0.0015 337.4440 +CYC 2014.836428 2 0.0000 25 | 0/16
2 h-m-p 0.0001 0.0014 107.6340 YCCC 2013.706974 3 0.0002 49 | 0/16
3 h-m-p 0.0001 0.0007 92.0296 YCCCC 2012.782861 4 0.0003 75 | 0/16
4 h-m-p 0.0002 0.0024 153.5120 YCCC 2011.337701 3 0.0004 99 | 0/16
5 h-m-p 0.0006 0.0029 51.7303 YYCC 2010.988664 3 0.0004 122 | 0/16
6 h-m-p 0.0005 0.0084 44.9289 CCC 2010.628435 2 0.0007 145 | 0/16
7 h-m-p 0.0003 0.0029 115.2675 +YCCC 2009.716736 3 0.0008 170 | 0/16
8 h-m-p 0.0008 0.0041 30.2617 YCCC 2009.614677 3 0.0005 194 | 0/16
9 h-m-p 0.0004 0.0087 35.8115 +CC 2009.326985 1 0.0014 216 | 0/16
10 h-m-p 0.0002 0.0014 233.0898 CCCC 2008.929272 3 0.0003 241 | 0/16
11 h-m-p 0.0014 0.0071 26.9767 CCC 2008.877464 2 0.0004 264 | 0/16
12 h-m-p 0.0006 0.0385 19.8799 +YCC 2008.559560 2 0.0044 287 | 0/16
13 h-m-p 0.0003 0.0056 338.3090 +YCYCCC 2004.977916 5 0.0026 315 | 0/16
14 h-m-p 0.0007 0.0036 78.8804 YCC 2004.888383 2 0.0003 337 | 0/16
15 h-m-p 0.0108 4.1970 2.3189 ++CYC 2004.285965 2 0.1956 361 | 0/16
16 h-m-p 0.7043 5.7084 0.6440 YCCCC 2003.063085 4 1.6316 387 | 0/16
17 h-m-p 1.6000 8.0000 0.3029 YCC 2002.786853 2 0.9093 425 | 0/16
18 h-m-p 0.7075 8.0000 0.3893 CC 2002.653687 1 0.6957 462 | 0/16
19 h-m-p 1.1798 8.0000 0.2296 CCCC 2002.532618 3 1.3804 503 | 0/16
20 h-m-p 1.6000 8.0000 0.1036 CY 2002.443575 1 1.6903 540 | 0/16
21 h-m-p 1.6000 8.0000 0.0533 YC 2002.437931 1 1.0407 576 | 0/16
22 h-m-p 1.6000 8.0000 0.0082 C 2002.437554 0 1.3036 611 | 0/16
23 h-m-p 1.6000 8.0000 0.0062 ++ 2002.436835 m 8.0000 646 | 0/16
24 h-m-p 1.6000 8.0000 0.0258 ++ 2002.431938 m 8.0000 681 | 0/16
25 h-m-p 0.5727 5.8356 0.3606 CYC 2002.426104 2 1.1048 719 | 0/16
26 h-m-p 1.6000 8.0000 0.1597 CCC 2002.419537 2 1.8828 758 | 0/16
27 h-m-p 1.6000 8.0000 0.0837 YC 2002.416408 1 0.8383 794 | 0/16
28 h-m-p 1.2615 8.0000 0.0557 C 2002.415465 0 1.2615 829 | 0/16
29 h-m-p 1.6000 8.0000 0.0361 Y 2002.415412 0 0.3151 864 | 0/16
30 h-m-p 0.6694 8.0000 0.0170 C 2002.415365 0 0.9968 899 | 0/16
31 h-m-p 1.6000 8.0000 0.0021 C 2002.415363 0 1.3928 934 | 0/16
32 h-m-p 1.6000 8.0000 0.0001 C 2002.415363 0 1.5154 969 | 0/16
33 h-m-p 1.6000 8.0000 0.0000 Y 2002.415363 0 1.2138 1004 | 0/16
34 h-m-p 1.1809 8.0000 0.0000 C 2002.415363 0 1.1809 1039 | 0/16
35 h-m-p 1.6000 8.0000 0.0000 C 2002.415363 0 1.6000 1074 | 0/16
36 h-m-p 1.6000 8.0000 0.0000 ----C 2002.415363 0 0.0020 1113
Out..
lnL = -2002.415363
1114 lfun, 24508 EigenQcodon, 134794 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2009.009454 S = -1849.992062 -153.359584
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 157 patterns 1:07
did 20 / 157 patterns 1:07
did 30 / 157 patterns 1:08
did 40 / 157 patterns 1:08
did 50 / 157 patterns 1:08
did 60 / 157 patterns 1:08
did 70 / 157 patterns 1:08
did 80 / 157 patterns 1:08
did 90 / 157 patterns 1:09
did 100 / 157 patterns 1:09
did 110 / 157 patterns 1:09
did 120 / 157 patterns 1:09
did 130 / 157 patterns 1:09
did 140 / 157 patterns 1:10
did 150 / 157 patterns 1:10
did 157 / 157 patterns 1:10
Time used: 1:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=267
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT
** * :.*** ** **: *****.****: ***.***. :*.**** ***
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGR-HAEYWNGQKDVLEDR
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDVLEDE
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRPDAEYWNSQKDLLERR
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDILERR
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDR
* ** :** ***:** ***************** .*****.***.** .
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 RAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 RAEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSG
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 RASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 RAEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 RAAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNG
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 RAAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNG
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 RAAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG
** *** ***** : : * * *** *******::**.***********.*
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 FYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 FYPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVY
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVY
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 FYPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVY
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY
***..***:****.***::********:*****:* ********:*****
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 SCEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYF
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 TCQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 TCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYF
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF
:*:* ***: *:******:***********:********** **:***
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 KNQKGHSGLHPTGLVS-
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 RNQKGHSGLQPTGLLNo
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 KNQKGHSGLHPTGLVS-
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 RNQKGHSGLQPTGLLS-
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 KNQKGHSGLHPTGLVS-
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 RNQKGHSGLQPTGLVS-
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 RNQKGHSGLQPTGLLS-
:********:****:.
>Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAAAGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGCAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTTCCTGCACAGAGACATCTATAACCAAGAGGAGGACTT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCTGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGG CGCGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGGTGAGAG CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACAGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG GAGAGCACAGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTATTCATCTACTTC AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC-- - >Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 ATGGTGCACCTGTGGTTCCCTGGAGGGTCCTGGATGGCAGCTCTGACAAT GATACTGATGGTGCTGAGCCCTCCCCTGGCTTTGGCTACGGACACCCGCC CGCGTTTCCTGGAACTGAATAAATTTGAGTGTCATTTCTCCAACGGGACG GAGGGGGTGCGGTTCGTGCACAGAAAAATCTACAACCGGGAGGAGGTCGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GG---CACGCCGAGTACTGGAACGGGCAGAAGGACGTCCTGGAGGACCGA CGGGCTGAGGTGGACACGGTGTGCAGACACAACTACGAGATTTCCGATAG ATTCCTGGTGCCGCGGCGAGTTCTGCCTAAGGTAACCGTGTACCCTACAA AGACCCAGCCCCTGCAACACCACAACCTCCTGGTCTGCTCTGTGAGTGGT TTCTATCCAGGCAACATCGAAGTCAAGTGGTTCCGGAATGGCCAGGAAGA GGAGGCTGGAGTGGTCTCCACAGGCCTGATCCAGAATGGAGACTGGACCT ACCAGATCTTAGTGATGCTTGAAACAGTTCCTCAGAGTGGAGAGGTGTAC AGCTGTGAAGTGGGGCACCCAAGTCTGATGAGCCCTGTCACAGTGGAATG GAGGGCACAGTCTGAGTCTGCACAGAGCAAGATGCTGAGTGGAATTGGAG GCTTTGTACTGGGCCTGCTCTTCCTCGTGATAGGTCTGCTCATCTACTTC AGGAATCAGAAAGGGCACTCTGGACTTCAGCCAACAGGACTCCTGAAC-- - >Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGTGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGAAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTATCTGCACAGAGACATCTATAACCAAGAGGAGGACTT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACGTCCTGGAAGACGAG CGGGCCTCGGTGGACACCTATTGCAGACACAACTACGGGGTTGTGGAGAG CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA GGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATTCAGAATGGAGACTGGACCT TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCAGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACGATCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTATTCATCTACTTC AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC-- - >Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 ATGGTGTGTCTGAAGCTCCCTGGAGGCTCCTGCATGGCAGCTCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGACTGGGGACACCCGAC CACGTTTCTTGAAGCAGGAAAAGTTTGAGTGTCACTTCTTCAACGGGACG GAGCGGGTGCGGTTGCTGCACAGATACATCTATAACCAAGAGGAGGACGC GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACCTCCTGGAGCGGAGG CGGGCCGAGGTGGACACCTACTGCAGACACAACTATGGGGTTGTGGAGAG CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTAACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGAAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACCAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCCGCACAGAGCAAGATGCTGAGTGGAGTTGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACTCTGGACTTCAACCAACAGGACTCCTGAGC-- - >Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 ATGGTGTGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGTGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGAAGCAGGATAAGTATGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTATCTGCACAGAGACATCTATAACCAAGAGGAGAACGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGCGGAGG CGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGCTGAGAG CTTCACAGTGCAGCGGCGAGTCCACCCTAAGGTGACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACCT TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGATGAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCCGGGCTGTTCATCTACTTC AAGAATCAGAAAGGGCACTCTGGACTTCACCCAACAGGACTCGTGAGC-- - >Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 ATGGTATGTCTGAAGCTCCCTGGAGGTTCCTACATGGCAGCGCTGACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAT CACGTTTCTTGAGACAGGATAAGTATGAGTGTCATTTCTTCAACGGGACC GAGCGGGTGCGGTTCCTGCACAGAGGCATCTATAACCAAGAAGAGAACGT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACTTCCTGGAAGACAGG CGGGCCGCGGTGGACACCTTCTGCAGACACAACTACGGGGTTGTGGAGAG CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTGACTGTGTATCCTGCAA AGACCCAGACCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAATGGT TTCTATCCAGACAGCATTGAAGTCAGGTGGTTCCGGAACGGCCAGGAAGA GAAGACTGGGGTGGTGTCCACAGGCCTGATCCAGAATGGAGACTGGACTT TCCAGATTCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCAAGCGTGACGAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCTGCACAGAGCAAGATGCTGAGTGGAGTCGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGACCGGGCTGTTCATCTACTTC AGGAATCAGAAAGGGCACTCTGGACTTCAGCCAACAGGACTCGTGAGC-- - >Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 ATGGTGTGTCTGAAGCTCTCTGGAGGCTCCTGCATGGCAGCTCTCACAGT GACACTGATGGTGCTGAGCTCCCCACTGGCTTTGGCTGGGGACACCCGAC CACGTTTCTTGAAGCAGGATAAGCATGAGTGTCATTTCTTCAACGGGACG GAGCGGGTGCGGTACCTGCACAGAGACATCTACAACCAAGAGGAAGACTT GCGCTTCGACAGCGACGTGGGGGAGTACCGGGCGGTGACGGAGCTGGGGC GGCCTGACGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAAGACAGG CGGGCCGCGGTGGACACCTACTGCAGACACAACTACGGGGTTGTGGAGAG CTTCACAGTGCAGCGGCGAGTTGAGCCTAAGGTAACTGTGTATCCTGCAA AGACCCAGCCCCTGCAGCACCACAACCTCCTGGTCTGCTCTGTGAACGGT TTCTATCCAGGCAGCATTGAAGTCAGGTGGTTCCGGAATGGCCAGGAAGA GAAGGCTGGGGTGGTGTCCACAGGCCTGATCCACAATGGAGACTGGACCT TCCAGACCCTGGTGATGCTGGAAACAGTTCCTCGGAGTGGAGAGGTTTAC ACCTGCCAAGTGGAGCACCCGAGCGTGACAAGCCCTCTCACAGTGGAATG GAGAGCACGGTCTGAATCCGCACAGAGCAAGATGCTGAGTGGAGTTGGGG GCTTTGTGCTGGGCCTGCTCTTCCTTGGGGCTGGGCTGTTCATCTACTTC AGGAATCAGAAAGGACACTCTGGACTTCAACCAACAGGACTCCTGAGC-- -
>Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5 MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGT ERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR RAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG FYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVY TCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAGLFIYF KNQKGHSGLHPTGLVS >Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 MVHLWFPGGSWMAALTMILMVLSPPLALATDTRPRFLELNKFECHFSNGT EGVRFVHRKIYNREEVVRFDSDVGEYRAVTELGR-HAEYWNGQKDVLEDR RAEVDTVCRHNYEISDRFLVPRRVLPKVTVYPTKTQPLQHHNLLVCSVSG FYPGNIEVKWFRNGQEEEAGVVSTGLIQNGDWTYQILVMLETVPQSGEVY SCEVGHPSLMSPVTVEWRAQSESAQSKMLSGIGGFVLGLLFLVIGLLIYF RNQKGHSGLQPTGLLN >Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDVLEDE RASVDTYCRHNYGVVESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPQSGEVY TCQVEHPSVTIPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF KNQKGHSGLHPTGLVS >Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 MVCLKLPGGSCMAALTVTLMVLSSPLALTGDTRPRFLKQEKFECHFFNGT ERVRLLHRYIYNQEEDARFDSDVGEYRAVTELGRPDAEYWNSQKDLLERR RAEVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHSGLQPTGLLS >Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 MVCLKLPGGSYMAVLTVTLMVLSSPLALAGDTRPRFLKQDKYECHFFNGT ERVRYLHRDIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDILERR RAAVDTYCRHNYGVAESFTVQRRVHPKVTVYPAKTQPLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQILVMLETVPRSGEVY TCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF KNQKGHSGLHPTGLVS >Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 MVCLKLPGGSYMAALTVTLMVLSSPLALAGDTRSRFLRQDKYECHFFNGT ERVRFLHRGIYNQEENVRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDR RAAVDTFCRHNYGVVESFTVQRRVEPKVTVYPAKTQTLQHHNLLVCSVNG FYPDSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQILVMLETVPRSGEVY TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGTGLFIYF RNQKGHSGLQPTGLVS >Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 MVCLKLSGGSCMAALTVTLMVLSSPLALAGDTRPRFLKQDKHECHFFNGT ERVRYLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDILEDR RAAVDTYCRHNYGVVESFTVQRRVEPKVTVYPAKTQPLQHHNLLVCSVNG FYPGSIEVRWFRNGQEEKAGVVSTGLIHNGDWTFQTLVMLETVPRSGEVY TCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYF RNQKGHSGLQPTGLLS
#NEXUS
[ID: 3459631009]
begin trees;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5:0.020274,Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235:0.013398,(((Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988:0.226873,(Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711:0.024816,Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885:0.017314)0.51:0.007844)0.99:0.018984,Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5:0.022298)0.53:0.004981,Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477:0.023525)0.96:0.007991);
[Note: This tree contains information only on the topology
and branch lengths (mean of the posterior probability density).]
tree con_50_majrule = (Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5:0.020274,Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235:0.013398,(((Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988:0.226873,(Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711:0.024816,Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885:0.017314):0.007844):0.018984,Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5:0.022298):0.004981,Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477:0.023525):0.007991);
end;
Estimated marginal likelihoods for runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2070.09 -2086.67
2 -2070.24 -2083.84
--------------------------------------
TOTAL -2070.16 -2086.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Summaries are based on a total of 15002 samples from 2 runs)
(Each run produced 10001 samples of which 7501 samples were included)
95% Cred. Interval
----------------------
Parameter Mean Variance Lower Upper Median PSRF *
---------------------------------------------------------------------------------------------
TL{all} 0.387002 0.002772 0.302000 0.506000 0.381000 1.002
r(A<->C){all} 0.063303 0.000621 0.021490 0.117950 0.060938 1.000
r(A<->G){all} 0.298973 0.001963 0.216633 0.390808 0.297989 1.000
r(A<->T){all} 0.103916 0.001019 0.049369 0.171716 0.101087 1.001
r(C<->G){all} 0.097919 0.000523 0.057623 0.147252 0.096397 1.000
r(C<->T){all} 0.366160 0.002758 0.268401 0.474117 0.364419 1.000
r(G<->T){all} 0.069729 0.000452 0.033963 0.117084 0.067622 1.000
pi(A){all} 0.223771 0.000189 0.197390 0.251420 0.223506 1.000
pi(C){all} 0.252485 0.000208 0.224846 0.281379 0.252357 1.000
pi(G){all} 0.319789 0.000228 0.290485 0.349826 0.319538 1.000
pi(T){all} 0.203956 0.000181 0.178250 0.231141 0.203611 1.000
alpha{1,2} 28.031627 2721.559097 0.308864 180.764229 1.105597 1.012
alpha{3} 101.990667 3266.394053 6.809541 195.003643 100.976671 1.000
pinvar{all} 0.607037 0.006145 0.427042 0.720997 0.620129 1.007
---------------------------------------------------------------------------------------------
* Convergence diagnostic (PSRF = Potential scale reduction factor [Gelman
and Rubin, 1992], uncorrected) should approach 1 as runs converge. The
values may be unreliable if you have a small number of samples. PSRF should
only be used as a rough guide to convergence since all the assumptions
that allow one to interpret it as a scale reduction factor are not met in
the phylogenetic context.
CODONML (in paml version 4.5, December 2011) /home/jorge/Data/ADOPS/HLA/HLA-DRB5/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 265
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------
Phe TTT 1 2 1 2 1 1 | Ser TCT 4 4 4 3 4 4 | Tyr TAT 4 1 6 4 5 4 | Cys TGT 2 2 2 2 2 2
TTC 13 10 11 11 11 14 | TCC 3 4 3 4 3 3 | TAC 7 8 6 6 7 6 | TGC 3 2 3 4 3 3
Leu TTA 0 1 0 0 0 0 | TCA 0 0 0 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 1 3 3 2 2 | TCG 0 0 1 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 4 6 4 4 4 4
--------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 5 6 5 5 5 5 | His CAT 1 1 1 0 1 1 | Arg CGT 1 1 1 1 1 1
CTC 5 5 5 6 5 5 | CCC 0 2 0 1 1 0 | CAC 7 8 7 8 8 6 | CGC 2 2 1 1 1 1
CTA 1 0 1 0 0 0 | CCA 5 3 5 5 5 4 | Gln CAA 2 1 2 3 2 2 | CGA 3 2 2 3 2 2
CTG 16 20 16 18 17 17 | CCG 0 2 0 0 0 0 | CAG 12 10 11 9 10 11 | CGG 6 7 8 9 10 9
--------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 3 1 2 2 | Thr ACT 1 0 1 2 1 3 | Asn AAT 3 4 3 3 4 3 | Ser AGT 2 4 2 2 2 2
ATC 2 5 3 3 4 3 | ACC 7 4 6 7 5 7 | AAC 6 7 6 6 6 7 | AGC 10 5 8 9 9 9
ATA 0 2 0 0 0 0 | ACA 7 6 7 7 7 7 | Lys AAA 1 3 1 1 1 1 | Arg AGA 3 3 3 3 3 4
Met ATG 5 7 5 5 6 5 | ACG 3 4 3 2 2 2 | AAG 8 5 8 8 9 7 | AGG 3 2 2 3 2 3
--------------------------------------------------------------------------------------------------------------
Val GTT 4 2 4 5 3 4 | Ala GCT 4 5 3 3 4 2 | Asp GAT 1 1 1 0 1 1 | Gly GGT 3 2 2 1 2 2
GTC 3 6 4 2 4 3 | GCC 2 1 3 3 2 2 | GAC 10 7 10 8 8 9 | GGC 4 5 5 6 5 5
GTA 0 2 0 1 0 1 | GCA 4 3 4 4 4 4 | Glu GAA 6 6 6 6 5 7 | GGA 6 8 6 7 6 6
GTG 19 18 21 18 21 20 | GCG 2 1 1 2 3 3 | GAG 12 14 13 14 12 11 | GGG 10 8 10 9 10 10
--------------------------------------------------------------------------------------------------------------
--------------------------------------------------
Phe TTT 1 | Ser TCT 4 | Tyr TAT 2 | Cys TGT 2
TTC 11 | TCC 4 | TAC 8 | TGC 4
Leu TTA 0 | TCA 0 | *** TAA 0 | *** TGA 0
TTG 3 | TCG 0 | TAG 0 | Trp TGG 4
--------------------------------------------------
Leu CTT 2 | Pro CCT 4 | His CAT 2 | Arg CGT 1
CTC 6 | CCC 1 | CAC 7 | CGC 1
CTA 0 | CCA 4 | Gln CAA 3 | CGA 2
CTG 17 | CCG 1 | CAG 9 | CGG 9
--------------------------------------------------
Ile ATT 1 | Thr ACT 1 | Asn AAT 3 | Ser AGT 2
ATC 4 | ACC 6 | AAC 6 | AGC 9
ATA 0 | ACA 8 | Lys AAA 1 | Arg AGA 3
Met ATG 5 | ACG 2 | AAG 8 | AGG 3
--------------------------------------------------
Val GTT 5 | Ala GCT 5 | Asp GAT 1 | Gly GGT 1
GTC 2 | GCC 2 | GAC 10 | GGC 6
GTA 1 | GCA 4 | Glu GAA 7 | GGA 7
GTG 18 | GCG 2 | GAG 11 | GGG 9
--------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5
position 1: T:0.16604 C:0.25660 A:0.23774 G:0.33962
position 2: T:0.28679 C:0.17736 A:0.30189 G:0.23396
position 3: T:0.15094 C:0.31698 A:0.14340 G:0.38868
Average T:0.20126 C:0.25031 A:0.22767 G:0.32075
#2: Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988
position 1: T:0.15472 C:0.27170 A:0.23774 G:0.33585
position 2: T:0.32075 C:0.16981 A:0.28679 G:0.22264
position 3: T:0.14717 C:0.30566 A:0.15094 G:0.39623
Average T:0.20755 C:0.24906 A:0.22516 G:0.31824
#3: Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235
position 1: T:0.16604 C:0.25283 A:0.23019 G:0.35094
position 2: T:0.29811 C:0.17358 A:0.30566 G:0.22264
position 3: T:0.15472 C:0.30566 A:0.13962 G:0.40000
Average T:0.20629 C:0.24403 A:0.22516 G:0.32453
#4: Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711
position 1: T:0.16226 C:0.26792 A:0.23396 G:0.33585
position 2: T:0.29057 C:0.18113 A:0.28679 G:0.24151
position 3: T:0.13585 C:0.32075 A:0.15094 G:0.39245
Average T:0.19623 C:0.25660 A:0.22390 G:0.32327
#5: Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5
position 1: T:0.15849 C:0.26415 A:0.23774 G:0.33962
position 2: T:0.29434 C:0.17358 A:0.29811 G:0.23396
position 3: T:0.15094 C:0.30943 A:0.13208 G:0.40755
Average T:0.20126 C:0.24906 A:0.22264 G:0.32704
#6: Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477
position 1: T:0.16604 C:0.24906 A:0.24528 G:0.33962
position 2: T:0.29811 C:0.17736 A:0.28679 G:0.23774
position 3: T:0.14717 C:0.31321 A:0.14717 G:0.39245
Average T:0.20377 C:0.24654 A:0.22642 G:0.32327
#7: Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885
position 1: T:0.16226 C:0.26038 A:0.23396 G:0.34340
position 2: T:0.28679 C:0.18113 A:0.29434 G:0.23774
position 3: T:0.13962 C:0.32830 A:0.15094 G:0.38113
Average T:0.19623 C:0.25660 A:0.22642 G:0.32075
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 9 | Ser S TCT 27 | Tyr Y TAT 26 | Cys C TGT 14
TTC 81 | TCC 24 | TAC 48 | TGC 22
Leu L TTA 1 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 17 | TCG 1 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 14 | Pro P CCT 35 | His H CAT 7 | Arg R CGT 7
CTC 37 | CCC 5 | CAC 51 | CGC 9
CTA 2 | CCA 31 | Gln Q CAA 15 | CGA 16
CTG 121 | CCG 3 | CAG 72 | CGG 58
------------------------------------------------------------------------------
Ile I ATT 13 | Thr T ACT 9 | Asn N AAT 23 | Ser S AGT 16
ATC 24 | ACC 42 | AAC 44 | AGC 59
ATA 2 | ACA 49 | Lys K AAA 9 | Arg R AGA 22
Met M ATG 38 | ACG 18 | AAG 53 | AGG 18
------------------------------------------------------------------------------
Val V GTT 27 | Ala A GCT 26 | Asp D GAT 6 | Gly G GGT 13
GTC 24 | GCC 15 | GAC 62 | GGC 36
GTA 5 | GCA 27 | Glu E GAA 43 | GGA 46
GTG 135 | GCG 14 | GAG 87 | GGG 66
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16226 C:0.26038 A:0.23666 G:0.34070
position 2: T:0.29650 C:0.17628 A:0.29434 G:0.23288
position 3: T:0.14663 C:0.31429 A:0.14501 G:0.39407
Average T:0.20180 C:0.25031 A:0.22534 G:0.32255
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5
Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988 0.4485 (0.1281 0.2857)
Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235 0.6437 (0.0237 0.0368) 0.4780 (0.1297 0.2714)
Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711 0.5325 (0.0430 0.0807) 0.4535 (0.1221 0.2692) 0.5506 (0.0457 0.0830)
Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5 0.5636 (0.0315 0.0559) 0.4463 (0.1215 0.2723) 0.6289 (0.0281 0.0446) 0.4771 (0.0369 0.0773)
Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477 0.4704 (0.0315 0.0670) 0.4319 (0.1212 0.2807) 0.7222 (0.0342 0.0473) 0.4040 (0.0404 0.1000) 0.5465 (0.0333 0.0609)
Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885 0.2775 (0.0298 0.1072) 0.4524 (0.1209 0.2672) 0.2793 (0.0289 0.1036) 0.3733 (0.0247 0.0661) 0.2964 (0.0307 0.1035) 0.2664 (0.0307 0.1152)
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
lnL(ntime: 11 np: 14): -2012.263927 +0.000000
8..1 8..3 8..9 9..10 10..11 11..2 11..12 12..4 12..7 10..5 9..6
0.048395 0.036922 0.019480 0.011400 0.037712 0.487976 0.016742 0.067633 0.043612 0.058680 0.058834 3.202154 0.639116 0.024374
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.88739
(1: 0.048395, 3: 0.036922, (((2: 0.487976, (4: 0.067633, 7: 0.043612): 0.016742): 0.037712, 5: 0.058680): 0.011400, 6: 0.058834): 0.019480);
(Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5: 0.048395, Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235: 0.036922, (((Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988: 0.487976, (Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711: 0.067633, Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885: 0.043612): 0.016742): 0.037712, Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5: 0.058680): 0.011400, Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477: 0.058834): 0.019480);
Detailed output identifying parameters
kappa (ts/tv) = 3.20215
dN/dS (w) for site classes (K=2)
p: 0.63912 0.36088
w: 0.02437 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.048 598.0 197.0 0.3765 0.0114 0.0304 6.8 6.0
8..3 0.037 598.0 197.0 0.3765 0.0087 0.0232 5.2 4.6
8..9 0.019 598.0 197.0 0.3765 0.0046 0.0122 2.8 2.4
9..10 0.011 598.0 197.0 0.3765 0.0027 0.0072 1.6 1.4
10..11 0.038 598.0 197.0 0.3765 0.0089 0.0237 5.3 4.7
11..2 0.488 598.0 197.0 0.3765 0.1153 0.3063 69.0 60.3
11..12 0.017 598.0 197.0 0.3765 0.0040 0.0105 2.4 2.1
12..4 0.068 598.0 197.0 0.3765 0.0160 0.0425 9.6 8.4
12..7 0.044 598.0 197.0 0.3765 0.0103 0.0274 6.2 5.4
10..5 0.059 598.0 197.0 0.3765 0.0139 0.0368 8.3 7.3
9..6 0.059 598.0 197.0 0.3765 0.0139 0.0369 8.3 7.3
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
lnL(ntime: 11 np: 16): -2002.425163 +0.000000
8..1 8..3 8..9 9..10 10..11 11..2 11..12 12..4 12..7 10..5 9..6
0.051864 0.035515 0.018943 0.010982 0.039177 0.570191 0.017992 0.071877 0.043368 0.058446 0.062891 3.585584 0.760218 0.154977 0.123618 4.583541
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.98125
(1: 0.051864, 3: 0.035515, (((2: 0.570191, (4: 0.071877, 7: 0.043368): 0.017992): 0.039177, 5: 0.058446): 0.010982, 6: 0.062891): 0.018943);
(Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5: 0.051864, Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235: 0.035515, (((Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988: 0.570191, (Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711: 0.071877, Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885: 0.043368): 0.017992): 0.039177, Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5: 0.058446): 0.010982, Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477: 0.062891): 0.018943);
Detailed output identifying parameters
kappa (ts/tv) = 3.58558
dN/dS (w) for site classes (K=3)
p: 0.76022 0.15498 0.08480
w: 0.12362 1.00000 4.58354
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.052 595.6 199.4 0.6377 0.0151 0.0237 9.0 4.7
8..3 0.036 595.6 199.4 0.6377 0.0104 0.0162 6.2 3.2
8..9 0.019 595.6 199.4 0.6377 0.0055 0.0087 3.3 1.7
9..10 0.011 595.6 199.4 0.6377 0.0032 0.0050 1.9 1.0
10..11 0.039 595.6 199.4 0.6377 0.0114 0.0179 6.8 3.6
11..2 0.570 595.6 199.4 0.6377 0.1664 0.2609 99.1 52.0
11..12 0.018 595.6 199.4 0.6377 0.0052 0.0082 3.1 1.6
12..4 0.072 595.6 199.4 0.6377 0.0210 0.0329 12.5 6.6
12..7 0.043 595.6 199.4 0.6377 0.0127 0.0198 7.5 4.0
10..5 0.058 595.6 199.4 0.6377 0.0171 0.0267 10.2 5.3
9..6 0.063 595.6 199.4 0.6377 0.0183 0.0288 10.9 5.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.593 3.085
14 K 0.962* 4.446
38 Q 0.647 3.312
42 Y 0.929 4.329
55 F 0.963* 4.451
59 D 0.885 4.171
66 D 0.730 3.610
67 L 0.847 4.030
95 F 0.961* 4.442
98 D 0.992** 4.554
99 R 0.641 3.255
102 A 0.727 3.599
106 Y 0.939 4.363
114 G 0.961* 4.442
118 T 0.733 3.607
124 E 0.906 4.248
185 T 0.580 3.035
243 A 0.786 3.812
259 H 0.536 2.870
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
14 K 0.939 5.211 +- 2.037
38 Q 0.517 2.982 +- 2.230
42 Y 0.897 5.014 +- 2.172
55 F 0.949 5.278 +- 2.013
59 D 0.787 4.346 +- 2.291
66 D 0.595 3.358 +- 2.306
67 L 0.798 4.527 +- 2.395
95 F 0.943 5.246 +- 2.030
98 D 0.989* 5.475 +- 1.846
99 R 0.530 3.083 +- 2.368
102 A 0.595 3.367 +- 2.316
106 Y 0.897 4.986 +- 2.148
114 G 0.941 5.235 +- 2.035
118 T 0.629 3.585 +- 2.429
124 E 0.821 4.530 +- 2.253
243 A 0.662 3.705 +- 2.351
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.443 0.513 0.044 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.000 0.041 0.180 0.211 0.214 0.158 0.096 0.054 0.030 0.017
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.042 0.118
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.018 0.243 0.056
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.053 0.214 0.011
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.033 0.126 0.064 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:15
Model 7: beta (10 categories)
TREE # 1: (1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
lnL(ntime: 11 np: 14): -2013.086717 +0.000000
8..1 8..3 8..9 9..10 10..11 11..2 11..12 12..4 12..7 10..5 9..6
0.048067 0.035745 0.019180 0.011266 0.036278 0.477426 0.016734 0.065300 0.043249 0.058723 0.057887 2.788029 0.033203 0.048920
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.86986
(1: 0.048067, 3: 0.035745, (((2: 0.477426, (4: 0.065300, 7: 0.043249): 0.016734): 0.036278, 5: 0.058723): 0.011266, 6: 0.057887): 0.019180);
(Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5: 0.048067, Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235: 0.035745, (((Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988: 0.477426, (Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711: 0.065300, Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885: 0.043249): 0.016734): 0.036278, Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5: 0.058723): 0.011266, Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477: 0.057887): 0.019180);
Detailed output identifying parameters
kappa (ts/tv) = 2.78803
Parameters in M7 (beta):
p= 0.03320 q= 0.04892
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00020 0.07779 0.95241 0.99995 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.048 601.1 193.9 0.4030 0.0118 0.0292 7.1 5.7
8..3 0.036 601.1 193.9 0.4030 0.0088 0.0217 5.3 4.2
8..9 0.019 601.1 193.9 0.4030 0.0047 0.0117 2.8 2.3
9..10 0.011 601.1 193.9 0.4030 0.0028 0.0068 1.7 1.3
10..11 0.036 601.1 193.9 0.4030 0.0089 0.0220 5.3 4.3
11..2 0.477 601.1 193.9 0.4030 0.1169 0.2901 70.3 56.3
11..12 0.017 601.1 193.9 0.4030 0.0041 0.0102 2.5 2.0
12..4 0.065 601.1 193.9 0.4030 0.0160 0.0397 9.6 7.7
12..7 0.043 601.1 193.9 0.4030 0.0106 0.0263 6.4 5.1
10..5 0.059 601.1 193.9 0.4030 0.0144 0.0357 8.6 6.9
9..6 0.058 601.1 193.9 0.4030 0.0142 0.0352 8.5 6.8
Time used: 0:30
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 3, (((2, (4, 7)), 5), 6)); MP score: 162
lnL(ntime: 11 np: 16): -2002.415363 +0.000000
8..1 8..3 8..9 9..10 10..11 11..2 11..12 12..4 12..7 10..5 9..6
0.051789 0.035544 0.018950 0.010965 0.039116 0.568814 0.017929 0.071797 0.043327 0.058437 0.062766 3.582838 0.906592 0.445292 1.333023 4.393421
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.97943
(1: 0.051789, 3: 0.035544, (((2: 0.568814, (4: 0.071797, 7: 0.043327): 0.017929): 0.039116, 5: 0.058437): 0.010965, 6: 0.062766): 0.018950);
(Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5: 0.051789, Gorilla_gorilla_gorilla_Hominidae_Haplorrhini_XP_018884633.1_LOC101131235: 0.035544, (((Carlito_syrichta_Tarsiidae_Haplorrhini_XP_008063736.1_LOC103267988: 0.568814, (Mandrillus_leucophaeus_Cercopithecidae_Haplorrhini_XP_011832740.1_LOC105537711: 0.071797, Rhinopithecus_bieti_Cercopithecidae_Haplorrhini_XP_017714647.1_LOC108519885: 0.043327): 0.017929): 0.039116, Pan_troglodytes_Hominidae_Haplorrhini_NP_001266704.1_PATR-DRB5: 0.058437): 0.010965, Pongo_abelii_Hominidae_Haplorrhini_XP_003776854.2_LOC100456477: 0.062766): 0.018950);
Detailed output identifying parameters
kappa (ts/tv) = 3.58284
Parameters in M8 (beta&w>1):
p0= 0.90659 p= 0.44529 q= 1.33302
(p1= 0.09341) w= 4.39342
dN/dS (w) for site classes (K=11)
p: 0.09066 0.09066 0.09066 0.09066 0.09066 0.09066 0.09066 0.09066 0.09066 0.09066 0.09341
w: 0.00084 0.00994 0.03145 0.06752 0.12025 0.19214 0.28664 0.40916 0.56991 0.79717 4.39342
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.052 595.6 199.4 0.6357 0.0151 0.0237 9.0 4.7
8..3 0.036 595.6 199.4 0.6357 0.0104 0.0163 6.2 3.2
8..9 0.019 595.6 199.4 0.6357 0.0055 0.0087 3.3 1.7
9..10 0.011 595.6 199.4 0.6357 0.0032 0.0050 1.9 1.0
10..11 0.039 595.6 199.4 0.6357 0.0114 0.0179 6.8 3.6
11..2 0.569 595.6 199.4 0.6357 0.1658 0.2608 98.7 52.0
11..12 0.018 595.6 199.4 0.6357 0.0052 0.0082 3.1 1.6
12..4 0.072 595.6 199.4 0.6357 0.0209 0.0329 12.5 6.6
12..7 0.043 595.6 199.4 0.6357 0.0126 0.0199 7.5 4.0
10..5 0.058 595.6 199.4 0.6357 0.0170 0.0268 10.1 5.3
9..6 0.063 595.6 199.4 0.6357 0.0183 0.0288 10.9 5.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.661 3.108
14 K 0.985* 4.340
38 Q 0.757 3.486
40 D 0.534 2.622
42 Y 0.963* 4.256
55 F 0.985* 4.339
59 D 0.951* 4.212
66 D 0.828 3.750
67 L 0.901 4.022
95 F 0.984* 4.336
98 D 0.997** 4.384
99 R 0.692 3.221
102 A 0.825 3.740
106 Y 0.971* 4.287
114 G 0.985* 4.337
118 T 0.797 3.625
124 E 0.962* 4.252
185 T 0.644 3.043
243 A 0.871 3.914
259 H 0.603 2.885
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.571 2.856 +- 2.258
14 K 0.975* 4.930 +- 1.855
38 Q 0.640 3.168 +- 2.234
42 Y 0.946 4.797 +- 1.964
55 F 0.978* 4.949 +- 1.848
59 D 0.898 4.509 +- 2.057
66 D 0.719 3.569 +- 2.253
67 L 0.870 4.438 +- 2.183
95 F 0.976* 4.937 +- 1.855
98 D 0.996** 5.032 +- 1.772
99 R 0.608 3.059 +- 2.323
102 A 0.719 3.575 +- 2.260
106 Y 0.952* 4.813 +- 1.935
114 G 0.975* 4.934 +- 1.856
118 T 0.720 3.625 +- 2.337
124 E 0.919 4.623 +- 2.009
185 T 0.563 2.833 +- 2.273
243 A 0.782 3.905 +- 2.236
259 H 0.517 2.586 +- 2.178
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011 0.403 0.586
p : 0.154 0.399 0.286 0.124 0.032 0.005 0.000 0.000 0.000 0.000
q : 0.000 0.090 0.051 0.103 0.098 0.108 0.124 0.133 0.141 0.150
ws: 0.001 0.098 0.258 0.162 0.186 0.153 0.085 0.037 0.015 0.005
Time used: 1:10
Model 8: beta&w>1 -2002.415363
Model 7: beta -2013.086717
Model 1: NearlyNeutral -2012.263927
Model 2: PositiveSelection -2002.425163
Model 2 vs 1 19.67752799999971
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.593 3.085
14 K 0.962* 4.446
38 Q 0.647 3.312
42 Y 0.929 4.329
55 F 0.963* 4.451
59 D 0.885 4.171
66 D 0.730 3.610
67 L 0.847 4.030
95 F 0.961* 4.442
98 D 0.992** 4.554
99 R 0.641 3.255
102 A 0.727 3.599
106 Y 0.939 4.363
114 G 0.961* 4.442
118 T 0.733 3.607
124 E 0.906 4.248
185 T 0.580 3.035
243 A 0.786 3.812
259 H 0.536 2.870
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
14 K 0.939 5.211 +- 2.037
38 Q 0.517 2.982 +- 2.230
42 Y 0.897 5.014 +- 2.172
55 F 0.949 5.278 +- 2.013
59 D 0.787 4.346 +- 2.291
66 D 0.595 3.358 +- 2.306
67 L 0.798 4.527 +- 2.395
95 F 0.943 5.246 +- 2.030
98 D 0.989* 5.475 +- 1.846
99 R 0.530 3.083 +- 2.368
102 A 0.595 3.367 +- 2.316
106 Y 0.897 4.986 +- 2.148
114 G 0.941 5.235 +- 2.035
118 T 0.629 3.585 +- 2.429
124 E 0.821 4.530 +- 2.253
243 A 0.662 3.705 +- 2.351
Model 8 vs 7 21.342707999999675
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.661 3.108
14 K 0.985* 4.340
38 Q 0.757 3.486
40 D 0.534 2.622
42 Y 0.963* 4.256
55 F 0.985* 4.339
59 D 0.951* 4.212
66 D 0.828 3.750
67 L 0.901 4.022
95 F 0.984* 4.336
98 D 0.997** 4.384
99 R 0.692 3.221
102 A 0.825 3.740
106 Y 0.971* 4.287
114 G 0.985* 4.337
118 T 0.797 3.625
124 E 0.962* 4.252
185 T 0.644 3.043
243 A 0.871 3.914
259 H 0.603 2.885
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Homo_sapiens_Hominidae_Haplorrhini_NP_002116.2_HLA-DRB5)
Pr(w>1) post mean +- SE for w
3 C 0.571 2.856 +- 2.258
14 K 0.975* 4.930 +- 1.855
38 Q 0.640 3.168 +- 2.234
42 Y 0.946 4.797 +- 1.964
55 F 0.978* 4.949 +- 1.848
59 D 0.898 4.509 +- 2.057
66 D 0.719 3.569 +- 2.253
67 L 0.870 4.438 +- 2.183
95 F 0.976* 4.937 +- 1.855
98 D 0.996** 5.032 +- 1.772
99 R 0.608 3.059 +- 2.323
102 A 0.719 3.575 +- 2.260
106 Y 0.952* 4.813 +- 1.935
114 G 0.975* 4.934 +- 1.856
118 T 0.720 3.625 +- 2.337
124 E 0.919 4.623 +- 2.009
185 T 0.563 2.833 +- 2.273
243 A 0.782 3.905 +- 2.236
259 H 0.517 2.586 +- 2.178
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
